2YSFA

Solution structure of the fourth ww domain from the human e3 ubiquitin-protein ligase itchy homolog, itch
Total Genus 1
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
1
sequence length
40
structure length
40
Chain Sequence
GSSGSSGLPEGWEMRFTVDGIPYFVDHNRRTTTYIDPRTG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Protein binding
molecule keywords E3 ubiquitin-protein ligase Itchy homolog
publication title Solution structure of the fourth WW domain from the human E3 ubiquitin-protein ligase Itchy homolog, ITCH
rcsb
source organism Homo sapiens
total genus 1
structure length 40
sequence length 40
ec nomenclature ec 2.3.2.26: HECT-type E3 ubiquitin transferase.
pdb deposition date 2007-04-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00397 WW WW domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.20.70.10 Mainly Beta Single Sheet Ubiquitin Ligase Nedd4; Chain: W; Ubiquitin Ligase Nedd4; Chain: W; 2ysfA01
3OOBA 2ITKA 2JV4A 3M7NA 1EG4A 2DWVA 5AHTA 2ZAJA 3KABA 1F8AB 2EZ5W 2M8IA 2XPBA 1WMVA 4QIBA 2YSHA 4REXA 5CQ2A 2DMVA 2LAJA 3NTPA 2XP7A 2ZQUA 3LE4A 1WR7A 2YSBA 1O6WA 3KCEA 2DK7A 2XPAA 1YW5A 2XP4A 1K9RA 3KADA 3WH0A 2ZQTA 3KAFA 4E5RA 2JMFA 1PINA 3TCZA 2XP9A 2E45A 2F21A 2XP3A 3TDBA 2ZQVA 2DK1A 4U84A 1EG3A 2KXQA 1NMVA 3CNGA 1JMQA 2XP8A 2XP6A 3KAHA 2Q5AA 3KAIA 3L4HA 2YSFA 2BA1A 1I5HW 3TC5A 2ZR6A 2M3OW 3ODKA 2L4JA 2M8JA 2ZR4A 2JX8A 2XP5A 2RE3A 2MDIA 2YSGA 4U86A 1ZCNA 2JXWA 2YSIA 1K9QA 3M85A 1TK7A 2ZQSA 3KAGA 2ZR5A 2DJYA 4U85A
chains in the Genus database with same CATH superfamily
3OOBA 2ITKA 2JV4A 3M7NA 1EG4A 2DWVA 5AHTA 4GLXA 2ZAJA 3KABA 1F8AB 2EZ5W 2M8IA 2XPBA 1WMVA 3FSCA 5E65A 4QIBA 5U47A 2YSHA 1RP5A 4REXA 4A0UA 5CQ2A 2DMVA 2LAJA 3LKXB 3NTPA 2XP7A 3FSBA 2ZQUA 3LE4A 1WR7A 2YSBA 5E66A 3MCBB 1O6WA 3KCEA 2DK7A 2XPAA 1YW5A 2XP4A 2Y8NB 1K9RA 3KADA 3WH0A 2ZQTA 3KAFA 4E5RA 2JMFA 1PINA 3TCZA 2XP9A 2E45A 5E5WA 2F21A 5E64A 2XP3A 3TDBA 2ZQVA 3LKXA 2DK1A 1EG3A 4U84A 2KXQA 3PQHA 1NMVA 3CNGA 3MCBA 1JMQA 2XP8A 2XP6A 1FLCA 2QRVA 3KAHA 3MQGA 2Q5AA 3KAIA 4A0TA 3L4HA 2YSFA 2BA1A 1I5HW 3TC5A 2ZR6A 2M3OW 3ODKA 2L4JA 2M8JA 2ZR4A 2WADA 2JX8A 3MQHA 2XP5A 2RE3A 2MDIA 2YSGA 3FS8A 4U86A 1ZCNA 2JXWA 2YSIA 1K9QA 3M85A 2OWOA 1TK7A 2YAJB 5E62A 1TR8A 2ZQSA 2WAEA 3KAGA 2ZR5A 2DJYA 4U85A
chains in the Genus database with same CATH topology
3OOBA 2ITKA 2JV4A 3M7NA 1EG4A 2DWVA 5AHTA 4GLXA 2ZAJA 3KABA 1F8AB 2EZ5W 2M8IA 2XPBA 1WMVA 3FSCA 5E65A 4QIBA 5U47A 2YSHA 1RP5A 4REXA 4A0UA 5CQ2A 2DMVA 2LAJA 3LKXB 3NTPA 2XP7A 3FSBA 2ZQUA 3LE4A 1WR7A 2YSBA 5E66A 3MCBB 1O6WA 3KCEA 2DK7A 2XPAA 1YW5A 2XP4A 2Y8NB 1K9RA 3KADA 3WH0A 2ZQTA 3KAFA 4E5RA 2JMFA 1PINA 3TCZA 2XP9A 2E45A 5E5WA 2F21A 5E64A 2XP3A 3TDBA 2ZQVA 3LKXA 2DK1A 1EG3A 4U84A 2KXQA 3PQHA 1NMVA 3CNGA 3MCBA 1JMQA 2XP8A 2XP6A 1FLCA 2QRVA 3KAHA 3MQGA 2Q5AA 3KAIA 4A0TA 3L4HA 2YSFA 2BA1A 1I5HW 3TC5A 2ZR6A 2M3OW 3ODKA 2L4JA 2M8JA 2ZR4A 2WADA 2JX8A 3MQHA 2XP5A 2RE3A 2MDIA 2YSGA 3FS8A 4U86A 1ZCNA 2JXWA 2YSIA 1K9QA 3M85A 2OWOA 1TK7A 2YAJB 5E62A 1TR8A 2ZQSA 2WAEA 3KAGA 2ZR5A 2DJYA 4U85A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3OOB A;  2ITK A;  2JV4 A;  3M7N A;  1EG4 A;  2DWV A;  5AHT A;  2ZAJ A;  3KAB A;  1F8A B;  2EZ5 W;  2M8I A;  2XPB A;  1WMV A;  4QIB A;  2YSH A;  4REX A;  5CQ2 A;  2DMV A;  2LAJ A;  3NTP A;  2XP7 A;  2ZQU A;  3LE4 A;  1WR7 A;  2YSB A;  1O6W A;  3KCE A;  2DK7 A;  2XPA A;  1YW5 A;  2XP4 A;  1K9R A;  3KAD A;  3WH0 A;  2ZQT A;  3KAF A;  4E5R A;  2JMF A;  1PIN A;  3TCZ A;  2XP9 A;  2E45 A;  2F21 A;  2XP3 A;  3TDB A;  2ZQV A;  2DK1 A;  4U84 A;  1EG3 A;  2KXQ A;  1NMV A;  3CNG A;  1JMQ A;  2XP8 A;  2XP6 A;  3KAH A;  2Q5A A;  3KAI A;  3L4H A;  2YSF A;  2BA1 A;  1I5H W;  3TC5 A;  2ZR6 A;  2M3O W;  3ODK A;  2L4J A;  2M8J A;  2ZR4 A;  2JX8 A;  2XP5 A;  2RE3 A;  2MDI A;  2YSG A;  4U86 A;  1ZCN A;  2JXW A;  2YSI A;  1K9Q A;  3M85 A;  1TK7 A;  2ZQS A;  3KAG A;  2ZR5 A;  2DJY A;  4U85 A; 
#chains in the Genus database with same CATH topology
 3OOB A;  2ITK A;  2JV4 A;  3M7N A;  1EG4 A;  2DWV A;  5AHT A;  4GLX A;  2ZAJ A;  3KAB A;  1F8A B;  2EZ5 W;  2M8I A;  2XPB A;  1WMV A;  3FSC A;  5E65 A;  4QIB A;  5U47 A;  2YSH A;  1RP5 A;  4REX A;  4A0U A;  5CQ2 A;  2DMV A;  2LAJ A;  3LKX B;  3NTP A;  2XP7 A;  3FSB A;  2ZQU A;  3LE4 A;  1WR7 A;  2YSB A;  5E66 A;  3MCB B;  1O6W A;  3KCE A;  2DK7 A;  2XPA A;  1YW5 A;  2XP4 A;  2Y8N B;  1K9R A;  3KAD A;  3WH0 A;  2ZQT A;  3KAF A;  4E5R A;  2JMF A;  1PIN A;  3TCZ A;  2XP9 A;  2E45 A;  5E5W A;  2F21 A;  5E64 A;  2XP3 A;  3TDB A;  2ZQV A;  3LKX A;  2DK1 A;  1EG3 A;  4U84 A;  2KXQ A;  3PQH A;  1NMV A;  3CNG A;  3MCB A;  1JMQ A;  2XP8 A;  2XP6 A;  1FLC A;  2QRV A;  3KAH A;  3MQG A;  2Q5A A;  3KAI A;  4A0T A;  3L4H A;  2YSF A;  2BA1 A;  1I5H W;  3TC5 A;  2ZR6 A;  2M3O W;  3ODK A;  2L4J A;  2M8J A;  2ZR4 A;  2WAD A;  2JX8 A;  3MQH A;  2XP5 A;  2RE3 A;  2MDI A;  2YSG A;  3FS8 A;  4U86 A;  1ZCN A;  2JXW A;  2YSI A;  1K9Q A;  3M85 A;  2OWO A;  1TK7 A;  2YAJ B;  5E62 A;  1TR8 A;  2ZQS A;  2WAE A;  3KAG A;  2ZR5 A;  2DJY A;  4U85 A; 
#chains in the Genus database with same CATH homology
 3OOB A;  2ITK A;  2JV4 A;  3M7N A;  1EG4 A;  2DWV A;  5AHT A;  4GLX A;  2ZAJ A;  3KAB A;  1F8A B;  2EZ5 W;  2M8I A;  2XPB A;  1WMV A;  3FSC A;  5E65 A;  4QIB A;  5U47 A;  2YSH A;  1RP5 A;  4REX A;  4A0U A;  5CQ2 A;  2DMV A;  2LAJ A;  3LKX B;  3NTP A;  2XP7 A;  3FSB A;  2ZQU A;  3LE4 A;  1WR7 A;  2YSB A;  5E66 A;  3MCB B;  1O6W A;  3KCE A;  2DK7 A;  2XPA A;  1YW5 A;  2XP4 A;  2Y8N B;  1K9R A;  3KAD A;  3WH0 A;  2ZQT A;  3KAF A;  4E5R A;  2JMF A;  1PIN A;  3TCZ A;  2XP9 A;  2E45 A;  5E5W A;  2F21 A;  5E64 A;  2XP3 A;  3TDB A;  2ZQV A;  3LKX A;  2DK1 A;  1EG3 A;  4U84 A;  2KXQ A;  3PQH A;  1NMV A;  3CNG A;  3MCB A;  1JMQ A;  2XP8 A;  2XP6 A;  1FLC A;  2QRV A;  3KAH A;  3MQG A;  2Q5A A;  3KAI A;  4A0T A;  3L4H A;  2YSF A;  2BA1 A;  1I5H W;  3TC5 A;  2ZR6 A;  2M3O W;  3ODK A;  2L4J A;  2M8J A;  2ZR4 A;  2WAD A;  2JX8 A;  3MQH A;  2XP5 A;  2RE3 A;  2MDI A;  2YSG A;  3FS8 A;  4U86 A;  1ZCN A;  2JXW A;  2YSI A;  1K9Q A;  3M85 A;  2OWO A;  1TK7 A;  2YAJ B;  5E62 A;  1TR8 A;  2ZQS A;  2WAE A;  3KAG A;  2ZR5 A;  2DJY A;  4U85 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...