3LE4A

Crystal structure of the dgcr8 dimerization domain
Total Genus 3
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
3
sequence length
55
structure length
55
Chain Sequence
PPTEPLPDGWIMTFHNSGVPVYLHRESRVVTWSRPYFLGTGSIRKHDPPLSSIPC
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Nuclear protein
molecule keywords Microprocessor complex subunit DGCR8
publication title Structure of the dimerization domain of DiGeorge Critical Region 8
pubmed doi rcsb
source organism Homo sapiens
total genus 3
structure length 55
sequence length 55
ec nomenclature
pdb deposition date 2010-01-14
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.20.70.10 Mainly Beta Single Sheet Ubiquitin Ligase Nedd4; Chain: W; Ubiquitin Ligase Nedd4; Chain: W; 3le4A00
2JX8A 2ZR6A 2ZAJA 3KAIA 3M7NA 2YSGA 1PINA 4E5RA 2E45A 2ZQVA 3TCZA 2ZQTA 4U84A 1EG3A 2DK7A 2RE3A 2EZ5W 2ZQUA 2XP6A 2XPAA 2ZR4A 5CQ2A 2XP4A 1YW5A 3KAHA 3LE4A 3KAGA 2XPBA 2F21A 1K9QA 2YSBA 2DK1A 2ZQSA 1WMVA 2M8JA 2Q5AA 2XP5A 3OOBA 4REXA 5AHTA 1JMQA 1I5HW 2ITKA 2XP8A 2YSIA 2L4JA 3M85A 2XP7A 2M8IA 2MDIA 2YSFA 3CNGA 3KADA 2DJYA 1O6WA 3KCEA 2JXWA 2DMVA 4U86A 1NMVA 2DWVA 4QIBA 2JMFA 2XP3A 2ZR5A 2M3OW 2XP9A 1F8AB 1TK7A 1EG4A 2KXQA 3WH0A 3TC5A 4U85A 2BA1A 3ODKA 3KABA 3L4HA 1WR7A 2JV4A 3KAFA 2YSHA 3TDBA 1K9RA 3NTPA 2LAJA 1ZCNA
chains in the Genus database with same CATH superfamily
2JX8A 2ZR6A 3MCBB 3LKXA 2ZAJA 3KAIA 3MQHA 3M7NA 2YSGA 1PINA 3FSBA 4E5RA 2E45A 2ZQVA 3TCZA 2ZQTA 5E66A 2Y8NB 4U84A 1EG3A 2DK7A 5E5WA 4A0UA 5U47A 2WAEA 2RE3A 2EZ5W 2ZQUA 2XP6A 2XPAA 2ZR4A 5CQ2A 5E64A 2XP4A 1YW5A 1FLCA 3KAHA 3LE4A 3KAGA 3MCBA 2XPBA 2F21A 1K9QA 2QRVA 2YSBA 2DK1A 3PQHA 2ZQSA 1WMVA 2M8JA 2Q5AA 2XP5A 3OOBA 3FS8A 5E65A 4REXA 5AHTA 1JMQA 2WADA 1I5HW 3LKXB 2ITKA 2XP8A 2YSIA 2L4JA 3M85A 2XP7A 2M8IA 2MDIA 1RP5A 2YSFA 3CNGA 3KADA 2DJYA 3FSCA 1O6WA 3KCEA 2JXWA 4GLXA 2DMVA 2YAJB 4U86A 1NMVA 2DWVA 4A0TA 4QIBA 2JMFA 2XP3A 2ZR5A 2M3OW 2XP9A 1F8AB 1TK7A 1EG4A 2OWOA 2KXQA 3WH0A 3TC5A 4U85A 2BA1A 3ODKA 3KABA 3L4HA 1WR7A 1TR8A 2JV4A 3KAFA 3MQGA 2YSHA 3TDBA 1K9RA 3NTPA 5E62A 2LAJA 1ZCNA
chains in the Genus database with same CATH topology
2JX8A 2ZR6A 3MCBB 3LKXA 2ZAJA 3KAIA 3MQHA 3M7NA 2YSGA 1PINA 3FSBA 4E5RA 2E45A 2ZQVA 3TCZA 2ZQTA 5E66A 2Y8NB 4U84A 1EG3A 2DK7A 5E5WA 4A0UA 5U47A 2WAEA 2RE3A 2EZ5W 2ZQUA 2XP6A 2XPAA 2ZR4A 5CQ2A 5E64A 2XP4A 1YW5A 1FLCA 3KAHA 3LE4A 3KAGA 3MCBA 2XPBA 2F21A 1K9QA 2QRVA 2YSBA 2DK1A 3PQHA 2ZQSA 1WMVA 2M8JA 2Q5AA 2XP5A 3OOBA 3FS8A 5E65A 4REXA 5AHTA 1JMQA 2WADA 1I5HW 3LKXB 2ITKA 2XP8A 2YSIA 2L4JA 3M85A 2XP7A 2M8IA 2MDIA 1RP5A 2YSFA 3CNGA 3KADA 2DJYA 3FSCA 1O6WA 3KCEA 2JXWA 4GLXA 2DMVA 2YAJB 4U86A 1NMVA 2DWVA 4A0TA 4QIBA 2JMFA 2XP3A 2ZR5A 2M3OW 2XP9A 1F8AB 1TK7A 1EG4A 2OWOA 2KXQA 3WH0A 3TC5A 4U85A 2BA1A 3ODKA 3KABA 3L4HA 1WR7A 1TR8A 2JV4A 3KAFA 3MQGA 2YSHA 3TDBA 1K9RA 3NTPA 5E62A 2LAJA 1ZCNA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2JX8 A;  2ZR6 A;  2ZAJ A;  3KAI A;  3M7N A;  2YSG A;  1PIN A;  4E5R A;  2E45 A;  2ZQV A;  3TCZ A;  2ZQT A;  4U84 A;  1EG3 A;  2DK7 A;  2RE3 A;  2EZ5 W;  2ZQU A;  2XP6 A;  2XPA A;  2ZR4 A;  5CQ2 A;  2XP4 A;  1YW5 A;  3KAH A;  3LE4 A;  3KAG A;  2XPB A;  2F21 A;  1K9Q A;  2YSB A;  2DK1 A;  2ZQS A;  1WMV A;  2M8J A;  2Q5A A;  2XP5 A;  3OOB A;  4REX A;  5AHT A;  1JMQ A;  1I5H W;  2ITK A;  2XP8 A;  2YSI A;  2L4J A;  3M85 A;  2XP7 A;  2M8I A;  2MDI A;  2YSF A;  3CNG A;  3KAD A;  2DJY A;  1O6W A;  3KCE A;  2JXW A;  2DMV A;  4U86 A;  1NMV A;  2DWV A;  4QIB A;  2JMF A;  2XP3 A;  2ZR5 A;  2M3O W;  2XP9 A;  1F8A B;  1TK7 A;  1EG4 A;  2KXQ A;  3WH0 A;  3TC5 A;  4U85 A;  2BA1 A;  3ODK A;  3KAB A;  3L4H A;  1WR7 A;  2JV4 A;  3KAF A;  2YSH A;  3TDB A;  1K9R A;  3NTP A;  2LAJ A;  1ZCN A; 
#chains in the Genus database with same CATH topology
 2JX8 A;  2ZR6 A;  3MCB B;  3LKX A;  2ZAJ A;  3KAI A;  3MQH A;  3M7N A;  2YSG A;  1PIN A;  3FSB A;  4E5R A;  2E45 A;  2ZQV A;  3TCZ A;  2ZQT A;  5E66 A;  2Y8N B;  4U84 A;  1EG3 A;  2DK7 A;  5E5W A;  4A0U A;  5U47 A;  2WAE A;  2RE3 A;  2EZ5 W;  2ZQU A;  2XP6 A;  2XPA A;  2ZR4 A;  5CQ2 A;  5E64 A;  2XP4 A;  1YW5 A;  1FLC A;  3KAH A;  3LE4 A;  3KAG A;  3MCB A;  2XPB A;  2F21 A;  1K9Q A;  2QRV A;  2YSB A;  2DK1 A;  3PQH A;  2ZQS A;  1WMV A;  2M8J A;  2Q5A A;  2XP5 A;  3OOB A;  3FS8 A;  5E65 A;  4REX A;  5AHT A;  1JMQ A;  2WAD A;  1I5H W;  3LKX B;  2ITK A;  2XP8 A;  2YSI A;  2L4J A;  3M85 A;  2XP7 A;  2M8I A;  2MDI A;  1RP5 A;  2YSF A;  3CNG A;  3KAD A;  2DJY A;  3FSC A;  1O6W A;  3KCE A;  2JXW A;  4GLX A;  2DMV A;  2YAJ B;  4U86 A;  1NMV A;  2DWV A;  4A0T A;  4QIB A;  2JMF A;  2XP3 A;  2ZR5 A;  2M3O W;  2XP9 A;  1F8A B;  1TK7 A;  1EG4 A;  2OWO A;  2KXQ A;  3WH0 A;  3TC5 A;  4U85 A;  2BA1 A;  3ODK A;  3KAB A;  3L4H A;  1WR7 A;  1TR8 A;  2JV4 A;  3KAF A;  3MQG A;  2YSH A;  3TDB A;  1K9R A;  3NTP A;  5E62 A;  2LAJ A;  1ZCN A; 
#chains in the Genus database with same CATH homology
 2JX8 A;  2ZR6 A;  3MCB B;  3LKX A;  2ZAJ A;  3KAI A;  3MQH A;  3M7N A;  2YSG A;  1PIN A;  3FSB A;  4E5R A;  2E45 A;  2ZQV A;  3TCZ A;  2ZQT A;  5E66 A;  2Y8N B;  4U84 A;  1EG3 A;  2DK7 A;  5E5W A;  4A0U A;  5U47 A;  2WAE A;  2RE3 A;  2EZ5 W;  2ZQU A;  2XP6 A;  2XPA A;  2ZR4 A;  5CQ2 A;  5E64 A;  2XP4 A;  1YW5 A;  1FLC A;  3KAH A;  3LE4 A;  3KAG A;  3MCB A;  2XPB A;  2F21 A;  1K9Q A;  2QRV A;  2YSB A;  2DK1 A;  3PQH A;  2ZQS A;  1WMV A;  2M8J A;  2Q5A A;  2XP5 A;  3OOB A;  3FS8 A;  5E65 A;  4REX A;  5AHT A;  1JMQ A;  2WAD A;  1I5H W;  3LKX B;  2ITK A;  2XP8 A;  2YSI A;  2L4J A;  3M85 A;  2XP7 A;  2M8I A;  2MDI A;  1RP5 A;  2YSF A;  3CNG A;  3KAD A;  2DJY A;  3FSC A;  1O6W A;  3KCE A;  2JXW A;  4GLX A;  2DMV A;  2YAJ B;  4U86 A;  1NMV A;  2DWV A;  4A0T A;  4QIB A;  2JMF A;  2XP3 A;  2ZR5 A;  2M3O W;  2XP9 A;  1F8A B;  1TK7 A;  1EG4 A;  2OWO A;  2KXQ A;  3WH0 A;  3TC5 A;  4U85 A;  2BA1 A;  3ODK A;  3KAB A;  3L4H A;  1WR7 A;  1TR8 A;  2JV4 A;  3KAF A;  3MQG A;  2YSH A;  3TDB A;  1K9R A;  3NTP A;  5E62 A;  2LAJ A;  1ZCN A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...