3TC5A

Selective targeting of disease-relevant protein binding domains by o-phosphorylated natural product derivatives
Total Genus 47
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
47
sequence length
157
structure length
144
Chain Sequence
LPPGWEKAMSRSSGRVYYFNHITNASQWERPEPARVRCSHLLVKHSQSRRPSSWRQEKITRTKEEALELINGYIQKIKSGEEDFESLASQFSDCSSAKARGDLGAFSRGQMQKPFEDASFALRTGEMSGPVFTDSGIHIILRTE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Isomerase/isomerase inhibitor
molecule keywords Peptidyl-prolyl cis-trans isomerase NIMA-interacting 1
publication title Selective targeting of disease-relevant protein binding domains by o-phosphorylated natural product derivatives.
pubmed doi rcsb
source organism Homo sapiens
total genus 47
structure length 144
sequence length 157
ec nomenclature ec 5.2.1.8: Peptidylprolyl isomerase.
pdb deposition date 2011-08-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00397 WW WW domain
A PF00639 Rotamase PPIC-type PPIASE domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.20.70.10 Mainly Beta Single Sheet Ubiquitin Ligase Nedd4; Chain: W; Ubiquitin Ligase Nedd4; Chain: W; 3tc5A01
3.10.50.40 Alpha Beta Roll Chitinase A; domain 3 Chitinase A; domain 3 3tc5A02
4GGQA 4DRJA 1PINA 4NNRA 2RURA 4JFIA 3CGMA 4U84A 3O5JA 2Q5AA 2BA1A 4ITZA 4DIPA 1JVWA 1PBKA 5DIUA 1A7XA 3UQIA 2PPPA 4FAPA 1TCOC 2F21A 1HXVA 5BXJA 2LJ4A 4TW7A 2DG3A 1FKTA 3KCEA 3JYJA 4O2TA 2DK7A 1J4HA 2JXWA 1EYMA 4DRHA 2PV2A 1FKSA 4ODOA 3O5PA 2KI3A 4J4NA 4ODKA 4DRMA 2MF9A 2XP7A 4MSPA 3KAIA 4R0XA 2L2SA 5B8IC 1D7IA 2N87A 1YW5A 2D9FA 2MLXA 3UQAA 2MDIA 2M08A 2IF4A 3CGNA 4W9PA 1FAPA 2FAPA 2LPVA 5AHTA 5HKGA 2KGJA 3KABA 1D7JA 3MDYB 2ZQTA 4G50A 2KO7A 1EQ3A 5HUAA 3UF8A 4ODRA 2EZ5W 4DRQA 3RGCA 2YSHA 1BKFA 3M7NA 1M5YA 2K8IA 4MGVA 3O5MA 3O5QA 2ZAJA 4ODQA 1FKBA 3EY6A 4C02B 1FKFA 1FKJA 4ODNA 2DMVA 1T11A 1K9QA 2RUDA 2M3OW 1ROTA 3KAHA 2DK1A 2RUCA 5DITA 2PBCA 3UI6A 3O5RA 2LGOA 1F8AB 2PV1A 3ODKA 1O6WA 1QPFA 2XPBA 4QIBA 1KT1A 3IKDA 1I5HW 2OFNA 1FKDA 3UI5A 2RQSA 4ODMA 1FD9A 4N19A 2XP4A 4IQCA 1D6OA 2VCDA 2KXQA 1KT0A 1WR7A 4U85A 2YSGA 4QT2A 2MLYA 3NRKA 2MPHA 2E45A 4DROA 2XP5A 3IK8A 4LAWA 1EG4A 1L1PA 4W9QA 2PV3A 4REXA 4G2PA 2PPNA 1NMVA 2ZQUA 3GPKA 1U79A 4TW8A 1EG3A 2YSIA 1B6CA 3RFWA 3LE4A 3TCZA 3PRBA 1FKKA 2MNTA 3O5KA 2LAJA 2XP6A 2YSFA 2KFWA 3TC5A 2FKEA 2XP9A 5J6EA 3O5IA 2AWGA 2PPOA 2ZR5A 3KADA 2JX8A 3FAPA 1F40A 3O5OA 1J4RA 5CQ2A 1D7HA 1FKLA 1WMVA 4FN2A 1ROUA 4JFKA 2XP3A 2KE0A 5HTGA 1FKHA 3O5GA 4IPXA 4JFMA 5D75A 3TDBA 2ZR6A 5HW6A 3KAFA 3PRDA 3M85A 3OOBA 1J4IA 4DRNA 3NTPA 4TYOA 3VAWA 2XPAA 2RUQA 2M8JA 1P5QA 1ZCNA 4LAYA 1YATA 4GIVA 1FJDA 4DZ3A 2M1IA 1C9HA 4E5RA 4JFLA 3O5EA 2F2DA 2ZQVA 1BL4A 1NMWA 2M8IA 2RSEA 4ODLA 2ZR4A 3H9RB 3KAGA 1JNTA 4ODPA 4J4OA 4DRPA 1FKGA 4TNSA 3O5DA 4U86A 2ITKA 1FKIA 1Q6IA 3O5FA 4IQ2A 4JYSA 2JV4A 2DWVA 4DRKA 3O5LA 1TK7A 3PA7A 2LKNA 2L4JA 2VN1A 4W9OA 4LAXA 2M2AA 3UQBA 1J6YA 2Y78A 5GPGA 3CNGA 5HT1A 3L4HA 3LUOA 1Y0OA 4QT3A 1Q1CA 4JFJA 3I6CA 4DZ2A 4LAVA 1Q6HA 1N1AA 5HW7A 3NI6A 4TW6A 3IHZA 5HW8A 1Q6UA 1QPLA 1NSGA 3B7XA 2YSBA 2MLZA 2JMFA 4DRIA 2DJYA 1JMQA 1R9HA 5I98A 2RE3A 5HWBA 1FKRA 3UI4A 2F4EA 1W26A 2ZQSA 5DIVA 5HWCA 4TX0A 1ZK6A 2UZ5A 4DT4A 4DH0A 3JXVA 3KZ7A 1K9RA 1JNSA 2KR7A 3JYMA 3WH0A 1QZ2A 3IKGA 4BF8A 2DG9A 2DG4A 3KACA 2XP8A 2JZVA
chains in the Genus database with same CATH superfamily
4GGQA 4DRJA 1PINA 1LL4A 3ARTA 4NNRA 2RURA 1W9VA 2DPEA 4JFIA 4S3KA 3CGMA 3CHFA 3MCBA 3WQWA 4U84A 3O5JA 2Q5AA 1W1PA 2BA1A 4ITZA 4GLXA 2YBTA 4DIPA 1JVWA 1PBKA 4XAKA 5DEZA 5DIUA 1A7XA 3UQIA 1JNDA 2PPPA 4L3NA 1TCOC 4FAPA 2F21A 1HXVA 2G8ZA 1WNOA 1E6ZA 4URIA 4DWSC 2A3BA 5BXJA 2LJ4A 4LGXA 3RMEA 3FSBA 2DG3A 4TW7A 1FKTA 3KCEA 3JYJA 4O2TA 1CTNA 2DK7A 4KQZA 2DT0A 1J4HA 5E65A 4MPKA 1W9UA 2JXWA 1EYMA 1HJWA 4DRHA 2PV2A 1FKSA 1FLCA 2WLYA 4ODOA 4P8VA 3O5PA 2KI3A 3AS3A 3B9AA 4J4NA 4ODKA 3WIJA 4DRMA 2MF9A 5E5WA 2XP7A 4MSPA 3KAIA 4R0XA 4Z2HA 1GOIA 2B5UB 2L2SA 5B8IC 1D7IA 2N87A 1YW5A 1NWRA 2D9FA 2MLXA 1GRJA 3PR9A 3UQAA 2MDIA 1EIBA 2M08A 2IF4A 1UR9A 1JNEA 3CGNA 4W9PA 1FAPA 1OGBA 3WD4A 2FAPA 2LPVA 4MNMA 5AHTA 2G41A 5HKGA 2OLHA 2KGJA 3KABA 2Y8NB 1D7JA 3B8SA 3MDYB 4Z2KA 2ZQTA 1W1TA 3FSCA 4G50A 2KO7A 4P8WA 4AY1A 1EQ3A 5HUAA 3UF8A 4HARA 3WD1A 4ODRA 2EZ5W 4DRQA 3FS8A 4WJXA 3RGCA 4ZPVR 1E15A 2YSHA 2A3CA 4UDMA 1UR8A 1NWTA 3RM8A 1BKFA 2DSWA 2F23A 3AS1A 3FXYA 3WL0A 3M7NA 1LL7A 1GUVA 1M5YA 2K8IA 1X6NA 4MGVA 1EHNA 3O5MA 4W5UA 3O5QA 2ZAJA 4ODQA 1FKBA 3EY6A 4C02B 4ML4A 5JH8A 3BMBA 5U47A 1FKFA 2B31A 1FKJA 2DT1A 2A3AA 3AS2A 4ODNA 2DMVA 1T11A 4DWSA 1K9QA 1WB0A 1KFWA 1ZBCA 2RUDA 2M3OW 1ROTA 1RP5A 2O92A 2DSUA 2WM0A 3KAHA 2DK1A 2RUCA 5DITA 3MQHA 2PBCA 1X6LA 3UI6A 3O5RA 1HJVA 2LGOA 3W4RA 1F8AB 2PV1A 3ODKA 2QF8A 3ARXA 2YAJB 1VF8A 3G6LA 4IT4A 1O6WA 1QPFA 2XPBA 4QIBA 3PRAA 1KT1A 3IKDA 1I5HW 2OFNA 1FKDA 1LG2A 1LJYA 3UI5A 2RQSA 4ODMA 1FD9A 1ZBWA 3EIPA 4N19A 2XP4A 2QRVA 4IQCA 1FFRA 4Z2GA 5DF0A 1D6OA 2VCDA 1H0IA 2KXQA 3WQVA 1KT0A 1WR7A 3WD2A 4U85A 2YSGA 4P8UA 4QT2A 4IT6A 3B9DA 2MLYA 1E9LA 3NRKA 2MPHA 2E45A 4S3JA 4DROA 3ARZA 2XP5A 3IK8A 4LAWA 1EG4A 1L1PA 3AS0A 4W9QA 1H0GA 2PV3A 4REXA 4G2PA 2PPNA 1NMVA 3ARPA 2ZQUA 1E6RA 3MQGA 3GPKA 1U79A 1IX5A 1GPFA 3CHDA 4TW8A 1EG3A 2YSIA 1HKMA 1B6CA 1ZBKA 5E66A 4P8XA 4WKAA 3RFWA 1FFQA 1K9TA 2ESCA 3LE4A 3TCZA 3PRBA 1FKKA 3MCBB 2MNTA 3RM4A 3O5KA 4KR0B 2LAJA 2A3EA 3ALGA 4WK9A 2XP6A 2YSFA 2KFWA 4DWSD 3TC5A 2FKEA 2XP9A 5J6EA 5HBFA 5DO2A 1TFVA 1W1VA 3O5IA 2AWGA 2PPOA 2ZR5A 3KADA 4Q22A 1E6PA 1W9PA 2JX8A 2EULA 1HJXA 4WKHA 3FAPA 1EDQA 1F40A 1ZU8A 3O5OA 1J4RA 5CQ2A 1D7HA 2O9OA 3ARWA 4ZPTR 3CHCA 2WLZA 1FKLA 1WMVA 1ROUA 2DT2A 4FN2A 2XP3A 4JFKA 2KE0A 5HTGA 1FKHA 2DT3A 1HKJA 4QZVB 4PTMA 4Z2JA 4HBEA 3BXWA 3O5GA 4IPXA 4JFMA 1ZL1A 3OA5A 4ZPWR 4MTVA 5D75A 3TDBA 1JCHB 2ZR6A 1LQ0A 5HW6A 3KAFA 3PRDA 3M85A 3OOBA 3ARYA 1J4IA 2DSZA 4DRNA 3NTPA 4TYOA 3VAWA 2XPAA 2RUQA 3ARSA 3G6MA 3WL1A 1LG1A 3PQHA 2M8JA 1P5QA 1ZCNA 4LAYA 3LKXA 1YATA 4GIVA 4HBOA 3ARQA 1FJDA 4DZ3A 2M1IA 4MAVA 4NZCA 1D2KA 1C9HA 4E5RA 1XRVA 4JFLA 5GPRA 3O5EA 1WAWA 2F2DA 1OWQA 2ZQVA 1BL4A 1NMWA 2M8IA 2RSEA 3WD3A 4ODLA 5E64A 2ZR4A 3H9RB 3KAGA 2WK2A 4MNLA 1JNTA 2DSVA 3FY1A 4ODPA 1ZBVA 1HKIA 4J4OA 4DRPA 1FKGA 4TNSA 3O5DA 3ARVA 3RM9A 2FDMA 1ITXA 3ALFA 4DWSB 4U86A 2ITKA 1FKIA 4L72B 3CH9A 2OWOA 1Q6IA 3B9EA 3O5FA 4IQ2A 2P4VA 5GQBA 4JYSA 1LL6A 2JV4A 1RD6A 2DWVA 4DRKA 3O5LA 1TK7A 3PA7A 2LKNA 3GTYX 2L4JA 2VN1A 4W9OA 4LAXA 2M2AA 3UQBA 1J6YA 4A0UA 2Y78A 5GPGA 4A0TA 1NWSA 3CNGA 5HT1A 2ETNA 3L4HA 3LUOA 1Y0OA 4QT3A 1Q1CA 4JFJA 3I6CA 3LKXB 2AOSA 4DZ2A 4LAVA 1Q6HA 1N1AA 3AROA 3QOKA 4NSBA 5HW7A 1E6NA 3NI6A 2YBUA 4TW6A 4WIWA 1XHGA 3IHZA 3CHEA 5HW8A 1TR8A 1SYTA 1Q6UA 1QPLA 1NSGA 4MNJA 3B7XA 2YSBA 1NWUA 3WD0A 2MLZA 2JMFA 4DRIA 1W1YA 4Z2LA 1HKKA 2WADA 4MNKA 2DJYA 3AQUA 1JMQA 2WAEA 1R9HA 5I98A 4Z2IA 2RE3A 5HWBA 1FKRA 3GU0A 2IUZA 3UI4A 5E62A 2F4EA 1SR0A 1W26A 2ZQSA 5DIVA 1ZB5A 5HWCA 3ARRA 4R5EA 1OGGA 4TX0A 1ZK6A 2UZ5A 4DT4A 3WKZA 4DH0A 3JXVA 3KZ7A 4ZS6A 1K9RA 1JNSA 3ARUA 4WKFA 2KR7A 3JYMA 3WH0A 1QZ2A 2PN0A 1NH6A 2PI6A 3IKGA 1E44A 4BF8A 2DG9A 3CZ8A 2DG4A 3KACA 2XP8A 4Q7NA 2JZVA 1O6IA
chains in the Genus database with same CATH topology
4GGQA 4DRJA 1PINA 1LL4A 3ARTA 4NNRA 2RURA 1W9VA 2DPEA 4JFIA 4S3KA 3CGMA 3CHFA 3MCBA 3WQWA 4U84A 3O5JA 2Q5AA 1W1PA 2BA1A 4ITZA 4GLXA 2YBTA 4DIPA 1JVWA 1PBKA 4XAKA 5DEZA 5DIUA 1A7XA 3UQIA 1JNDA 2PPPA 4L3NA 1TCOC 4FAPA 2F21A 1HXVA 2G8ZA 1WNOA 1E6ZA 4URIA 4DWSC 2A3BA 5BXJA 2LJ4A 4LGXA 3RMEA 3FSBA 2DG3A 4TW7A 1FKTA 3KCEA 3JYJA 4O2TA 1CTNA 2DK7A 4KQZA 2DT0A 1J4HA 5E65A 4MPKA 1W9UA 2JXWA 1EYMA 1HJWA 4DRHA 2PV2A 1FKSA 1FLCA 2WLYA 4ODOA 4P8VA 3O5PA 2KI3A 3AS3A 3B9AA 4J4NA 4ODKA 3WIJA 4DRMA 2MF9A 5E5WA 2XP7A 4MSPA 3KAIA 4R0XA 4Z2HA 1GOIA 2L2SA 5B8IC 1D7IA 2N87A 1YW5A 1NWRA 2D9FA 2MLXA 3PR9A 3UQAA 2MDIA 1EIBA 2M08A 2IF4A 1UR9A 1JNEA 3CGNA 4W9PA 1FAPA 1OGBA 3WD4A 2FAPA 2LPVA 4MNMA 5AHTA 2G41A 5HKGA 2OLHA 2KGJA 3KABA 2Y8NB 1D7JA 3B8SA 3MDYB 4Z2KA 2ZQTA 1W1TA 3FSCA 4G50A 2KO7A 4P8WA 4AY1A 1EQ3A 5HUAA 3UF8A 4HARA 3WD1A 4ODRA 2EZ5W 4DRQA 3FS8A 4WJXA 3RGCA 4ZPVR 1E15A 2YSHA 2A3CA 1UR8A 1NWTA 3RM8A 1BKFA 2DSWA 3AS1A 3FXYA 3WL0A 3M7NA 1LL7A 1GUVA 1M5YA 2K8IA 1X6NA 4MGVA 1EHNA 3O5MA 4W5UA 3O5QA 2ZAJA 4ODQA 1FKBA 3EY6A 4C02B 4ML4A 5JH8A 5U47A 1FKFA 2B31A 1FKJA 2DT1A 2A3AA 3AS2A 4ODNA 2DMVA 1T11A 4DWSA 1K9QA 1WB0A 1KFWA 1ZBCA 2RUDA 2M3OW 1ROTA 1RP5A 2O92A 2DSUA 2WM0A 3KAHA 2DK1A 2RUCA 5DITA 3MQHA 2PBCA 1X6LA 3UI6A 3O5RA 1HJVA 2LGOA 3W4RA 1F8AB 2PV1A 3ODKA 2QF8A 3ARXA 2YAJB 1VF8A 3G6LA 4IT4A 1O6WA 1QPFA 2XPBA 4QIBA 3PRAA 1KT1A 3IKDA 1I5HW 2OFNA 1FKDA 1LG2A 1LJYA 3UI5A 2RQSA 4ODMA 1FD9A 1ZBWA 4N19A 2XP4A 2QRVA 4IQCA 1FFRA 4Z2GA 5DF0A 1D6OA 2VCDA 1H0IA 2KXQA 3WQVA 1KT0A 1WR7A 3WD2A 4U85A 2YSGA 4P8UA 4QT2A 4IT6A 3B9DA 2MLYA 1E9LA 3NRKA 2MPHA 2E45A 4S3JA 4DROA 3ARZA 2XP5A 3IK8A 4LAWA 1EG4A 1L1PA 3AS0A 4W9QA 1H0GA 2PV3A 4REXA 4G2PA 2PPNA 1NMVA 3ARPA 2ZQUA 1E6RA 3MQGA 3GPKA 1U79A 1IX5A 1GPFA 3CHDA 4TW8A 1EG3A 2YSIA 1HKMA 1B6CA 1ZBKA 5E66A 4P8XA 4WKAA 3RFWA 1FFQA 1K9TA 2ESCA 3LE4A 3TCZA 3PRBA 1FKKA 3MCBB 2MNTA 3RM4A 3O5KA 4KR0B 2LAJA 2A3EA 3ALGA 4WK9A 2XP6A 2YSFA 2KFWA 4DWSD 3TC5A 2FKEA 2XP9A 5J6EA 5HBFA 5DO2A 1TFVA 1W1VA 3O5IA 2AWGA 2PPOA 2ZR5A 3KADA 4Q22A 1E6PA 1W9PA 2JX8A 1HJXA 4WKHA 3FAPA 1EDQA 1F40A 1ZU8A 3O5OA 1J4RA 5CQ2A 1D7HA 2O9OA 3ARWA 4ZPTR 3CHCA 2WLZA 1FKLA 1WMVA 1ROUA 2DT2A 4FN2A 2XP3A 4JFKA 2KE0A 5HTGA 1FKHA 2DT3A 1HKJA 4QZVB 4PTMA 4Z2JA 4HBEA 3BXWA 3O5GA 4IPXA 4JFMA 1ZL1A 3OA5A 4ZPWR 4MTVA 5D75A 3TDBA 1LQ0A 2ZR6A 5HW6A 3KAFA 3PRDA 3M85A 3OOBA 3ARYA 1J4IA 2DSZA 4DRNA 3NTPA 4TYOA 3VAWA 2XPAA 2RUQA 3ARSA 3G6MA 3WL1A 1LG1A 3PQHA 2M8JA 1P5QA 1ZCNA 4LAYA 3LKXA 1YATA 4GIVA 4HBOA 3ARQA 1FJDA 4DZ3A 2M1IA 4MAVA 4NZCA 1D2KA 1C9HA 4E5RA 1XRVA 4JFLA 5GPRA 3O5EA 1WAWA 2F2DA 1OWQA 2ZQVA 1BL4A 1NMWA 2M8IA 2RSEA 3WD3A 4ODLA 5E64A 2ZR4A 3H9RB 3KAGA 2WK2A 4MNLA 1JNTA 2DSVA 3FY1A 4ODPA 1ZBVA 1HKIA 4J4OA 4DRPA 1FKGA 4TNSA 3O5DA 3ARVA 3RM9A 2FDMA 1ITXA 3ALFA 4DWSB 4U86A 2ITKA 1FKIA 4L72B 3CH9A 2OWOA 1Q6IA 3B9EA 3O5FA 4IQ2A 5GQBA 4JYSA 1LL6A 2JV4A 1RD6A 2DWVA 4DRKA 3O5LA 1TK7A 3PA7A 2LKNA 2L4JA 2VN1A 4W9OA 4LAXA 2M2AA 3UQBA 1J6YA 4A0UA 2Y78A 5GPGA 4A0TA 1NWSA 3CNGA 5HT1A 3L4HA 3LUOA 1Y0OA 4QT3A 1Q1CA 4JFJA 3I6CA 3LKXB 2AOSA 4DZ2A 4LAVA 1Q6HA 1N1AA 3AROA 3QOKA 4NSBA 5HW7A 1E6NA 3NI6A 2YBUA 4TW6A 4WIWA 1XHGA 3IHZA 3CHEA 5HW8A 1TR8A 1SYTA 1Q6UA 1QPLA 1NSGA 4MNJA 3B7XA 2YSBA 1NWUA 3WD0A 2MLZA 2JMFA 4DRIA 1W1YA 4Z2LA 1HKKA 2WADA 4MNKA 2DJYA 3AQUA 1JMQA 2WAEA 1R9HA 5I98A 4Z2IA 2RE3A 5HWBA 1FKRA 2IUZA 3UI4A 5E62A 2F4EA 1SR0A 1W26A 2ZQSA 5DIVA 1ZB5A 5HWCA 3ARRA 4R5EA 1OGGA 4TX0A 1ZK6A 2UZ5A 4DT4A 3WKZA 4DH0A 3JXVA 3KZ7A 4ZS6A 1K9RA 1JNSA 3ARUA 4WKFA 2KR7A 3JYMA 3WH0A 1QZ2A 1NH6A 2PI6A 3IKGA 4BF8A 2DG9A 3CZ8A 2DG4A 3KACA 2XP8A 4Q7NA 2JZVA 1O6IA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4GGQ A;  4DRJ A;  1PIN A;  4NNR A;  2RUR A;  4JFI A;  3CGM A;  4U84 A;  3O5J A;  2Q5A A;  2BA1 A;  4ITZ A;  4DIP A;  1JVW A;  1PBK A;  5DIU A;  1A7X A;  3UQI A;  2PPP A;  4FAP A;  1TCO C;  2F21 A;  1HXV A;  5BXJ A;  2LJ4 A;  4TW7 A;  2DG3 A;  1FKT A;  3KCE A;  3JYJ A;  4O2T A;  2DK7 A;  1J4H A;  2JXW A;  1EYM A;  4DRH A;  2PV2 A;  1FKS A;  4ODO A;  3O5P A;  2KI3 A;  4J4N A;  4ODK A;  4DRM A;  2MF9 A;  2XP7 A;  4MSP A;  3KAI A;  4R0X A;  2L2S A;  5B8I C;  1D7I A;  2N87 A;  1YW5 A;  2D9F A;  2MLX A;  3UQA A;  2MDI A;  2M08 A;  2IF4 A;  3CGN A;  4W9P A;  1FAP A;  2FAP A;  2LPV A;  5AHT A;  5HKG A;  2KGJ A;  3KAB A;  1D7J A;  3MDY B;  2ZQT A;  4G50 A;  2KO7 A;  1EQ3 A;  5HUA A;  3UF8 A;  4ODR A;  2EZ5 W;  4DRQ A;  3RGC A;  2YSH A;  1BKF A;  3M7N A;  1M5Y A;  2K8I A;  4MGV A;  3O5M A;  3O5Q A;  2ZAJ A;  4ODQ A;  1FKB A;  3EY6 A;  4C02 B;  1FKF A;  1FKJ A;  4ODN A;  2DMV A;  1T11 A;  1K9Q A;  2RUD A;  2M3O W;  1ROT A;  3KAH A;  2DK1 A;  2RUC A;  5DIT A;  2PBC A;  3UI6 A;  3O5R A;  2LGO A;  1F8A B;  2PV1 A;  3ODK A;  1O6W A;  1QPF A;  2XPB A;  4QIB A;  1KT1 A;  3IKD A;  1I5H W;  2OFN A;  1FKD A;  3UI5 A;  2RQS A;  4ODM A;  1FD9 A;  4N19 A;  2XP4 A;  4IQC A;  1D6O A;  2VCD A;  2KXQ A;  1KT0 A;  1WR7 A;  4U85 A;  2YSG A;  4QT2 A;  2MLY A;  3NRK A;  2MPH A;  2E45 A;  4DRO A;  2XP5 A;  3IK8 A;  4LAW A;  1EG4 A;  1L1P A;  4W9Q A;  2PV3 A;  4REX A;  4G2P A;  2PPN A;  1NMV A;  2ZQU A;  3GPK A;  1U79 A;  4TW8 A;  1EG3 A;  2YSI A;  1B6C A;  3RFW A;  3LE4 A;  3TCZ A;  3PRB A;  1FKK A;  2MNT A;  3O5K A;  2LAJ A;  2XP6 A;  2YSF A;  2KFW A;  3TC5 A;  2FKE A;  2XP9 A;  5J6E A;  3O5I A;  2AWG A;  2PPO A;  2ZR5 A;  3KAD A;  2JX8 A;  3FAP A;  1F40 A;  3O5O A;  1J4R A;  5CQ2 A;  1D7H A;  1FKL A;  1WMV A;  4FN2 A;  1ROU A;  4JFK A;  2XP3 A;  2KE0 A;  5HTG A;  1FKH A;  3O5G A;  4IPX A;  4JFM A;  5D75 A;  3TDB A;  2ZR6 A;  5HW6 A;  3KAF A;  3PRD A;  3M85 A;  3OOB A;  1J4I A;  4DRN A;  3NTP A;  4TYO A;  3VAW A;  2XPA A;  2RUQ A;  2M8J A;  1P5Q A;  1ZCN A;  4LAY A;  1YAT A;  4GIV A;  1FJD A;  4DZ3 A;  2M1I A;  1C9H A;  4E5R A;  4JFL A;  3O5E A;  2F2D A;  2ZQV A;  1BL4 A;  1NMW A;  2M8I A;  2RSE A;  4ODL A;  2ZR4 A;  3H9R B;  3KAG A;  1JNT A;  4ODP A;  4J4O A;  4DRP A;  1FKG A;  4TNS A;  3O5D A;  4U86 A;  2ITK A;  1FKI A;  1Q6I A;  3O5F A;  4IQ2 A;  4JYS A;  2JV4 A;  2DWV A;  4DRK A;  3O5L A;  1TK7 A;  3PA7 A;  2LKN A;  2L4J A;  2VN1 A;  4W9O A;  4LAX A;  2M2A A;  3UQB A;  1J6Y A;  2Y78 A;  5GPG A;  3CNG A;  5HT1 A;  3L4H A;  3LUO A;  1Y0O A;  4QT3 A;  1Q1C A;  4JFJ A;  3I6C A;  4DZ2 A;  4LAV A;  1Q6H A;  1N1A A;  5HW7 A;  3NI6 A;  4TW6 A;  3IHZ A;  5HW8 A;  1Q6U A;  1QPL A;  1NSG A;  3B7X A;  2YSB A;  2MLZ A;  2JMF A;  4DRI A;  2DJY A;  1JMQ A;  1R9H A;  5I98 A;  2RE3 A;  5HWB A;  1FKR A;  3UI4 A;  2F4E A;  1W26 A;  2ZQS A;  5DIV A;  5HWC A;  4TX0 A;  1ZK6 A;  2UZ5 A;  4DT4 A;  4DH0 A;  3JXV A;  3KZ7 A;  1K9R A;  1JNS A;  2KR7 A;  3JYM A;  3WH0 A;  1QZ2 A;  3IKG A;  4BF8 A;  2DG9 A;  2DG4 A;  3KAC A;  2XP8 A;  2JZV A; 
#chains in the Genus database with same CATH topology
 4GGQ A;  4DRJ A;  1PIN A;  1LL4 A;  3ART A;  4NNR A;  2RUR A;  1W9V A;  2DPE A;  4JFI A;  4S3K A;  3CGM A;  3CHF A;  3MCB A;  3WQW A;  4U84 A;  3O5J A;  2Q5A A;  1W1P A;  2BA1 A;  4ITZ A;  4GLX A;  2YBT A;  4DIP A;  1JVW A;  1PBK A;  4XAK A;  5DEZ A;  5DIU A;  1A7X A;  3UQI A;  1JND A;  2PPP A;  4L3N A;  1TCO C;  4FAP A;  2F21 A;  1HXV A;  2G8Z A;  1WNO A;  1E6Z A;  4URI A;  4DWS C;  2A3B A;  5BXJ A;  2LJ4 A;  4LGX A;  3RME A;  3FSB A;  2DG3 A;  4TW7 A;  1FKT A;  3KCE A;  3JYJ A;  4O2T A;  1CTN A;  2DK7 A;  4KQZ A;  2DT0 A;  1J4H A;  5E65 A;  4MPK A;  1W9U A;  2JXW A;  1EYM A;  1HJW A;  4DRH A;  2PV2 A;  1FKS A;  1FLC A;  2WLY A;  4ODO A;  4P8V A;  3O5P A;  2KI3 A;  3AS3 A;  3B9A A;  4J4N A;  4ODK A;  3WIJ A;  4DRM A;  2MF9 A;  5E5W A;  2XP7 A;  4MSP A;  3KAI A;  4R0X A;  4Z2H A;  1GOI A;  2B5U B;  2L2S A;  5B8I C;  1D7I A;  2N87 A;  1YW5 A;  1NWR A;  2D9F A;  2MLX A;  1GRJ A;  3PR9 A;  3UQA A;  2MDI A;  1EIB A;  2M08 A;  2IF4 A;  1UR9 A;  1JNE A;  3CGN A;  4W9P A;  1FAP A;  1OGB A;  3WD4 A;  2FAP A;  2LPV A;  4MNM A;  5AHT A;  2G41 A;  5HKG A;  2OLH A;  2KGJ A;  3KAB A;  2Y8N B;  1D7J A;  3B8S A;  3MDY B;  4Z2K A;  2ZQT A;  1W1T A;  3FSC A;  4G50 A;  2KO7 A;  4P8W A;  4AY1 A;  1EQ3 A;  5HUA A;  3UF8 A;  4HAR A;  3WD1 A;  4ODR A;  2EZ5 W;  4DRQ A;  3FS8 A;  4WJX A;  3RGC A;  4ZPV R;  1E15 A;  2YSH A;  2A3C A;  4UDM A;  1UR8 A;  1NWT A;  3RM8 A;  1BKF A;  2DSW A;  2F23 A;  3AS1 A;  3FXY A;  3WL0 A;  3M7N A;  1LL7 A;  1GUV A;  1M5Y A;  2K8I A;  1X6N A;  4MGV A;  1EHN A;  3O5M A;  4W5U A;  3O5Q A;  2ZAJ A;  4ODQ A;  1FKB A;  3EY6 A;  4C02 B;  4ML4 A;  5JH8 A;  3BMB A;  5U47 A;  1FKF A;  2B31 A;  1FKJ A;  2DT1 A;  2A3A A;  3AS2 A;  4ODN A;  2DMV A;  1T11 A;  4DWS A;  1K9Q A;  1WB0 A;  1KFW A;  1ZBC A;  2RUD A;  2M3O W;  1ROT A;  1RP5 A;  2O92 A;  2DSU A;  2WM0 A;  3KAH A;  2DK1 A;  2RUC A;  5DIT A;  3MQH A;  2PBC A;  1X6L A;  3UI6 A;  3O5R A;  1HJV A;  2LGO A;  3W4R A;  1F8A B;  2PV1 A;  3ODK A;  2QF8 A;  3ARX A;  2YAJ B;  1VF8 A;  3G6L A;  4IT4 A;  1O6W A;  1QPF A;  2XPB A;  4QIB A;  3PRA A;  1KT1 A;  3IKD A;  1I5H W;  2OFN A;  1FKD A;  1LG2 A;  1LJY A;  3UI5 A;  2RQS A;  4ODM A;  1FD9 A;  1ZBW A;  3EIP A;  4N19 A;  2XP4 A;  2QRV A;  4IQC A;  1FFR A;  4Z2G A;  5DF0 A;  1D6O A;  2VCD A;  1H0I A;  2KXQ A;  3WQV A;  1KT0 A;  1WR7 A;  3WD2 A;  4U85 A;  2YSG A;  4P8U A;  4QT2 A;  4IT6 A;  3B9D A;  2MLY A;  1E9L A;  3NRK A;  2MPH A;  2E45 A;  4S3J A;  4DRO A;  3ARZ A;  2XP5 A;  3IK8 A;  4LAW A;  1EG4 A;  1L1P A;  3AS0 A;  4W9Q A;  1H0G A;  2PV3 A;  4REX A;  4G2P A;  2PPN A;  1NMV A;  3ARP A;  2ZQU A;  1E6R A;  3MQG A;  3GPK A;  1U79 A;  1IX5 A;  1GPF A;  3CHD A;  4TW8 A;  1EG3 A;  2YSI A;  1HKM A;  1B6C A;  1ZBK A;  5E66 A;  4P8X A;  4WKA A;  3RFW A;  1FFQ A;  1K9T A;  2ESC A;  3LE4 A;  3TCZ A;  3PRB A;  1FKK A;  3MCB B;  2MNT A;  3RM4 A;  3O5K A;  4KR0 B;  2LAJ A;  2A3E A;  3ALG A;  4WK9 A;  2XP6 A;  2YSF A;  2KFW A;  4DWS D;  3TC5 A;  2FKE A;  2XP9 A;  5J6E A;  5HBF A;  5DO2 A;  1TFV A;  1W1V A;  3O5I A;  2AWG A;  2PPO A;  2ZR5 A;  3KAD A;  4Q22 A;  1E6P A;  1W9P A;  2JX8 A;  2EUL A;  1HJX A;  4WKH A;  3FAP A;  1EDQ A;  1F40 A;  1ZU8 A;  3O5O A;  1J4R A;  5CQ2 A;  1D7H A;  2O9O A;  3ARW A;  4ZPT R;  3CHC A;  2WLZ A;  1FKL A;  1WMV A;  1ROU A;  2DT2 A;  4FN2 A;  2XP3 A;  4JFK A;  2KE0 A;  5HTG A;  1FKH A;  2DT3 A;  1HKJ A;  4QZV B;  4PTM A;  4Z2J A;  4HBE A;  3BXW A;  3O5G A;  4IPX A;  4JFM A;  1ZL1 A;  3OA5 A;  4ZPW R;  4MTV A;  5D75 A;  3TDB A;  1JCH B;  2ZR6 A;  1LQ0 A;  5HW6 A;  3KAF A;  3PRD A;  3M85 A;  3OOB A;  3ARY A;  1J4I A;  2DSZ A;  4DRN A;  3NTP A;  4TYO A;  3VAW A;  2XPA A;  2RUQ A;  3ARS A;  3G6M A;  3WL1 A;  1LG1 A;  3PQH A;  2M8J A;  1P5Q A;  1ZCN A;  4LAY A;  3LKX A;  1YAT A;  4GIV A;  4HBO A;  3ARQ A;  1FJD A;  4DZ3 A;  2M1I A;  4MAV A;  4NZC A;  1D2K A;  1C9H A;  4E5R A;  1XRV A;  4JFL A;  5GPR A;  3O5E A;  1WAW A;  2F2D A;  1OWQ A;  2ZQV A;  1BL4 A;  1NMW A;  2M8I A;  2RSE A;  3WD3 A;  4ODL A;  5E64 A;  2ZR4 A;  3H9R B;  3KAG A;  2WK2 A;  4MNL A;  1JNT A;  2DSV A;  3FY1 A;  4ODP A;  1ZBV A;  1HKI A;  4J4O A;  4DRP A;  1FKG A;  4TNS A;  3O5D A;  3ARV A;  3RM9 A;  2FDM A;  1ITX A;  3ALF A;  4DWS B;  4U86 A;  2ITK A;  1FKI A;  4L72 B;  3CH9 A;  2OWO A;  1Q6I A;  3B9E A;  3O5F A;  4IQ2 A;  2P4V A;  5GQB A;  4JYS A;  1LL6 A;  2JV4 A;  1RD6 A;  2DWV A;  4DRK A;  3O5L A;  1TK7 A;  3PA7 A;  2LKN A;  3GTY X;  2L4J A;  2VN1 A;  4W9O A;  4LAX A;  2M2A A;  3UQB A;  1J6Y A;  4A0U A;  2Y78 A;  5GPG A;  4A0T A;  1NWS A;  3CNG A;  5HT1 A;  2ETN A;  3L4H A;  3LUO A;  1Y0O A;  4QT3 A;  1Q1C A;  4JFJ A;  3I6C A;  3LKX B;  2AOS A;  4DZ2 A;  4LAV A;  1Q6H A;  1N1A A;  3ARO A;  3QOK A;  4NSB A;  5HW7 A;  1E6N A;  3NI6 A;  2YBU A;  4TW6 A;  4WIW A;  1XHG A;  3IHZ A;  3CHE A;  5HW8 A;  1TR8 A;  1SYT A;  1Q6U A;  1QPL A;  1NSG A;  4MNJ A;  3B7X A;  2YSB A;  1NWU A;  3WD0 A;  2MLZ A;  2JMF A;  4DRI A;  1W1Y A;  4Z2L A;  1HKK A;  2WAD A;  4MNK A;  2DJY A;  3AQU A;  1JMQ A;  2WAE A;  1R9H A;  5I98 A;  4Z2I A;  2RE3 A;  5HWB A;  1FKR A;  3GU0 A;  2IUZ A;  3UI4 A;  5E62 A;  2F4E A;  1SR0 A;  1W26 A;  2ZQS A;  5DIV A;  1ZB5 A;  5HWC A;  3ARR A;  4R5E A;  1OGG A;  4TX0 A;  1ZK6 A;  2UZ5 A;  4DT4 A;  3WKZ A;  4DH0 A;  3JXV A;  3KZ7 A;  4ZS6 A;  1K9R A;  1JNS A;  3ARU A;  4WKF A;  2KR7 A;  3JYM A;  3WH0 A;  1QZ2 A;  2PN0 A;  1NH6 A;  2PI6 A;  3IKG A;  1E44 A;  4BF8 A;  2DG9 A;  3CZ8 A;  2DG4 A;  3KAC A;  2XP8 A;  4Q7N A;  2JZV A;  1O6I A; 
#chains in the Genus database with same CATH homology
 4GGQ A;  4DRJ A;  1PIN A;  1LL4 A;  3ART A;  4NNR A;  2RUR A;  1W9V A;  2DPE A;  4JFI A;  4S3K A;  3CGM A;  3CHF A;  3MCB A;  3WQW A;  4U84 A;  3O5J A;  2Q5A A;  1W1P A;  2BA1 A;  4ITZ A;  4GLX A;  2YBT A;  4DIP A;  1JVW A;  1PBK A;  4XAK A;  5DEZ A;  5DIU A;  1A7X A;  3UQI A;  1JND A;  2PPP A;  4L3N A;  1TCO C;  4FAP A;  2F21 A;  1HXV A;  2G8Z A;  1WNO A;  1E6Z A;  4URI A;  4DWS C;  2A3B A;  5BXJ A;  2LJ4 A;  4LGX A;  3RME A;  3FSB A;  2DG3 A;  4TW7 A;  1FKT A;  3KCE A;  3JYJ A;  4O2T A;  1CTN A;  2DK7 A;  4KQZ A;  2DT0 A;  1J4H A;  5E65 A;  4MPK A;  1W9U A;  2JXW A;  1EYM A;  1HJW A;  4DRH A;  2PV2 A;  1FKS A;  1FLC A;  2WLY A;  4ODO A;  4P8V A;  3O5P A;  2KI3 A;  3AS3 A;  3B9A A;  4J4N A;  4ODK A;  3WIJ A;  4DRM A;  2MF9 A;  5E5W A;  2XP7 A;  4MSP A;  3KAI A;  4R0X A;  4Z2H A;  1GOI A;  2L2S A;  5B8I C;  1D7I A;  2N87 A;  1YW5 A;  1NWR A;  2D9F A;  2MLX A;  3PR9 A;  3UQA A;  2MDI A;  1EIB A;  2M08 A;  2IF4 A;  1UR9 A;  1JNE A;  3CGN A;  4W9P A;  1FAP A;  1OGB A;  3WD4 A;  2FAP A;  2LPV A;  4MNM A;  5AHT A;  2G41 A;  5HKG A;  2OLH A;  2KGJ A;  3KAB A;  2Y8N B;  1D7J A;  3B8S A;  3MDY B;  4Z2K A;  2ZQT A;  1W1T A;  3FSC A;  4G50 A;  2KO7 A;  4P8W A;  4AY1 A;  1EQ3 A;  5HUA A;  3UF8 A;  4HAR A;  3WD1 A;  4ODR A;  2EZ5 W;  4DRQ A;  3FS8 A;  4WJX A;  3RGC A;  4ZPV R;  1E15 A;  2YSH A;  2A3C A;  1UR8 A;  1NWT A;  3RM8 A;  1BKF A;  2DSW A;  3AS1 A;  3FXY A;  3WL0 A;  3M7N A;  1LL7 A;  1GUV A;  1M5Y A;  2K8I A;  1X6N A;  4MGV A;  1EHN A;  3O5M A;  4W5U A;  3O5Q A;  2ZAJ A;  4ODQ A;  1FKB A;  3EY6 A;  4C02 B;  4ML4 A;  5JH8 A;  5U47 A;  1FKF A;  2B31 A;  1FKJ A;  2DT1 A;  2A3A A;  3AS2 A;  4ODN A;  2DMV A;  1T11 A;  4DWS A;  1K9Q A;  1WB0 A;  1KFW A;  1ZBC A;  2RUD A;  2M3O W;  1ROT A;  1RP5 A;  2O92 A;  2DSU A;  2WM0 A;  3KAH A;  2DK1 A;  2RUC A;  5DIT A;  3MQH A;  2PBC A;  1X6L A;  3UI6 A;  3O5R A;  1HJV A;  2LGO A;  3W4R A;  1F8A B;  2PV1 A;  3ODK A;  2QF8 A;  3ARX A;  2YAJ B;  1VF8 A;  3G6L A;  4IT4 A;  1O6W A;  1QPF A;  2XPB A;  4QIB A;  3PRA A;  1KT1 A;  3IKD A;  1I5H W;  2OFN A;  1FKD A;  1LG2 A;  1LJY A;  3UI5 A;  2RQS A;  4ODM A;  1FD9 A;  1ZBW A;  4N19 A;  2XP4 A;  2QRV A;  4IQC A;  1FFR A;  4Z2G A;  5DF0 A;  1D6O A;  2VCD A;  1H0I A;  2KXQ A;  3WQV A;  1KT0 A;  1WR7 A;  3WD2 A;  4U85 A;  2YSG A;  4P8U A;  4QT2 A;  4IT6 A;  3B9D A;  2MLY A;  1E9L A;  3NRK A;  2MPH A;  2E45 A;  4S3J A;  4DRO A;  3ARZ A;  2XP5 A;  3IK8 A;  4LAW A;  1EG4 A;  1L1P A;  3AS0 A;  4W9Q A;  1H0G A;  2PV3 A;  4REX A;  4G2P A;  2PPN A;  1NMV A;  3ARP A;  2ZQU A;  1E6R A;  3MQG A;  3GPK A;  1U79 A;  1IX5 A;  1GPF A;  3CHD A;  4TW8 A;  1EG3 A;  2YSI A;  1HKM A;  1B6C A;  1ZBK A;  5E66 A;  4P8X A;  4WKA A;  3RFW A;  1FFQ A;  1K9T A;  2ESC A;  3LE4 A;  3TCZ A;  3PRB A;  1FKK A;  3MCB B;  2MNT A;  3RM4 A;  3O5K A;  4KR0 B;  2LAJ A;  2A3E A;  3ALG A;  4WK9 A;  2XP6 A;  2YSF A;  2KFW A;  4DWS D;  3TC5 A;  2FKE A;  2XP9 A;  5J6E A;  5HBF A;  5DO2 A;  1TFV A;  1W1V A;  3O5I A;  2AWG A;  2PPO A;  2ZR5 A;  3KAD A;  4Q22 A;  1E6P A;  1W9P A;  2JX8 A;  1HJX A;  4WKH A;  3FAP A;  1EDQ A;  1F40 A;  1ZU8 A;  3O5O A;  1J4R A;  5CQ2 A;  1D7H A;  2O9O A;  3ARW A;  4ZPT R;  3CHC A;  2WLZ A;  1FKL A;  1WMV A;  1ROU A;  2DT2 A;  4FN2 A;  2XP3 A;  4JFK A;  2KE0 A;  5HTG A;  1FKH A;  2DT3 A;  1HKJ A;  4QZV B;  4PTM A;  4Z2J A;  4HBE A;  3BXW A;  3O5G A;  4IPX A;  4JFM A;  1ZL1 A;  3OA5 A;  4ZPW R;  4MTV A;  5D75 A;  3TDB A;  1LQ0 A;  2ZR6 A;  5HW6 A;  3KAF A;  3PRD A;  3M85 A;  3OOB A;  3ARY A;  1J4I A;  2DSZ A;  4DRN A;  3NTP A;  4TYO A;  3VAW A;  2XPA A;  2RUQ A;  3ARS A;  3G6M A;  3WL1 A;  1LG1 A;  3PQH A;  2M8J A;  1P5Q A;  1ZCN A;  4LAY A;  3LKX A;  1YAT A;  4GIV A;  4HBO A;  3ARQ A;  1FJD A;  4DZ3 A;  2M1I A;  4MAV A;  4NZC A;  1D2K A;  1C9H A;  4E5R A;  1XRV A;  4JFL A;  5GPR A;  3O5E A;  1WAW A;  2F2D A;  1OWQ A;  2ZQV A;  1BL4 A;  1NMW A;  2M8I A;  2RSE A;  3WD3 A;  4ODL A;  5E64 A;  2ZR4 A;  3H9R B;  3KAG A;  2WK2 A;  4MNL A;  1JNT A;  2DSV A;  3FY1 A;  4ODP A;  1ZBV A;  1HKI A;  4J4O A;  4DRP A;  1FKG A;  4TNS A;  3O5D A;  3ARV A;  3RM9 A;  2FDM A;  1ITX A;  3ALF A;  4DWS B;  4U86 A;  2ITK A;  1FKI A;  4L72 B;  3CH9 A;  2OWO A;  1Q6I A;  3B9E A;  3O5F A;  4IQ2 A;  5GQB A;  4JYS A;  1LL6 A;  2JV4 A;  1RD6 A;  2DWV A;  4DRK A;  3O5L A;  1TK7 A;  3PA7 A;  2LKN A;  2L4J A;  2VN1 A;  4W9O A;  4LAX A;  2M2A A;  3UQB A;  1J6Y A;  4A0U A;  2Y78 A;  5GPG A;  4A0T A;  1NWS A;  3CNG A;  5HT1 A;  3L4H A;  3LUO A;  1Y0O A;  4QT3 A;  1Q1C A;  4JFJ A;  3I6C A;  3LKX B;  2AOS A;  4DZ2 A;  4LAV A;  1Q6H A;  1N1A A;  3ARO A;  3QOK A;  4NSB A;  5HW7 A;  1E6N A;  3NI6 A;  2YBU A;  4TW6 A;  4WIW A;  1XHG A;  3IHZ A;  3CHE A;  5HW8 A;  1TR8 A;  1SYT A;  1Q6U A;  1QPL A;  1NSG A;  4MNJ A;  3B7X A;  2YSB A;  1NWU A;  3WD0 A;  2MLZ A;  2JMF A;  4DRI A;  1W1Y A;  4Z2L A;  1HKK A;  2WAD A;  4MNK A;  2DJY A;  3AQU A;  1JMQ A;  2WAE A;  1R9H A;  5I98 A;  4Z2I A;  2RE3 A;  5HWB A;  1FKR A;  2IUZ A;  3UI4 A;  5E62 A;  2F4E A;  1SR0 A;  1W26 A;  2ZQS A;  5DIV A;  1ZB5 A;  5HWC A;  3ARR A;  4R5E A;  1OGG A;  4TX0 A;  1ZK6 A;  2UZ5 A;  4DT4 A;  3WKZ A;  4DH0 A;  3JXV A;  3KZ7 A;  4ZS6 A;  1K9R A;  1JNS A;  3ARU A;  4WKF A;  2KR7 A;  3JYM A;  3WH0 A;  1QZ2 A;  1NH6 A;  2PI6 A;  3IKG A;  4BF8 A;  2DG9 A;  3CZ8 A;  2DG4 A;  3KAC A;  2XP8 A;  4Q7N A;  2JZV A;  1O6I A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...