3TC5A

Selective targeting of disease-relevant protein binding domains by o-phosphorylated natural product derivatives
Total Genus 47
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
47
sequence length
157
structure length
144
Chain Sequence
LPPGWEKAMSRSSGRVYYFNHITNASQWERPEPARVRCSHLLVKHSQSRRPSSWRQEKITRTKEEALELINGYIQKIKSGEEDFESLASQFSDCSSAKARGDLGAFSRGQMQKPFEDASFALRTGEMSGPVFTDSGIHIILRTE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Peptidyl-prolyl cis-trans isomerase NIMA-interacting 1
publication title Selective targeting of disease-relevant protein binding domains by o-phosphorylated natural product derivatives.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Isomerase/isomerase inhibitor
total genus 47
structure length 144
sequence length 157
ec nomenclature ec 5.2.1.8: Peptidylprolyl isomerase.
pdb deposition date 2011-08-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00397 WW WW domain
A PF00639 Rotamase PPIC-type PPIASE domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.20.70.10 Mainly Beta Single Sheet Ubiquitin Ligase Nedd4; Chain: W; Ubiquitin Ligase Nedd4; Chain: W; 3tc5A01
3.10.50.40 Alpha Beta Roll Chitinase A; domain 3 Chitinase A; domain 3 3tc5A02
1QPLA 2BA1A 2ZQTA 4TNSA 3O5KA 4U86A 1F40A 3KAFA 5I98A 3NI6A 2F21A 3IKDA 2KE0A 3KCEA 1I5HW 2F2DA 1NMVA 3KABA 1FKKA 1FKRA 5D75A 1EYMA 2RUQA 2XP4A 2PV3A 2RUCA 2DG9A 2D9FA 2MNTA 3VAWA 3O5GA 2RURA 1A7XA 3MDYB 2DG3A 2LJ4A 2PPNA 3KACA 2ZQUA 2N87A 2FKEA 2MF9A 2Q5AA 5HUAA 2JZVA 3CNGA 1ZK6A 3UQAA 2ZQVA 1FKGA 2MDIA 4E5RA 2RSEA 3KAHA 4TYOA 3L4HA 5BXJA 2RE3A 4LAYA 1T11A 5HW7A 2YSHA 2OFNA 5CQ2A 4DRJA 4DRQA 1FKLA 4TX0A 4DH0A 3KZ7A 3EY6A 2XP7A 5GPGA 4FAPA 1TK7A 4MGVA 2JMFA 4J4OA 3O5RA 4J4NA 2PPOA 4W9PA 4JFMA 2YSBA 3JYJA 4IQ2A 4U85A 3UI6A 4QT3A 3H9RB 4GIVA 4JFKA 4ODOA 2M2AA 1JNSA 4MSPA 1FKDA 1J4RA 1FAPA 1TCOC 2ITKA 4FN2A 1U79A 4IPXA 1ROUA 2ZQSA 1B6CA 1EQ3A 2F4EA 4O2TA 4DRNA 2LGOA 1NSGA 4G50A 2K8IA 3O5IA 1FD9A 3IHZA 3O5QA 4R0XA 5HWBA 1BKFA 2AWGA 3TCZA 4DRMA 2KXQA 3B7XA 2Y78A 3RGCA 4ITZA 2LKNA 4W9QA 3IK8A 5DITA 1ROTA 2LAJA 1W26A 3LUOA 3RFWA 1D6OA 4TW6A 4QT2A 1JMQA 5HTGA 1KT1A 4ODPA 1M5YA 3LE4A 1FKSA 2XP9A 2XP6A 1FKHA 4QIBA 1FKTA 3UI5A 4DRKA 4GGQA 2DK7A 1K9RA 2ZR4A 2JV4A 1C9HA 3PRBA 4ODRA 1Q1CA 2DG4A 4JFJA 5HW8A 4DRIA 1EG4A 2DMVA 3UI4A 5HKGA 4REXA 1FKFA 4DT4A 2KO7A 1FKBA 1D7JA 3O5MA 1FJDA 3FAPA 2MPHA 2RUDA 1Y0OA 1Q6UA 3UQBA 2XP8A 3KAIA 4G2PA 2KFWA 3IKGA 5J6EA 3NRKA 2E45A 1D7HA 5AHTA 4DRHA 1PINA 1KT0A 2MLXA 2JXWA 3JXVA 4LAVA 4DZ2A 4N19A 3UF8A 4DZ3A 1Q6HA 2L2SA 2MLZA 3O5LA 2YSGA 2PBCA 1YW5A 2M8JA 4ODMA 2VCDA 4W9OA 1HXVA 2M8IA 5DIUA 2YSIA 2IF4A 2ZAJA 4ODLA 2DJYA 2PPPA 2UZ5A 1ZCNA 4LAWA 4U84A 5HWCA 3ODKA 3KADA 2M1IA 1D7IA 2XP3A 2EZ5W 3UQIA 3WH0A 2KGJA 3PRDA 2KR7A 2DK1A 3M7NA 1EG3A 1JNTA 2XP5A 1P5QA 1J6YA 3O5EA 4DROA 1N1AA 2RQSA 2KI3A 4DIPA 1NMWA 3O5PA 4LAXA 1J4HA 3M85A 3O5DA 1PBKA 3O5JA 1JVWA 3O5FA 1F8AB 3KAGA 1FKIA 4ODKA 3TDBA 2JX8A 2MLYA 4NNRA 3O5OA 2PV2A 2XPBA 2ZR5A 1QPFA 1WMVA 1O6WA 3CGNA 3GPKA 1K9QA 5B8IC 3PA7A 2M08A 1QZ2A 2VN1A 5DIVA 4JFIA 4TW7A 2M3OW 2XPAA 2ZR6A 1WR7A 4JFLA 3JYMA 2YSFA 2LPVA 3CGMA 2PV1A 3OOBA 3I6CA 5HT1A 4IQCA 1YATA 3TC5A 1L1PA 1J4IA 4ODQA 2DWVA 4C02B 4BF8A 4DRPA 4TW8A 4JYSA 5HW6A 1R9HA 1FKJA 2L4JA 4ODNA 3NTPA 2FAPA 1BL4A 1Q6IA
chains in the Genus database with same CATH superfamily
4MNKA 1QPLA 2BA1A 2ZQTA 4QZVB 4TNSA 5DO2A 3RMEA 2G8ZA 4P8XA 3O5KA 4U86A 4Z2GA 1F40A 3KAFA 1ZBWA 1IX5A 5I98A 3NI6A 5HBFA 3RM8A 2F21A 3IKDA 3RM9A 2KE0A 1LL6A 3KCEA 1I5HW 2F2DA 3WIJA 1NMVA 3KABA 3LKXB 2WLYA 1ZBCA 1FKKA 1FKRA 3MQHA 5D75A 4L3NA 1EYMA 3WD3A 2RUQA 2ETNA 3BMBA 5GQBA 2XP4A 2PV3A 2RUCA 3AS2A 2DG9A 2DSVA 2D9FA 2MNTA 2A3AA 4ZPVR 3GTYX 5E5WA 2PI6A 1GOIA 3VAWA 2YAJB 2O9OA 3O5GA 2F23A 1A7XA 2RURA 2WM0A 2YBTA 3MDYB 2DG3A 2LJ4A 3PR9A 2DSUA 4ZPTR 1W1PA 2PPNA 3KACA 1W9VA 2ZQUA 2N87A 4DWSB 1E6RA 2FKEA 2MF9A 4P8VA 1W1YA 2Q5AA 5HUAA 3OA5A 2JZVA 3CNGA 1ZK6A 3UQAA 2ZQVA 1FKGA 2MDIA 1UR8A 4DWSC 1WB0A 4E5RA 4WK9A 2RSEA 3KAHA 4TYOA 3ARQA 3L4HA 1UR9A 5BXJA 3CHFA 2RE3A 4LAYA 1EDQA 1T11A 2YSHA 5HW7A 2OFNA 1LL4A 4HBOA 5CQ2A 4DRJA 5DEZA 4DRQA 4MNMA 1KFWA 1FKLA 1OGBA 4TX0A 4DH0A 3KZ7A 3EY6A 1GPFA 4L72B 2XP7A 5U47A 1H0IA 5GPGA 1D2KA 1TK7A 4MGVA 4FAPA 2WK2A 2JMFA 1WNOA 5E66A 4J4OA 4ML4A 2AOSA 3O5RA 4J4NA 2YBUA 2PPOA 4W9PA 2DPEA 4JFMA 1ZB5A 4Z2JA 2YSBA 3JYJA 4WKFA 4XAKA 4IQ2A 4U85A 3UI6A 4QT3A 2O92A 3H9RB 4GIVA 2WADA 3FXYA 4JFKA 2DSZA 4WJXA 1LG2A 4Z2IA 4ODOA 1HJWA 2M2AA 1JNSA 4PTMA 4HARA 4MSPA 1XHGA 2A3CA 1FKDA 1J4RA 3CHDA 1OGGA 1FAPA 1NWUA 1TCOC 2ITKA 4FN2A 3CHEA 4WKHA 3G6LA 4LGXA 5E62A 1U79A 4IPXA 1ROUA 1E15A 2ZQSA 4ZPWR 2DSWA 1B6CA 3B9DA 1EQ3A 2F4EA 3CHCA 4O2TA 4DRNA 2LGOA 1NSGA 4G50A 2K8IA 3O5IA 5E65A 3AS1A 1FD9A 3IHZA 3O5QA 4R0XA 2OWOA 4NSBA 5HWBA 1TFVA 1BKFA 1RD6A 2AWGA 3TCZA 1E6PA 4DRMA 2KXQA 3B7XA 2Y78A 4WIWA 3ARPA 3RGCA 3WQVA 3CH9A 1E9LA 4ITZA 2LKNA 1W1TA 3FSBA 3RM4A 4W9QA 3IK8A 4WKAA 5DITA 1ROTA 2LAJA 1W26A 3LUOA 3RFWA 1D6OA 3ARSA 1FFRA 4TW6A 4QT2A 1JMQA 1XRVA 5HTGA 1KT1A 2B5UB 1M5YA 4ODPA 4S3JA 1W1VA 3LE4A 1FKSA 3ARYA 2XP9A 2XP6A 2FDMA 1FKHA 4QIBA 1EIBA 1FKTA 3UI5A 3WD4A 4DRKA 1FFQA 4MTVA 1LL7A 3B9AA 4GGQA 2DT3A 2DK7A 1K9RA 2ZR4A 4Z2LA 4W5UA 3W4RA 1E6ZA 2QRVA 2JV4A 4S3KA 3WD0A 1C9HA 3PRBA 4ODRA 1Q1CA 2DG4A 1W9UA 4JFJA 5HW8A 1JNDA 4DRIA 1EG4A 2DMVA 4Z2HA 3ARWA 4MAVA 1ZBKA 2PN0A 3UI4A 5HKGA 4REXA 1FKFA 3FSCA 1ZL1A 1ZBVA 4DT4A 2KO7A 4Q7NA 1FKBA 1NWRA 1D7JA 1X6NA 3O5MA 1FJDA 3FAPA 1ZU8A 2MPHA 4Z2KA 2EULA 2RUDA 4IT6A 1Y0OA 1Q6UA 4ZS6A 3UQBA 2XP8A 3KAIA 3ARRA 5GPRA 4G2PA 2DT2A 3LKXA 2KFWA 3WL1A 3IKGA 4R5EA 5J6EA 3NRKA 2Y8NB 1CTNA 2P4VA 3CZ8A 2E45A 1D7HA 5AHTA 1EHNA 4DRHA 1PINA 1KT0A 2MLXA 2JXWA 1GRJA 1JCHB 3JXVA 4LAVA 4DZ2A 3ALGA 4N19A 3UF8A 4DZ3A 1Q6HA 4P8WA 2L2SA 3FY1A 2MLZA 3O5LA 1WAWA 2YSGA 2PBCA 3WD2A 1FLCA 1HKJA 3WKZA 1YW5A 3B9EA 2M8JA 1O6IA 2VCDA 3AS0A 4ODMA 2G41A 4W9OA 2DT0A 1HXVA 4UDMA 2M8IA 5DIUA 2YSIA 1HJXA 1SYTA 3ARUA 1TR8A 4IT4A 2IF4A 3ARTA 2ZAJA 4ODLA 2DJYA 2PPPA 1W9PA 2UZ5A 1ZCNA 4LAWA 4MNLA 4U84A 3PQHA 5HWCA 3ODKA 4DWSD 3KADA 4URIA 5E64A 2M1IA 1D7IA 3QOKA 2XP3A 2EZ5W 1HKMA 3UQIA 3WH0A 2KGJA 2QF8A 3PRDA 2WAEA 3MQGA 3ARZA 2KR7A 3WL0A 4AY1A 2DK1A 3ALFA 1K9TA 3M7NA 4MNJA 4A0TA 3EIPA 1EG3A 1JNTA 3MCBA 2XP5A 1P5QA 2A3BA 1J6YA 4Q22A 1LG1A 3O5EA 4DROA 1N1AA 4P8UA 3GU0A 2RQSA 2ESCA 1LQ0A 2KI3A 1RP5A 1VF8A 4DIPA 1NMWA 3O5PA 4A0UA 1J4HA 4LAXA 3M85A 3O5DA 1PBKA 3O5JA 1ITXA 1JVWA 4NZCA 1E6NA 2B31A 1HKIA 1F8AB 3KAGA 3O5FA 4KR0B 1OWQA 2IUZA 4MPKA 1GUVA 1FKIA 4ODKA 3TDBA 2JX8A 1X6LA 1H0GA 2MLYA 3WQWA 1E44A 3O5OA 4NNRA 2PV2A 2XPBA 2ZR5A 1QPFA 1WMVA 1O6WA 2A3EA 1HKKA 2OLHA 3CGNA 3PRAA 3GPKA 3ARVA 1K9QA 5B8IC 3PA7A 3AROA 2M08A 1QZ2A 2VN1A 3B8SA 5DIVA 4JFIA 4TW7A 2M3OW 2XPAA 3MCBB 1NWSA 3AS3A 2DT1A 2ZR6A 1NH6A 3WD1A 3G6MA 1WR7A 1HJVA 4JFLA 3FS8A 3JYMA 2YSFA 2LPVA 3CGMA 2PV1A 3OOBA 3I6CA 5DF0A 5HT1A 4GLXA 3ARXA 1NWTA 4IQCA 1YATA 3TC5A 1L1PA 1J4IA 4HBEA 4ODQA 2DWVA 1SR0A 4C02B 3AQUA 4BF8A 3BXWA 4DRPA 2WLZA 4TW8A 4JYSA 5HW6A 1R9HA 1FKJA 1JNEA 5JH8A 2L4JA 4ODNA 3NTPA 2FAPA 4DWSA 1BL4A 1Q6IA 1LJYA 4KQZA
chains in the Genus database with same CATH topology
4MNKA 1QPLA 2BA1A 2ZQTA 4QZVB 4TNSA 5DO2A 3RMEA 2G8ZA 4P8XA 3O5KA 4U86A 4Z2GA 1F40A 3KAFA 1ZBWA 1IX5A 5I98A 3NI6A 5HBFA 3RM8A 2F21A 3IKDA 3RM9A 2KE0A 1LL6A 3KCEA 1I5HW 2F2DA 3WIJA 1NMVA 3KABA 3LKXB 2WLYA 1ZBCA 1FKKA 1FKRA 3MQHA 5D75A 4L3NA 1EYMA 3WD3A 2RUQA 5GQBA 2XP4A 2PV3A 2RUCA 3AS2A 2DG9A 2DSVA 2D9FA 2MNTA 2A3AA 4ZPVR 5E5WA 2PI6A 1GOIA 3VAWA 2YAJB 2O9OA 3O5GA 2RURA 1A7XA 3MDYB 2WM0A 2YBTA 2DG3A 2LJ4A 3PR9A 2DSUA 4ZPTR 1W1PA 2PPNA 3KACA 1W9VA 2ZQUA 2N87A 4DWSB 1E6RA 2FKEA 2MF9A 4P8VA 1W1YA 2Q5AA 5HUAA 3OA5A 2JZVA 3CNGA 1ZK6A 3UQAA 2ZQVA 1FKGA 2MDIA 1UR8A 4DWSC 1WB0A 4E5RA 4WK9A 2RSEA 3KAHA 4TYOA 3ARQA 3L4HA 1UR9A 5BXJA 3CHFA 2RE3A 4LAYA 1EDQA 1T11A 2YSHA 5HW7A 2OFNA 1LL4A 4HBOA 5CQ2A 4DRJA 5DEZA 4DRQA 4MNMA 1KFWA 1FKLA 1OGBA 4TX0A 4DH0A 3KZ7A 3EY6A 1GPFA 4L72B 2XP7A 5U47A 1H0IA 5GPGA 1D2KA 1TK7A 4MGVA 4FAPA 2WK2A 2JMFA 1WNOA 5E66A 4J4OA 4ML4A 2AOSA 3O5RA 4J4NA 2YBUA 2PPOA 4W9PA 2DPEA 4JFMA 1ZB5A 4Z2JA 2YSBA 3JYJA 4WKFA 4XAKA 4IQ2A 4U85A 3UI6A 4QT3A 2O92A 3H9RB 4GIVA 2WADA 3FXYA 4JFKA 2DSZA 4WJXA 1LG2A 4Z2IA 4ODOA 1HJWA 2M2AA 1JNSA 4PTMA 4HARA 4MSPA 1XHGA 2A3CA 1FKDA 1J4RA 3CHDA 1OGGA 1FAPA 1NWUA 1TCOC 2ITKA 4FN2A 3CHEA 4WKHA 3G6LA 4LGXA 5E62A 1U79A 4IPXA 1ROUA 1E15A 2ZQSA 4ZPWR 2DSWA 1B6CA 3B9DA 1EQ3A 2F4EA 3CHCA 4O2TA 4DRNA 2LGOA 1NSGA 4G50A 2K8IA 3O5IA 5E65A 3AS1A 1FD9A 3IHZA 3O5QA 4R0XA 2OWOA 4NSBA 5HWBA 1TFVA 1BKFA 1RD6A 2AWGA 3TCZA 1E6PA 4DRMA 2KXQA 3B7XA 2Y78A 4WIWA 3ARPA 3RGCA 3WQVA 3CH9A 1E9LA 4ITZA 2LKNA 1W1TA 3FSBA 3RM4A 4W9QA 3IK8A 4WKAA 5DITA 1ROTA 2LAJA 1W26A 3LUOA 3RFWA 1D6OA 3ARSA 1FFRA 4TW6A 4QT2A 1JMQA 1XRVA 5HTGA 1KT1A 4ODPA 1M5YA 4S3JA 1W1VA 3LE4A 1FKSA 3ARYA 2XP9A 2XP6A 2FDMA 1FKHA 4QIBA 1EIBA 1FKTA 3UI5A 3WD4A 4DRKA 1FFQA 4MTVA 1LL7A 3B9AA 4GGQA 2DT3A 2DK7A 1K9RA 2ZR4A 4Z2LA 4W5UA 3W4RA 1E6ZA 2QRVA 2JV4A 4S3KA 3WD0A 1C9HA 3PRBA 4ODRA 1Q1CA 2DG4A 1W9UA 4JFJA 5HW8A 1JNDA 4DRIA 1EG4A 2DMVA 4Z2HA 3ARWA 4MAVA 1ZBKA 3UI4A 5HKGA 4REXA 1FKFA 3FSCA 1ZL1A 1ZBVA 4DT4A 2KO7A 4Q7NA 1FKBA 1NWRA 1D7JA 1X6NA 3O5MA 1FJDA 3FAPA 1ZU8A 2MPHA 4Z2KA 2RUDA 4IT6A 1Y0OA 1Q6UA 4ZS6A 3UQBA 2XP8A 3KAIA 3ARRA 5GPRA 4G2PA 2DT2A 3LKXA 2KFWA 3WL1A 3IKGA 4R5EA 5J6EA 3NRKA 2Y8NB 1CTNA 3CZ8A 2E45A 1D7HA 5AHTA 1EHNA 4DRHA 1PINA 1KT0A 2MLXA 2JXWA 3JXVA 4LAVA 4DZ2A 3ALGA 4N19A 3UF8A 4DZ3A 1Q6HA 4P8WA 2L2SA 3FY1A 2MLZA 3O5LA 1WAWA 2YSGA 2PBCA 3WD2A 1FLCA 1HKJA 3WKZA 1YW5A 3B9EA 2M8JA 1O6IA 2VCDA 3AS0A 4ODMA 2G41A 4W9OA 2DT0A 1HXVA 2M8IA 5DIUA 2YSIA 1HJXA 1SYTA 3ARUA 1TR8A 4IT4A 2IF4A 3ARTA 2ZAJA 4ODLA 2DJYA 2PPPA 1W9PA 2UZ5A 1ZCNA 4LAWA 4MNLA 4U84A 3PQHA 5HWCA 3ODKA 4DWSD 3KADA 4URIA 5E64A 2M1IA 1D7IA 3QOKA 2XP3A 2EZ5W 1HKMA 3UQIA 3WH0A 2KGJA 2QF8A 3PRDA 2WAEA 3MQGA 3ARZA 2KR7A 3WL0A 4AY1A 2DK1A 3ALFA 1K9TA 3M7NA 4MNJA 4A0TA 1EG3A 1JNTA 3MCBA 2XP5A 1P5QA 2A3BA 1J6YA 4Q22A 1LG1A 3O5EA 4DROA 1N1AA 4P8UA 2RQSA 2ESCA 1LQ0A 2KI3A 1RP5A 1VF8A 4DIPA 1NMWA 3O5PA 4A0UA 1J4HA 4LAXA 3M85A 3O5DA 1PBKA 3O5JA 1ITXA 1JVWA 4NZCA 1E6NA 2B31A 1HKIA 1F8AB 3KAGA 3O5FA 4KR0B 1OWQA 2IUZA 4MPKA 1GUVA 1FKIA 4ODKA 3TDBA 2JX8A 1X6LA 1H0GA 2MLYA 3WQWA 4NNRA 3O5OA 2PV2A 2XPBA 2ZR5A 1QPFA 1WMVA 1O6WA 2A3EA 1HKKA 2OLHA 3CGNA 3PRAA 3GPKA 3ARVA 1K9QA 5B8IC 3PA7A 3AROA 2M08A 1QZ2A 2VN1A 3B8SA 5DIVA 4JFIA 4TW7A 2M3OW 2XPAA 3MCBB 1NWSA 3AS3A 2DT1A 2ZR6A 1NH6A 3WD1A 3G6MA 1WR7A 1HJVA 4JFLA 3FS8A 3JYMA 2YSFA 2LPVA 3CGMA 2PV1A 3OOBA 3I6CA 5DF0A 5HT1A 4GLXA 3ARXA 1NWTA 4IQCA 1YATA 3TC5A 1L1PA 1J4IA 4HBEA 4ODQA 2DWVA 1SR0A 4C02B 3AQUA 4BF8A 3BXWA 4DRPA 2WLZA 4TW8A 4JYSA 5HW6A 1R9HA 1FKJA 1JNEA 5JH8A 2L4JA 4ODNA 3NTPA 2FAPA 4DWSA 1BL4A 1Q6IA 1LJYA 4KQZA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1QPL A;  2BA1 A;  2ZQT A;  4TNS A;  3O5K A;  4U86 A;  1F40 A;  3KAF A;  5I98 A;  3NI6 A;  2F21 A;  3IKD A;  2KE0 A;  3KCE A;  1I5H W;  2F2D A;  1NMV A;  3KAB A;  1FKK A;  1FKR A;  5D75 A;  1EYM A;  2RUQ A;  2XP4 A;  2PV3 A;  2RUC A;  2DG9 A;  2D9F A;  2MNT A;  3VAW A;  3O5G A;  2RUR A;  1A7X A;  3MDY B;  2DG3 A;  2LJ4 A;  2PPN A;  3KAC A;  2ZQU A;  2N87 A;  2FKE A;  2MF9 A;  2Q5A A;  5HUA A;  2JZV A;  3CNG A;  1ZK6 A;  3UQA A;  2ZQV A;  1FKG A;  2MDI A;  4E5R A;  2RSE A;  3KAH A;  4TYO A;  3L4H A;  5BXJ A;  2RE3 A;  4LAY A;  1T11 A;  5HW7 A;  2YSH A;  2OFN A;  5CQ2 A;  4DRJ A;  4DRQ A;  1FKL A;  4TX0 A;  4DH0 A;  3KZ7 A;  3EY6 A;  2XP7 A;  5GPG A;  4FAP A;  1TK7 A;  4MGV A;  2JMF A;  4J4O A;  3O5R A;  4J4N A;  2PPO A;  4W9P A;  4JFM A;  2YSB A;  3JYJ A;  4IQ2 A;  4U85 A;  3UI6 A;  4QT3 A;  3H9R B;  4GIV A;  4JFK A;  4ODO A;  2M2A A;  1JNS A;  4MSP A;  1FKD A;  1J4R A;  1FAP A;  1TCO C;  2ITK A;  4FN2 A;  1U79 A;  4IPX A;  1ROU A;  2ZQS A;  1B6C A;  1EQ3 A;  2F4E A;  4O2T A;  4DRN A;  2LGO A;  1NSG A;  4G50 A;  2K8I A;  3O5I A;  1FD9 A;  3IHZ A;  3O5Q A;  4R0X A;  5HWB A;  1BKF A;  2AWG A;  3TCZ A;  4DRM A;  2KXQ A;  3B7X A;  2Y78 A;  3RGC A;  4ITZ A;  2LKN A;  4W9Q A;  3IK8 A;  5DIT A;  1ROT A;  2LAJ A;  1W26 A;  3LUO A;  3RFW A;  1D6O A;  4TW6 A;  4QT2 A;  1JMQ A;  5HTG A;  1KT1 A;  4ODP A;  1M5Y A;  3LE4 A;  1FKS A;  2XP9 A;  2XP6 A;  1FKH A;  4QIB A;  1FKT A;  3UI5 A;  4DRK A;  4GGQ A;  2DK7 A;  1K9R A;  2ZR4 A;  2JV4 A;  1C9H A;  3PRB A;  4ODR A;  1Q1C A;  2DG4 A;  4JFJ A;  5HW8 A;  4DRI A;  1EG4 A;  2DMV A;  3UI4 A;  5HKG A;  4REX A;  1FKF A;  4DT4 A;  2KO7 A;  1FKB A;  1D7J A;  3O5M A;  1FJD A;  3FAP A;  2MPH A;  2RUD A;  1Y0O A;  1Q6U A;  3UQB A;  2XP8 A;  3KAI A;  4G2P A;  2KFW A;  3IKG A;  5J6E A;  3NRK A;  2E45 A;  1D7H A;  5AHT A;  4DRH A;  1PIN A;  1KT0 A;  2MLX A;  2JXW A;  3JXV A;  4LAV A;  4DZ2 A;  4N19 A;  3UF8 A;  4DZ3 A;  1Q6H A;  2L2S A;  2MLZ A;  3O5L A;  2YSG A;  2PBC A;  1YW5 A;  2M8J A;  4ODM A;  2VCD A;  4W9O A;  1HXV A;  2M8I A;  5DIU A;  2YSI A;  2IF4 A;  2ZAJ A;  4ODL A;  2DJY A;  2PPP A;  2UZ5 A;  1ZCN A;  4LAW A;  4U84 A;  5HWC A;  3ODK A;  3KAD A;  2M1I A;  1D7I A;  2XP3 A;  2EZ5 W;  3UQI A;  3WH0 A;  2KGJ A;  3PRD A;  2KR7 A;  2DK1 A;  3M7N A;  1EG3 A;  1JNT A;  2XP5 A;  1P5Q A;  1J6Y A;  3O5E A;  4DRO A;  1N1A A;  2RQS A;  2KI3 A;  4DIP A;  1NMW A;  3O5P A;  4LAX A;  1J4H A;  3M85 A;  3O5D A;  1PBK A;  3O5J A;  1JVW A;  3O5F A;  1F8A B;  3KAG A;  1FKI A;  4ODK A;  3TDB A;  2JX8 A;  2MLY A;  4NNR A;  3O5O A;  2PV2 A;  2XPB A;  2ZR5 A;  1QPF A;  1WMV A;  1O6W A;  3CGN A;  3GPK A;  1K9Q A;  5B8I C;  3PA7 A;  2M08 A;  1QZ2 A;  2VN1 A;  5DIV A;  4JFI A;  4TW7 A;  2M3O W;  2XPA A;  2ZR6 A;  1WR7 A;  4JFL A;  3JYM A;  2YSF A;  2LPV A;  3CGM A;  2PV1 A;  3OOB A;  3I6C A;  5HT1 A;  4IQC A;  1YAT A;  3TC5 A;  1L1P A;  1J4I A;  4ODQ A;  2DWV A;  4C02 B;  4BF8 A;  4DRP A;  4TW8 A;  4JYS A;  5HW6 A;  1R9H A;  1FKJ A;  2L4J A;  4ODN A;  3NTP A;  2FAP A;  1BL4 A;  1Q6I A; 
#chains in the Genus database with same CATH topology
 4MNK A;  1QPL A;  2BA1 A;  2ZQT A;  4QZV B;  4TNS A;  5DO2 A;  3RME A;  2G8Z A;  4P8X A;  3O5K A;  4U86 A;  4Z2G A;  1F40 A;  3KAF A;  1ZBW A;  1IX5 A;  5I98 A;  3NI6 A;  5HBF A;  3RM8 A;  2F21 A;  3IKD A;  3RM9 A;  2KE0 A;  1LL6 A;  3KCE A;  1I5H W;  2F2D A;  3WIJ A;  1NMV A;  3KAB A;  3LKX B;  2WLY A;  1ZBC A;  1FKK A;  1FKR A;  3MQH A;  5D75 A;  4L3N A;  1EYM A;  3WD3 A;  2RUQ A;  2ETN A;  3BMB A;  5GQB A;  2XP4 A;  2PV3 A;  2RUC A;  3AS2 A;  2DG9 A;  2DSV A;  2D9F A;  2MNT A;  2A3A A;  4ZPV R;  3GTY X;  5E5W A;  2PI6 A;  1GOI A;  3VAW A;  2YAJ B;  2O9O A;  3O5G A;  2F23 A;  1A7X A;  2RUR A;  2WM0 A;  2YBT A;  3MDY B;  2DG3 A;  2LJ4 A;  3PR9 A;  2DSU A;  4ZPT R;  1W1P A;  2PPN A;  3KAC A;  1W9V A;  2ZQU A;  2N87 A;  4DWS B;  1E6R A;  2FKE A;  2MF9 A;  4P8V A;  1W1Y A;  2Q5A A;  5HUA A;  3OA5 A;  2JZV A;  3CNG A;  1ZK6 A;  3UQA A;  2ZQV A;  1FKG A;  2MDI A;  1UR8 A;  4DWS C;  1WB0 A;  4E5R A;  4WK9 A;  2RSE A;  3KAH A;  4TYO A;  3ARQ A;  3L4H A;  1UR9 A;  5BXJ A;  3CHF A;  2RE3 A;  4LAY A;  1EDQ A;  1T11 A;  2YSH A;  5HW7 A;  2OFN A;  1LL4 A;  4HBO A;  5CQ2 A;  4DRJ A;  5DEZ A;  4DRQ A;  4MNM A;  1KFW A;  1FKL A;  1OGB A;  4TX0 A;  4DH0 A;  3KZ7 A;  3EY6 A;  1GPF A;  4L72 B;  2XP7 A;  5U47 A;  1H0I A;  5GPG A;  1D2K A;  1TK7 A;  4MGV A;  4FAP A;  2WK2 A;  2JMF A;  1WNO A;  5E66 A;  4J4O A;  4ML4 A;  2AOS A;  3O5R A;  4J4N A;  2YBU A;  2PPO A;  4W9P A;  2DPE A;  4JFM A;  1ZB5 A;  4Z2J A;  2YSB A;  3JYJ A;  4WKF A;  4XAK A;  4IQ2 A;  4U85 A;  3UI6 A;  4QT3 A;  2O92 A;  3H9R B;  4GIV A;  2WAD A;  3FXY A;  4JFK A;  2DSZ A;  4WJX A;  1LG2 A;  4Z2I A;  4ODO A;  1HJW A;  2M2A A;  1JNS A;  4PTM A;  4HAR A;  4MSP A;  1XHG A;  2A3C A;  1FKD A;  1J4R A;  3CHD A;  1OGG A;  1FAP A;  1NWU A;  1TCO C;  2ITK A;  4FN2 A;  3CHE A;  4WKH A;  3G6L A;  4LGX A;  5E62 A;  1U79 A;  4IPX A;  1ROU A;  1E15 A;  2ZQS A;  4ZPW R;  2DSW A;  1B6C A;  3B9D A;  1EQ3 A;  2F4E A;  3CHC A;  4O2T A;  4DRN A;  2LGO A;  1NSG A;  4G50 A;  2K8I A;  3O5I A;  5E65 A;  3AS1 A;  1FD9 A;  3IHZ A;  3O5Q A;  4R0X A;  2OWO A;  4NSB A;  5HWB A;  1TFV A;  1BKF A;  1RD6 A;  2AWG A;  3TCZ A;  1E6P A;  4DRM A;  2KXQ A;  3B7X A;  2Y78 A;  4WIW A;  3ARP A;  3RGC A;  3WQV A;  3CH9 A;  1E9L A;  4ITZ A;  2LKN A;  1W1T A;  3FSB A;  3RM4 A;  4W9Q A;  3IK8 A;  4WKA A;  5DIT A;  1ROT A;  2LAJ A;  1W26 A;  3LUO A;  3RFW A;  1D6O A;  3ARS A;  1FFR A;  4TW6 A;  4QT2 A;  1JMQ A;  1XRV A;  5HTG A;  1KT1 A;  2B5U B;  1M5Y A;  4ODP A;  4S3J A;  1W1V A;  3LE4 A;  1FKS A;  3ARY A;  2XP9 A;  2XP6 A;  2FDM A;  1FKH A;  4QIB A;  1EIB A;  1FKT A;  3UI5 A;  3WD4 A;  4DRK A;  1FFQ A;  4MTV A;  1LL7 A;  3B9A A;  4GGQ A;  2DT3 A;  2DK7 A;  1K9R A;  2ZR4 A;  4Z2L A;  4W5U A;  3W4R A;  1E6Z A;  2QRV A;  2JV4 A;  4S3K A;  3WD0 A;  1C9H A;  3PRB A;  4ODR A;  1Q1C A;  2DG4 A;  1W9U A;  4JFJ A;  5HW8 A;  1JND A;  4DRI A;  1EG4 A;  2DMV A;  4Z2H A;  3ARW A;  4MAV A;  1ZBK A;  2PN0 A;  3UI4 A;  5HKG A;  4REX A;  1FKF A;  3FSC A;  1ZL1 A;  1ZBV A;  4DT4 A;  2KO7 A;  4Q7N A;  1FKB A;  1NWR A;  1D7J A;  1X6N A;  3O5M A;  1FJD A;  3FAP A;  1ZU8 A;  2MPH A;  4Z2K A;  2EUL A;  2RUD A;  4IT6 A;  1Y0O A;  1Q6U A;  4ZS6 A;  3UQB A;  2XP8 A;  3KAI A;  3ARR A;  5GPR A;  4G2P A;  2DT2 A;  3LKX A;  2KFW A;  3WL1 A;  3IKG A;  4R5E A;  5J6E A;  3NRK A;  2Y8N B;  1CTN A;  2P4V A;  3CZ8 A;  2E45 A;  1D7H A;  5AHT A;  1EHN A;  4DRH A;  1PIN A;  1KT0 A;  2MLX A;  2JXW A;  1GRJ A;  1JCH B;  3JXV A;  4LAV A;  4DZ2 A;  3ALG A;  4N19 A;  3UF8 A;  4DZ3 A;  1Q6H A;  4P8W A;  2L2S A;  3FY1 A;  2MLZ A;  3O5L A;  1WAW A;  2YSG A;  2PBC A;  3WD2 A;  1FLC A;  1HKJ A;  3WKZ A;  1YW5 A;  3B9E A;  2M8J A;  1O6I A;  2VCD A;  3AS0 A;  4ODM A;  2G41 A;  4W9O A;  2DT0 A;  1HXV A;  4UDM A;  2M8I A;  5DIU A;  2YSI A;  1HJX A;  1SYT A;  3ARU A;  1TR8 A;  4IT4 A;  2IF4 A;  3ART A;  2ZAJ A;  4ODL A;  2DJY A;  2PPP A;  1W9P A;  2UZ5 A;  1ZCN A;  4LAW A;  4MNL A;  4U84 A;  3PQH A;  5HWC A;  3ODK A;  4DWS D;  3KAD A;  4URI A;  5E64 A;  2M1I A;  1D7I A;  3QOK A;  2XP3 A;  2EZ5 W;  1HKM A;  3UQI A;  3WH0 A;  2KGJ A;  2QF8 A;  3PRD A;  2WAE A;  3MQG A;  3ARZ A;  2KR7 A;  3WL0 A;  4AY1 A;  2DK1 A;  3ALF A;  1K9T A;  3M7N A;  4MNJ A;  4A0T A;  3EIP A;  1EG3 A;  1JNT A;  3MCB A;  2XP5 A;  1P5Q A;  2A3B A;  1J6Y A;  4Q22 A;  1LG1 A;  3O5E A;  4DRO A;  1N1A A;  4P8U A;  3GU0 A;  2RQS A;  2ESC A;  1LQ0 A;  2KI3 A;  1RP5 A;  1VF8 A;  4DIP A;  1NMW A;  3O5P A;  4A0U A;  1J4H A;  4LAX A;  3M85 A;  3O5D A;  1PBK A;  3O5J A;  1ITX A;  1JVW A;  4NZC A;  1E6N A;  2B31 A;  1HKI A;  1F8A B;  3KAG A;  3O5F A;  4KR0 B;  1OWQ A;  2IUZ A;  4MPK A;  1GUV A;  1FKI A;  4ODK A;  3TDB A;  2JX8 A;  1X6L A;  1H0G A;  2MLY A;  3WQW A;  1E44 A;  3O5O A;  4NNR A;  2PV2 A;  2XPB A;  2ZR5 A;  1QPF A;  1WMV A;  1O6W A;  2A3E A;  1HKK A;  2OLH A;  3CGN A;  3PRA A;  3GPK A;  3ARV A;  1K9Q A;  5B8I C;  3PA7 A;  3ARO A;  2M08 A;  1QZ2 A;  2VN1 A;  3B8S A;  5DIV A;  4JFI A;  4TW7 A;  2M3O W;  2XPA A;  3MCB B;  1NWS A;  3AS3 A;  2DT1 A;  2ZR6 A;  1NH6 A;  3WD1 A;  3G6M A;  1WR7 A;  1HJV A;  4JFL A;  3FS8 A;  3JYM A;  2YSF A;  2LPV A;  3CGM A;  2PV1 A;  3OOB A;  3I6C A;  5DF0 A;  5HT1 A;  4GLX A;  3ARX A;  1NWT A;  4IQC A;  1YAT A;  3TC5 A;  1L1P A;  1J4I A;  4HBE A;  4ODQ A;  2DWV A;  1SR0 A;  4C02 B;  3AQU A;  4BF8 A;  3BXW A;  4DRP A;  2WLZ A;  4TW8 A;  4JYS A;  5HW6 A;  1R9H A;  1FKJ A;  1JNE A;  5JH8 A;  2L4J A;  4ODN A;  3NTP A;  2FAP A;  4DWS A;  1BL4 A;  1Q6I A;  1LJY A;  4KQZ A; 
#chains in the Genus database with same CATH homology
 4MNK A;  1QPL A;  2BA1 A;  2ZQT A;  4QZV B;  4TNS A;  5DO2 A;  3RME A;  2G8Z A;  4P8X A;  3O5K A;  4U86 A;  4Z2G A;  1F40 A;  3KAF A;  1ZBW A;  1IX5 A;  5I98 A;  3NI6 A;  5HBF A;  3RM8 A;  2F21 A;  3IKD A;  3RM9 A;  2KE0 A;  1LL6 A;  3KCE A;  1I5H W;  2F2D A;  3WIJ A;  1NMV A;  3KAB A;  3LKX B;  2WLY A;  1ZBC A;  1FKK A;  1FKR A;  3MQH A;  5D75 A;  4L3N A;  1EYM A;  3WD3 A;  2RUQ A;  5GQB A;  2XP4 A;  2PV3 A;  2RUC A;  3AS2 A;  2DG9 A;  2DSV A;  2D9F A;  2MNT A;  2A3A A;  4ZPV R;  5E5W A;  2PI6 A;  1GOI A;  3VAW A;  2YAJ B;  2O9O A;  3O5G A;  2RUR A;  1A7X A;  3MDY B;  2WM0 A;  2YBT A;  2DG3 A;  2LJ4 A;  3PR9 A;  2DSU A;  4ZPT R;  1W1P A;  2PPN A;  3KAC A;  1W9V A;  2ZQU A;  2N87 A;  4DWS B;  1E6R A;  2FKE A;  2MF9 A;  4P8V A;  1W1Y A;  2Q5A A;  5HUA A;  3OA5 A;  2JZV A;  3CNG A;  1ZK6 A;  3UQA A;  2ZQV A;  1FKG A;  2MDI A;  1UR8 A;  4DWS C;  1WB0 A;  4E5R A;  4WK9 A;  2RSE A;  3KAH A;  4TYO A;  3ARQ A;  3L4H A;  1UR9 A;  5BXJ A;  3CHF A;  2RE3 A;  4LAY A;  1EDQ A;  1T11 A;  2YSH A;  5HW7 A;  2OFN A;  1LL4 A;  4HBO A;  5CQ2 A;  4DRJ A;  5DEZ A;  4DRQ A;  4MNM A;  1KFW A;  1FKL A;  1OGB A;  4TX0 A;  4DH0 A;  3KZ7 A;  3EY6 A;  1GPF A;  4L72 B;  2XP7 A;  5U47 A;  1H0I A;  5GPG A;  1D2K A;  1TK7 A;  4MGV A;  4FAP A;  2WK2 A;  2JMF A;  1WNO A;  5E66 A;  4J4O A;  4ML4 A;  2AOS A;  3O5R A;  4J4N A;  2YBU A;  2PPO A;  4W9P A;  2DPE A;  4JFM A;  1ZB5 A;  4Z2J A;  2YSB A;  3JYJ A;  4WKF A;  4XAK A;  4IQ2 A;  4U85 A;  3UI6 A;  4QT3 A;  2O92 A;  3H9R B;  4GIV A;  2WAD A;  3FXY A;  4JFK A;  2DSZ A;  4WJX A;  1LG2 A;  4Z2I A;  4ODO A;  1HJW A;  2M2A A;  1JNS A;  4PTM A;  4HAR A;  4MSP A;  1XHG A;  2A3C A;  1FKD A;  1J4R A;  3CHD A;  1OGG A;  1FAP A;  1NWU A;  1TCO C;  2ITK A;  4FN2 A;  3CHE A;  4WKH A;  3G6L A;  4LGX A;  5E62 A;  1U79 A;  4IPX A;  1ROU A;  1E15 A;  2ZQS A;  4ZPW R;  2DSW A;  1B6C A;  3B9D A;  1EQ3 A;  2F4E A;  3CHC A;  4O2T A;  4DRN A;  2LGO A;  1NSG A;  4G50 A;  2K8I A;  3O5I A;  5E65 A;  3AS1 A;  1FD9 A;  3IHZ A;  3O5Q A;  4R0X A;  2OWO A;  4NSB A;  5HWB A;  1TFV A;  1BKF A;  1RD6 A;  2AWG A;  3TCZ A;  1E6P A;  4DRM A;  2KXQ A;  3B7X A;  2Y78 A;  4WIW A;  3ARP A;  3RGC A;  3WQV A;  3CH9 A;  1E9L A;  4ITZ A;  2LKN A;  1W1T A;  3FSB A;  3RM4 A;  4W9Q A;  3IK8 A;  4WKA A;  5DIT A;  1ROT A;  2LAJ A;  1W26 A;  3LUO A;  3RFW A;  1D6O A;  3ARS A;  1FFR A;  4TW6 A;  4QT2 A;  1JMQ A;  1XRV A;  5HTG A;  1KT1 A;  4ODP A;  1M5Y A;  4S3J A;  1W1V A;  3LE4 A;  1FKS A;  3ARY A;  2XP9 A;  2XP6 A;  2FDM A;  1FKH A;  4QIB A;  1EIB A;  1FKT A;  3UI5 A;  3WD4 A;  4DRK A;  1FFQ A;  4MTV A;  1LL7 A;  3B9A A;  4GGQ A;  2DT3 A;  2DK7 A;  1K9R A;  2ZR4 A;  4Z2L A;  4W5U A;  3W4R A;  1E6Z A;  2QRV A;  2JV4 A;  4S3K A;  3WD0 A;  1C9H A;  3PRB A;  4ODR A;  1Q1C A;  2DG4 A;  1W9U A;  4JFJ A;  5HW8 A;  1JND A;  4DRI A;  1EG4 A;  2DMV A;  4Z2H A;  3ARW A;  4MAV A;  1ZBK A;  3UI4 A;  5HKG A;  4REX A;  1FKF A;  3FSC A;  1ZL1 A;  1ZBV A;  4DT4 A;  2KO7 A;  4Q7N A;  1FKB A;  1NWR A;  1D7J A;  1X6N A;  3O5M A;  1FJD A;  3FAP A;  1ZU8 A;  2MPH A;  4Z2K A;  2RUD A;  4IT6 A;  1Y0O A;  1Q6U A;  4ZS6 A;  3UQB A;  2XP8 A;  3KAI A;  3ARR A;  5GPR A;  4G2P A;  2DT2 A;  3LKX A;  2KFW A;  3WL1 A;  3IKG A;  4R5E A;  5J6E A;  3NRK A;  2Y8N B;  1CTN A;  3CZ8 A;  2E45 A;  1D7H A;  5AHT A;  1EHN A;  4DRH A;  1PIN A;  1KT0 A;  2MLX A;  2JXW A;  3JXV A;  4LAV A;  4DZ2 A;  3ALG A;  4N19 A;  3UF8 A;  4DZ3 A;  1Q6H A;  4P8W A;  2L2S A;  3FY1 A;  2MLZ A;  3O5L A;  1WAW A;  2YSG A;  2PBC A;  3WD2 A;  1FLC A;  1HKJ A;  3WKZ A;  1YW5 A;  3B9E A;  2M8J A;  1O6I A;  2VCD A;  3AS0 A;  4ODM A;  2G41 A;  4W9O A;  2DT0 A;  1HXV A;  2M8I A;  5DIU A;  2YSI A;  1HJX A;  1SYT A;  3ARU A;  1TR8 A;  4IT4 A;  2IF4 A;  3ART A;  2ZAJ A;  4ODL A;  2DJY A;  2PPP A;  1W9P A;  2UZ5 A;  1ZCN A;  4LAW A;  4MNL A;  4U84 A;  3PQH A;  5HWC A;  3ODK A;  4DWS D;  3KAD A;  4URI A;  5E64 A;  2M1I A;  1D7I A;  3QOK A;  2XP3 A;  2EZ5 W;  1HKM A;  3UQI A;  3WH0 A;  2KGJ A;  2QF8 A;  3PRD A;  2WAE A;  3MQG A;  3ARZ A;  2KR7 A;  3WL0 A;  4AY1 A;  2DK1 A;  3ALF A;  1K9T A;  3M7N A;  4MNJ A;  4A0T A;  1EG3 A;  1JNT A;  3MCB A;  2XP5 A;  1P5Q A;  2A3B A;  1J6Y A;  4Q22 A;  1LG1 A;  3O5E A;  4DRO A;  1N1A A;  4P8U A;  2RQS A;  2ESC A;  1LQ0 A;  2KI3 A;  1RP5 A;  1VF8 A;  4DIP A;  1NMW A;  3O5P A;  4A0U A;  1J4H A;  4LAX A;  3M85 A;  3O5D A;  1PBK A;  3O5J A;  1ITX A;  1JVW A;  4NZC A;  1E6N A;  2B31 A;  1HKI A;  1F8A B;  3KAG A;  3O5F A;  4KR0 B;  1OWQ A;  2IUZ A;  4MPK A;  1GUV A;  1FKI A;  4ODK A;  3TDB A;  2JX8 A;  1X6L A;  1H0G A;  2MLY A;  3WQW A;  4NNR A;  3O5O A;  2PV2 A;  2XPB A;  2ZR5 A;  1QPF A;  1WMV A;  1O6W A;  2A3E A;  1HKK A;  2OLH A;  3CGN A;  3PRA A;  3GPK A;  3ARV A;  1K9Q A;  5B8I C;  3PA7 A;  3ARO A;  2M08 A;  1QZ2 A;  2VN1 A;  3B8S A;  5DIV A;  4JFI A;  4TW7 A;  2M3O W;  2XPA A;  3MCB B;  1NWS A;  3AS3 A;  2DT1 A;  2ZR6 A;  1NH6 A;  3WD1 A;  3G6M A;  1WR7 A;  1HJV A;  4JFL A;  3FS8 A;  3JYM A;  2YSF A;  2LPV A;  3CGM A;  2PV1 A;  3OOB A;  3I6C A;  5DF0 A;  5HT1 A;  4GLX A;  3ARX A;  1NWT A;  4IQC A;  1YAT A;  3TC5 A;  1L1P A;  1J4I A;  4HBE A;  4ODQ A;  2DWV A;  1SR0 A;  4C02 B;  3AQU A;  4BF8 A;  3BXW A;  4DRP A;  2WLZ A;  4TW8 A;  4JYS A;  5HW6 A;  1R9H A;  1FKJ A;  1JNE A;  5JH8 A;  2L4J A;  4ODN A;  3NTP A;  2FAP A;  4DWS A;  1BL4 A;  1Q6I A;  1LJY A;  4KQZ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...