2JX8A

Solution structure of hpcif1 ww domain
Total Genus 3
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
3
sequence length
47
structure length
47
Chain Sequence
LPEELVHAGWEKCWSRRENRPYYFNRFTNQSLWEMPVLGQHDVISDP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transcription
molecule keywords Phosphorylated CTD-interacting factor 1
publication title 1H, 13C, and 15N resonance assignments of hPCIF1 WW domain
rcsb
source organism Homo sapiens
total genus 3
structure length 47
sequence length 47
ec nomenclature ec 2.1.1.62: mRNA (2'-O-methyladenosine-N(6)-)-methyltransferase.
pdb deposition date 2007-11-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00397 WW WW domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.20.70.10 Mainly Beta Single Sheet Ubiquitin Ligase Nedd4; Chain: W; Ubiquitin Ligase Nedd4; Chain: W; 2jx8A00
2MDIA 3LE4A 1JMQA 2YSFA 1TK7A 2JMFA 2E45A 2YSHA 3OOBA 2M8IA 4E5RA 3KADA 3KAIA 2ZAJA 3ODKA 3TDBA 2XP8A 2DK1A 4QIBA 2BA1A 5AHTA 4U86A 2XPAA 1YW5A 2LAJA 1K9RA 2JV4A 3NTPA 2XPBA 1I5HW 4U84A 1ZCNA 1EG4A 3KAHA 2YSIA 1K9QA 2F21A 2Q5AA 2DWVA 1WMVA 3TCZA 2XP5A 2XP3A 2M3OW 2ITKA 2XP7A 2KXQA 3KAGA 2DK7A 1EG3A 1PINA 2ZR6A 2YSBA 2XP6A 2ZQTA 5CQ2A 2ZQVA 2ZQUA 3WH0A 4REXA 2DMVA 3KCEA 2ZR4A 3L4HA 3M85A 3KABA 1WR7A 4U85A 2RE3A 3TC5A 2JXWA 1F8AB 2XP9A 3M7NA 2M8JA 2L4JA 2ZR5A 2EZ5W 2DJYA 1O6WA 3KAFA 2ZQSA 2YSGA 3CNGA 2XP4A 2JX8A 1NMVA
chains in the Genus database with same CATH superfamily
2MDIA 3LE4A 1JMQA 3PQHA 2YSFA 1TK7A 2JMFA 2E45A 2YSHA 5U47A 5E5WA 3MCBA 2OWOA 3OOBA 2M8IA 4E5RA 3KADA 3KAIA 2ZAJA 3ODKA 3TDBA 2XP8A 2DK1A 3MCBB 4QIBA 2BA1A 5AHTA 3FS8A 3MQGA 4U86A 2QRVA 2XPAA 1YW5A 3FSCA 2Y8NB 2LAJA 4GLXA 1K9RA 3MQHA 2JV4A 2WAEA 3FSBA 3NTPA 2XPBA 5E66A 1I5HW 4U84A 1ZCNA 1FLCA 1EG4A 3KAHA 2YSIA 1K9QA 2F21A 2Q5AA 2DWVA 1WMVA 3TCZA 2XP5A 2XP3A 2M3OW 2ITKA 2XP7A 2KXQA 3KAGA 2DK7A 1EG3A 5E65A 1PINA 2ZR6A 2YSBA 2XP6A 2ZQTA 4A0TA 3LKXA 5CQ2A 1TR8A 2ZQVA 2ZQUA 3WH0A 4REXA 2DMVA 3KCEA 2ZR4A 3L4HA 3M85A 5E62A 3KABA 1WR7A 4A0UA 4U85A 2RE3A 2YAJB 3LKXB 3TC5A 2JXWA 1F8AB 2XP9A 3M7NA 2M8JA 5E64A 2L4JA 1RP5A 2ZR5A 2EZ5W 2WADA 2DJYA 1O6WA 3KAFA 2ZQSA 2YSGA 3CNGA 2XP4A 2JX8A 1NMVA
chains in the Genus database with same CATH topology
2MDIA 3LE4A 1JMQA 3PQHA 2YSFA 1TK7A 2JMFA 2E45A 2YSHA 5U47A 5E5WA 3MCBA 2OWOA 3OOBA 2M8IA 4E5RA 3KADA 3KAIA 2ZAJA 3ODKA 3TDBA 2XP8A 2DK1A 3MCBB 4QIBA 2BA1A 5AHTA 3FS8A 3MQGA 4U86A 2QRVA 2XPAA 1YW5A 3FSCA 2Y8NB 2LAJA 4GLXA 1K9RA 3MQHA 2JV4A 2WAEA 3FSBA 3NTPA 2XPBA 5E66A 1I5HW 4U84A 1ZCNA 1FLCA 1EG4A 3KAHA 2YSIA 1K9QA 2F21A 2Q5AA 2DWVA 1WMVA 3TCZA 2XP5A 2XP3A 2M3OW 2ITKA 2XP7A 2KXQA 3KAGA 2DK7A 1EG3A 5E65A 1PINA 2ZR6A 2YSBA 2XP6A 2ZQTA 4A0TA 3LKXA 5CQ2A 1TR8A 2ZQVA 2ZQUA 3WH0A 4REXA 2DMVA 3KCEA 2ZR4A 3L4HA 3M85A 5E62A 3KABA 1WR7A 4A0UA 4U85A 2RE3A 2YAJB 3LKXB 3TC5A 2JXWA 1F8AB 2XP9A 3M7NA 2M8JA 5E64A 2L4JA 1RP5A 2ZR5A 2EZ5W 2WADA 2DJYA 1O6WA 3KAFA 2ZQSA 2YSGA 3CNGA 2XP4A 2JX8A 1NMVA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2MDI A;  3LE4 A;  1JMQ A;  2YSF A;  1TK7 A;  2JMF A;  2E45 A;  2YSH A;  3OOB A;  2M8I A;  4E5R A;  3KAD A;  3KAI A;  2ZAJ A;  3ODK A;  3TDB A;  2XP8 A;  2DK1 A;  4QIB A;  2BA1 A;  5AHT A;  4U86 A;  2XPA A;  1YW5 A;  2LAJ A;  1K9R A;  2JV4 A;  3NTP A;  2XPB A;  1I5H W;  4U84 A;  1ZCN A;  1EG4 A;  3KAH A;  2YSI A;  1K9Q A;  2F21 A;  2Q5A A;  2DWV A;  1WMV A;  3TCZ A;  2XP5 A;  2XP3 A;  2M3O W;  2ITK A;  2XP7 A;  2KXQ A;  3KAG A;  2DK7 A;  1EG3 A;  1PIN A;  2ZR6 A;  2YSB A;  2XP6 A;  2ZQT A;  5CQ2 A;  2ZQV A;  2ZQU A;  3WH0 A;  4REX A;  2DMV A;  3KCE A;  2ZR4 A;  3L4H A;  3M85 A;  3KAB A;  1WR7 A;  4U85 A;  2RE3 A;  3TC5 A;  2JXW A;  1F8A B;  2XP9 A;  3M7N A;  2M8J A;  2L4J A;  2ZR5 A;  2EZ5 W;  2DJY A;  1O6W A;  3KAF A;  2ZQS A;  2YSG A;  3CNG A;  2XP4 A;  2JX8 A;  1NMV A; 
#chains in the Genus database with same CATH topology
 2MDI A;  3LE4 A;  1JMQ A;  3PQH A;  2YSF A;  1TK7 A;  2JMF A;  2E45 A;  2YSH A;  5U47 A;  5E5W A;  3MCB A;  2OWO A;  3OOB A;  2M8I A;  4E5R A;  3KAD A;  3KAI A;  2ZAJ A;  3ODK A;  3TDB A;  2XP8 A;  2DK1 A;  3MCB B;  4QIB A;  2BA1 A;  5AHT A;  3FS8 A;  3MQG A;  4U86 A;  2QRV A;  2XPA A;  1YW5 A;  3FSC A;  2Y8N B;  2LAJ A;  4GLX A;  1K9R A;  3MQH A;  2JV4 A;  2WAE A;  3FSB A;  3NTP A;  2XPB A;  5E66 A;  1I5H W;  4U84 A;  1ZCN A;  1FLC A;  1EG4 A;  3KAH A;  2YSI A;  1K9Q A;  2F21 A;  2Q5A A;  2DWV A;  1WMV A;  3TCZ A;  2XP5 A;  2XP3 A;  2M3O W;  2ITK A;  2XP7 A;  2KXQ A;  3KAG A;  2DK7 A;  1EG3 A;  5E65 A;  1PIN A;  2ZR6 A;  2YSB A;  2XP6 A;  2ZQT A;  4A0T A;  3LKX A;  5CQ2 A;  1TR8 A;  2ZQV A;  2ZQU A;  3WH0 A;  4REX A;  2DMV A;  3KCE A;  2ZR4 A;  3L4H A;  3M85 A;  5E62 A;  3KAB A;  1WR7 A;  4A0U A;  4U85 A;  2RE3 A;  2YAJ B;  3LKX B;  3TC5 A;  2JXW A;  1F8A B;  2XP9 A;  3M7N A;  2M8J A;  5E64 A;  2L4J A;  1RP5 A;  2ZR5 A;  2EZ5 W;  2WAD A;  2DJY A;  1O6W A;  3KAF A;  2ZQS A;  2YSG A;  3CNG A;  2XP4 A;  2JX8 A;  1NMV A; 
#chains in the Genus database with same CATH homology
 2MDI A;  3LE4 A;  1JMQ A;  3PQH A;  2YSF A;  1TK7 A;  2JMF A;  2E45 A;  2YSH A;  5U47 A;  5E5W A;  3MCB A;  2OWO A;  3OOB A;  2M8I A;  4E5R A;  3KAD A;  3KAI A;  2ZAJ A;  3ODK A;  3TDB A;  2XP8 A;  2DK1 A;  3MCB B;  4QIB A;  2BA1 A;  5AHT A;  3FS8 A;  3MQG A;  4U86 A;  2QRV A;  2XPA A;  1YW5 A;  3FSC A;  2Y8N B;  2LAJ A;  4GLX A;  1K9R A;  3MQH A;  2JV4 A;  2WAE A;  3FSB A;  3NTP A;  2XPB A;  5E66 A;  1I5H W;  4U84 A;  1ZCN A;  1FLC A;  1EG4 A;  3KAH A;  2YSI A;  1K9Q A;  2F21 A;  2Q5A A;  2DWV A;  1WMV A;  3TCZ A;  2XP5 A;  2XP3 A;  2M3O W;  2ITK A;  2XP7 A;  2KXQ A;  3KAG A;  2DK7 A;  1EG3 A;  5E65 A;  1PIN A;  2ZR6 A;  2YSB A;  2XP6 A;  2ZQT A;  4A0T A;  3LKX A;  5CQ2 A;  1TR8 A;  2ZQV A;  2ZQU A;  3WH0 A;  4REX A;  2DMV A;  3KCE A;  2ZR4 A;  3L4H A;  3M85 A;  5E62 A;  3KAB A;  1WR7 A;  4A0U A;  4U85 A;  2RE3 A;  2YAJ B;  3LKX B;  3TC5 A;  2JXW A;  1F8A B;  2XP9 A;  3M7N A;  2M8J A;  5E64 A;  2L4J A;  1RP5 A;  2ZR5 A;  2EZ5 W;  2WAD A;  2DJY A;  1O6W A;  3KAF A;  2ZQS A;  2YSG A;  3CNG A;  2XP4 A;  2JX8 A;  1NMV A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...