2JX8A

Solution structure of hpcif1 ww domain
Total Genus 3
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
3
sequence length
47
structure length
47
Chain Sequence
LPEELVHAGWEKCWSRRENRPYYFNRFTNQSLWEMPVLGQHDVISDP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Phosphorylated CTD-interacting factor 1
publication title 1H, 13C, and 15N resonance assignments of hPCIF1 WW domain
rcsb
source organism Homo sapiens
molecule tags Transcription
total genus 3
structure length 47
sequence length 47
ec nomenclature ec 2.1.1.62: mRNA (2'-O-methyladenosine-N(6)-)-methyltransferase.
pdb deposition date 2007-11-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00397 WW WW domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.20.70.10 Mainly Beta Single Sheet Ubiquitin Ligase Nedd4; Chain: W; Ubiquitin Ligase Nedd4; Chain: W; 2jx8A00
2DWVA 2M8IA 2LAJA 3ODKA 2ZAJA 4E5RA 2M8JA 1EG3A 2XP6A 2ZR6A 3TC5A 2ZQTA 2XP9A 1JMQA 2YSBA 2Q5AA 1F8AB 3OOBA 5AHTA 4U85A 2XP5A 2XP4A 3TCZA 3NTPA 3KAHA 2BA1A 2M3OW 3LE4A 3M85A 2ZQUA 1PINA 1O6WA 3TDBA 3KAIA 4QIBA 2F21A 3KAGA 1NMVA 1ZCNA 2RE3A 2JV4A 4U84A 2YSFA 2DK1A 2MDIA 3L4HA 2ZQVA 1WR7A 2ZR4A 1YW5A 2DK7A 3KABA 3WH0A 2ITKA 1WMVA 2YSHA 2JX8A 1EG4A 4U86A 2XP3A 2DJYA 3KCEA 1K9RA 1K9QA 3CNGA 2KXQA 2L4JA 2E45A 2XPAA 2JMFA 2YSIA 2XP8A 3KADA 3M7NA 5CQ2A 1TK7A 2ZQSA 1I5HW 3KAFA 2YSGA 2XP7A 2DMVA 4REXA 2JXWA 2XPBA 2EZ5W 2ZR5A
chains in the Genus database with same CATH superfamily
2DWVA 2M8IA 2LAJA 3ODKA 2ZAJA 4E5RA 3MQGA 2M8JA 1EG3A 2XP6A 2ZR6A 3TC5A 3LKXB 2ZQTA 2XP9A 1JMQA 2YSBA 2Q5AA 1F8AB 4GLXA 3OOBA 5AHTA 2Y8NB 4U85A 1FLCA 2XP5A 2XP4A 3PQHA 3TCZA 3NTPA 3KAHA 2BA1A 2M3OW 3LE4A 3M85A 2ZQUA 1PINA 1O6WA 3TDBA 3KAIA 4QIBA 2F21A 3KAGA 1NMVA 1ZCNA 2RE3A 5E65A 3MCBA 3FS8A 2JV4A 4U84A 2YSFA 2DK1A 3FSBA 2MDIA 3L4HA 2ZQVA 4A0UA 1WR7A 2ZR4A 1YW5A 3FSCA 2DK7A 3KABA 3WH0A 5E62A 2ITKA 1WMVA 2YSHA 2JX8A 2WADA 1EG4A 4U86A 2XP3A 2DJYA 3KCEA 1K9RA 5U47A 5E66A 1K9QA 3CNGA 2KXQA 2L4JA 2E45A 2XPAA 2JMFA 1RP5A 3MQHA 2OWOA 3MCBB 2YSIA 2XP8A 2YAJB 3KADA 3M7NA 5CQ2A 2QRVA 1TK7A 2ZQSA 1I5HW 3KAFA 2YSGA 2WAEA 5E5WA 2XP7A 2DMVA 4REXA 4A0TA 2JXWA 2XPBA 5E64A 2EZ5W 3LKXA 2ZR5A 1TR8A
chains in the Genus database with same CATH topology
2DWVA 2M8IA 2LAJA 3ODKA 2ZAJA 4E5RA 3MQGA 2M8JA 1EG3A 2XP6A 2ZR6A 3TC5A 3LKXB 2ZQTA 2XP9A 1JMQA 2YSBA 2Q5AA 1F8AB 4GLXA 3OOBA 5AHTA 2Y8NB 4U85A 1FLCA 2XP5A 2XP4A 3PQHA 3TCZA 3NTPA 3KAHA 2BA1A 2M3OW 3LE4A 3M85A 2ZQUA 1PINA 1O6WA 3TDBA 3KAIA 4QIBA 2F21A 3KAGA 1NMVA 1ZCNA 2RE3A 5E65A 3MCBA 3FS8A 2JV4A 4U84A 2YSFA 2DK1A 3FSBA 2MDIA 3L4HA 2ZQVA 4A0UA 1WR7A 2ZR4A 1YW5A 3FSCA 2DK7A 3KABA 3WH0A 5E62A 2ITKA 1WMVA 2YSHA 2JX8A 2WADA 1EG4A 4U86A 2XP3A 2DJYA 3KCEA 1K9RA 5U47A 5E66A 1K9QA 3CNGA 2KXQA 2L4JA 2E45A 2XPAA 2JMFA 1RP5A 3MQHA 2OWOA 3MCBB 2YSIA 2XP8A 2YAJB 3KADA 3M7NA 5CQ2A 2QRVA 1TK7A 2ZQSA 1I5HW 3KAFA 2YSGA 2WAEA 5E5WA 2XP7A 2DMVA 4REXA 4A0TA 2JXWA 2XPBA 5E64A 2EZ5W 3LKXA 2ZR5A 1TR8A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2DWV A;  2M8I A;  2LAJ A;  3ODK A;  2ZAJ A;  4E5R A;  2M8J A;  1EG3 A;  2XP6 A;  2ZR6 A;  3TC5 A;  2ZQT A;  2XP9 A;  1JMQ A;  2YSB A;  2Q5A A;  1F8A B;  3OOB A;  5AHT A;  4U85 A;  2XP5 A;  2XP4 A;  3TCZ A;  3NTP A;  3KAH A;  2BA1 A;  2M3O W;  3LE4 A;  3M85 A;  2ZQU A;  1PIN A;  1O6W A;  3TDB A;  3KAI A;  4QIB A;  2F21 A;  3KAG A;  1NMV A;  1ZCN A;  2RE3 A;  2JV4 A;  4U84 A;  2YSF A;  2DK1 A;  2MDI A;  3L4H A;  2ZQV A;  1WR7 A;  2ZR4 A;  1YW5 A;  2DK7 A;  3KAB A;  3WH0 A;  2ITK A;  1WMV A;  2YSH A;  2JX8 A;  1EG4 A;  4U86 A;  2XP3 A;  2DJY A;  3KCE A;  1K9R A;  1K9Q A;  3CNG A;  2KXQ A;  2L4J A;  2E45 A;  2XPA A;  2JMF A;  2YSI A;  2XP8 A;  3KAD A;  3M7N A;  5CQ2 A;  1TK7 A;  2ZQS A;  1I5H W;  3KAF A;  2YSG A;  2XP7 A;  2DMV A;  4REX A;  2JXW A;  2XPB A;  2EZ5 W;  2ZR5 A; 
#chains in the Genus database with same CATH topology
 2DWV A;  2M8I A;  2LAJ A;  3ODK A;  2ZAJ A;  4E5R A;  3MQG A;  2M8J A;  1EG3 A;  2XP6 A;  2ZR6 A;  3TC5 A;  3LKX B;  2ZQT A;  2XP9 A;  1JMQ A;  2YSB A;  2Q5A A;  1F8A B;  4GLX A;  3OOB A;  5AHT A;  2Y8N B;  4U85 A;  1FLC A;  2XP5 A;  2XP4 A;  3PQH A;  3TCZ A;  3NTP A;  3KAH A;  2BA1 A;  2M3O W;  3LE4 A;  3M85 A;  2ZQU A;  1PIN A;  1O6W A;  3TDB A;  3KAI A;  4QIB A;  2F21 A;  3KAG A;  1NMV A;  1ZCN A;  2RE3 A;  5E65 A;  3MCB A;  3FS8 A;  2JV4 A;  4U84 A;  2YSF A;  2DK1 A;  3FSB A;  2MDI A;  3L4H A;  2ZQV A;  4A0U A;  1WR7 A;  2ZR4 A;  1YW5 A;  3FSC A;  2DK7 A;  3KAB A;  3WH0 A;  5E62 A;  2ITK A;  1WMV A;  2YSH A;  2JX8 A;  2WAD A;  1EG4 A;  4U86 A;  2XP3 A;  2DJY A;  3KCE A;  1K9R A;  5U47 A;  5E66 A;  1K9Q A;  3CNG A;  2KXQ A;  2L4J A;  2E45 A;  2XPA A;  2JMF A;  1RP5 A;  3MQH A;  2OWO A;  3MCB B;  2YSI A;  2XP8 A;  2YAJ B;  3KAD A;  3M7N A;  5CQ2 A;  2QRV A;  1TK7 A;  2ZQS A;  1I5H W;  3KAF A;  2YSG A;  2WAE A;  5E5W A;  2XP7 A;  2DMV A;  4REX A;  4A0T A;  2JXW A;  2XPB A;  5E64 A;  2EZ5 W;  3LKX A;  2ZR5 A;  1TR8 A; 
#chains in the Genus database with same CATH homology
 2DWV A;  2M8I A;  2LAJ A;  3ODK A;  2ZAJ A;  4E5R A;  3MQG A;  2M8J A;  1EG3 A;  2XP6 A;  2ZR6 A;  3TC5 A;  3LKX B;  2ZQT A;  2XP9 A;  1JMQ A;  2YSB A;  2Q5A A;  1F8A B;  4GLX A;  3OOB A;  5AHT A;  2Y8N B;  4U85 A;  1FLC A;  2XP5 A;  2XP4 A;  3PQH A;  3TCZ A;  3NTP A;  3KAH A;  2BA1 A;  2M3O W;  3LE4 A;  3M85 A;  2ZQU A;  1PIN A;  1O6W A;  3TDB A;  3KAI A;  4QIB A;  2F21 A;  3KAG A;  1NMV A;  1ZCN A;  2RE3 A;  5E65 A;  3MCB A;  3FS8 A;  2JV4 A;  4U84 A;  2YSF A;  2DK1 A;  3FSB A;  2MDI A;  3L4H A;  2ZQV A;  4A0U A;  1WR7 A;  2ZR4 A;  1YW5 A;  3FSC A;  2DK7 A;  3KAB A;  3WH0 A;  5E62 A;  2ITK A;  1WMV A;  2YSH A;  2JX8 A;  2WAD A;  1EG4 A;  4U86 A;  2XP3 A;  2DJY A;  3KCE A;  1K9R A;  5U47 A;  5E66 A;  1K9Q A;  3CNG A;  2KXQ A;  2L4J A;  2E45 A;  2XPA A;  2JMF A;  1RP5 A;  3MQH A;  2OWO A;  3MCB B;  2YSI A;  2XP8 A;  2YAJ B;  3KAD A;  3M7N A;  5CQ2 A;  2QRV A;  1TK7 A;  2ZQS A;  1I5H W;  3KAF A;  2YSG A;  2WAE A;  5E5W A;  2XP7 A;  2DMV A;  4REX A;  4A0T A;  2JXW A;  2XPB A;  5E64 A;  2EZ5 W;  3LKX A;  2ZR5 A;  1TR8 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...