3TC5A

Selective targeting of disease-relevant protein binding domains by o-phosphorylated natural product derivatives
Total Genus 47
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
47
sequence length
157
structure length
144
Chain Sequence
LPPGWEKAMSRSSGRVYYFNHITNASQWERPEPARVRCSHLLVKHSQSRRPSSWRQEKITRTKEEALELINGYIQKIKSGEEDFESLASQFSDCSSAKARGDLGAFSRGQMQKPFEDASFALRTGEMSGPVFTDSGIHIILRTE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Selective targeting of disease-relevant protein binding domains by o-phosphorylated natural product derivatives.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Isomerase/isomerase inhibitor
molecule keywords Peptidyl-prolyl cis-trans isomerase NIMA-interacting 1
total genus 47
structure length 144
sequence length 157
ec nomenclature ec 5.2.1.8: Peptidylprolyl isomerase.
pdb deposition date 2011-08-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00397 WW WW domain
A PF00639 Rotamase PPIC-type PPIASE domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.20.70.10 Mainly Beta Single Sheet Ubiquitin Ligase Nedd4; Chain: W; Ubiquitin Ligase Nedd4; Chain: W; 3tc5A01
3.10.50.40 Alpha Beta Roll Chitinase A; domain 3 Chitinase A; domain 3 3tc5A02
2KE0A 2OFNA 3RGCA 3KCEA 2DG3A 1HXVA 2YSFA 4JFMA 2F2DA 2XPAA 2XP6A 3O5DA 1BL4A 2XP4A 1Q6UA 1K9RA 1YATA 3EY6A 4C02B 3UQAA 2KXQA 1PINA 2ZAJA 2M1IA 1FKBA 4IPXA 4DRIA 3O5EA 1D7JA 2M8JA 1FKSA 1FKIA 3PRDA 4DRKA 3KABA 2M3OW 2YSBA 2XPBA 1FKHA 1ROTA 5D75A 2Q5AA 1I5HW 3IK8A 4ODQA 3O5LA 4ODNA 3KACA 2DG9A 2PPNA 3TDBA 3UQBA 3OOBA 3UI4A 2XP5A 1JMQA 1J6YA 1EG4A 1A7XA 5HT1A 2XP3A 4BF8A 1WR7A 4N19A 3UQIA 4TNSA 2LJ4A 3M85A 1QZ2A 1ROUA 1TCOC 2RURA 2MLXA 5HW6A 2E45A 2F21A 2JZVA 2M08A 1Q1CA 4QIBA 4FN2A 3JXVA 4E5RA 2DMVA 2LKNA 4DRHA 1FKJA 5I98A 3H9RB 4TW6A 2M2AA 4W9QA 3CNGA 2ITKA 2XP9A 1EYMA 1FKTA 2PV3A 3NI6A 3UI5A 3IKDA 4ODLA 1NMVA 5HUAA 1JNSA 3RFWA 2K8IA 5HKGA 2YSHA 1NMWA 1D6OA 4O2TA 4ODOA 1TK7A 1JVWA 2JXWA 1J4RA 2PBCA 4GIVA 3B7XA 1L1PA 3CGMA 3JYMA 5CQ2A 4ODMA 3GPKA 2MNTA 2DK1A 4JFJA 1Q6IA 5DIUA 1JNTA 3ODKA 2LGOA 3LE4A 1Q6HA 4DRMA 2KI3A 2KR7A 4LAYA 5J6EA 1F40A 2ZQUA 2YSIA 1R9HA 2Y78A 1FAPA 4MGVA 1FKKA 4J4NA 2YSGA 3NRKA 1C9HA 2RQSA 2MF9A 2DK7A 3KAFA 3O5FA 4IQCA 4ITZA 2FKEA 4ODRA 4TW7A 4W9OA 1J4HA 5GPGA 3O5KA 3KAIA 1M5YA 5AHTA 4ODKA 2RSEA 2EZ5W 4DRNA 3KAGA 3CGNA 2MLYA 3PA7A 5HTGA 1PBKA 2D9FA 4R0XA 5DIVA 4GGQA 4JYSA 2BA1A 4DT4A 4LAVA 1O6WA 2DWVA 1KT0A 1P5QA 3O5JA 3IKGA 4U86A 1YW5A 5BXJA 4DH0A 4JFKA 3M7NA 4DRQA 1U79A 2AWGA 2L2SA 1FKDA 4DROA 1T11A 4REXA 3TCZA 3O5PA 2DJYA 2MDIA 2LPVA 4TYOA 1KT1A 2M8IA 3L4HA 2KFWA 3UI6A 2PV2A 1Y0OA 2F4EA 3FAPA 3KAHA 5HW8A 2RUCA 1FKRA 2RUDA 3TC5A 1QPFA 1FD9A 2ZR6A 2MPHA 2RUQA 2PPPA 2RE3A 3MDYB 4MSPA 5HW7A 1B6CA 3KZ7A 4G2PA 2XP8A 3JYJA 2IF4A 3O5OA 3PRBA 4DZ3A 3O5RA 4IQ2A 4NNRA 4W9PA 3O5MA 4DZ2A 5HWBA 1ZK6A 5HWCA 1FKLA 4DRJA 3WH0A 4QT2A 1QPLA 2ZQVA 3NTPA 2KO7A 2KGJA 2UZ5A 4DRPA 2ZQSA 1ZCNA 2JMFA 4U84A 1J4IA 1W26A 2JV4A 2VN1A 3O5IA 1FJDA 3I6CA 4ODPA 1EG3A 5B8IC 4TX0A 1D7HA 4LAXA 4TW8A 1K9QA 2PPOA 3LUOA 1FKFA 2L4JA 2ZQTA 1WMVA 2XP7A 1BKFA 1NSGA 3IHZA 2JX8A 4LAWA 4QT3A 1EQ3A 2DG4A 4U85A 2FAPA 1FKGA 1F8AB 3VAWA 2PV1A 2VCDA 3UF8A 2ZR5A 3O5QA 5DITA 3KADA 2MLZA 2LAJA 3O5GA 4J4OA 4JFLA 1D7IA 4JFIA 1N1AA 2ZR4A 2N87A 4DIPA 4FAPA 4G50A
chains in the Genus database with same CATH superfamily
2DG3A 1X6NA 2XP6A 3UQAA 4L72B 4C02B 2ZAJA 1PINA 1OWQA 3ARYA 5E65A 4WK9A 1WB0A 1D7JA 3AS3A 1W1VA 3MQHA 1I5HW 1LG2A 3FS8A 3O5LA 2DG9A 4WKHA 1FFQA 2PPNA 3TDBA 3UQBA 3OOBA 3UI4A 1J6YA 2AOSA 4URIA 3M85A 2E45A 2F21A 2JZVA 1Q1CA 3JXVA 3WL1A 1TFVA 4MPKA 2M2AA 1EYMA 4S3KA 4A0UA 3IKDA 3QOKA 1LL6A 4IT6A 2K8IA 5HKGA 4O2TA 1TK7A 1J4RA 1NH6A 5CQ2A 4P8WA 3RM4A 4XAKA 4HBEA 4JFJA 1Q6IA 2PN0A 4R5EA 2DSVA 2KR7A 5J6EA 3RM8A 4NZCA 5E64A 1C9HA 1ZBVA 2DK7A 2FKEA 1GPFA 1K9TA 1LL4A 3PA7A 4R0XA 3AS0A 4Z2IA 2P4VA 3O5JA 3IKGA 1YW5A 4Q7NA 1U79A 2AWGA 2WM0A 2MDIA 2WLYA 1ZB5A 4TYOA 2M8IA 2KFWA 3ARWA 3WQVA 3FAPA 1Y0OA 1E6ZA 1QPFA 1OGBA 1EIBA 1X6LA 2MPHA 3MCBA 2XP8A 3JYJA 3O5RA 4IQ2A 1RP5A 4W9PA 4DZ2A 5HWCA 1ZK6A 1XRVA 4DRPA 3NTPA 2WADA 2ZQSA 3BMBA 3WD4A 2VN1A 3I6CA 1EG3A 4TX0A 1D7HA 1SR0A 4NSBA 5GQBA 1WMVA 2XP7A 3IHZA 2DG4A 2FAPA 2WK2A 3G6MA 3O5QA 3KADA 4L3NA 4JFLA 3WL0A 1D7IA 1FFRA 2ZR4A 2N87A 1KFWA 4WJXA 4G50A 2OFNA 2YSFA 4JFMA 3B9EA 3O5DA 2XP4A 3EY6A 3FY1A 4IPXA 2FDMA 2M1IA 4DRIA 1FKBA 3AQUA 4Z2LA 1NWRA 3O5EA 1E9LA 1FKIA 3PRDA 3ALGA 1ROTA 3W4RA 2XPBA 1FKHA 2OWOA 4ODQA 4ODNA 4ZPWR 5GPRA 4Q22A 2DSZA 1W9UA 4DWSD 1JMQA 1EHNA 2YBUA 4W5UA 2XP3A 3UQIA 1ROUA 1TCOC 2RURA 3B9DA 4P8XA 4KQZA 2M08A 4QIBA 2O92A 2LKNA 1FKJA 5I98A 4TW6A 2ITKA 4ZS6A 3UI5A 4KR0B 4ODLA 5HUAA 3RFWA 4DWSB 1D6OA 3ARZA 3FXYA 4GIVA 1JVWA 3CGMA 3JYMA 4ODMA 3GPKA 5DIUA 4DRMA 2KI3A 3GTYX 2YSIA 2Y8NB 1NWSA 1FAPA 3NRKA 3CHFA 3KAFA 4ITZA 2QRVA 5GPGA 4W9OA 3O5KA 5AHTA 2EZ5W 1RD6A 4ML4A 3LKXA 1W1PA 2ESCA 4MNJA 1PBKA 4GGQA 1OGGA 2BA1A 1O6WA 2DWVA 3RM9A 5BXJA 4U86A 4DH0A 2DPEA 3ARPA 1FKDA 3B8SA 5DO2A 3WKZA 2DJYA 1TR8A 3UI6A 1FD9A 2ZR6A 2RUQA 2PPPA 2RE3A 2IF4A 1ZU8A 1HJVA 4GLXA 2ZQVA 3OA5A 2JMFA 2JV4A 2YAJB 1IX5A 5B8IC 3CH9A 4P8UA 1K9QA 1LL7A 2G41A 1FKFA 2L4JA 1W1YA 1BKFA 1NSGA 3LUOA 4MGVA 4Z2JA 3ARXA 3FSCA 4U85A 2PV1A 2A3EA 2LAJA 2WLZA 4JFIA 1N1AA 2DSUA 4QZVB 4DIPA 1WNOA 3FSBA 1BL4A 1Q6UA 2DSWA 1K9RA 2A3CA 2KXQA 1E6PA 1ZBWA 1GRJA 1FKSA 1JNEA 3KABA 2M3OW 2YSBA 1CTNA 4IT4A 3ALFA 5D75A 3IK8A 1NWUA 4MTVA 1W9PA 2XP5A 1EG4A 1UR8A 1A7XA 4N19A 3PRAA 5DEZA 4TNSA 2LJ4A 5HW6A 4FN2A 4P8VA 3H9RB 2O9OA 4W9QA 3CNGA 4LGXA 1FKTA 2XP9A 3WIJA 4ZPVR 3AROA 2YSHA 3LKXB 3PQHA 2JXWA 2PBCA 4DWSA 1GOIA 5E5WA 3ARSA 2MNTA 2LGOA 3ODKA 3GU0A 4WIWA 1GUVA 1NWTA 2YSGA 2MF9A 3G6LA 4IQCA 3ARRA 4TW7A 3ARVA 1J4HA 3EIPA 3KAIA 1M5YA 4ODKA 2RSEA 2DT1A 3CGNA 2MLYA 2G8ZA 5HTGA 2ETNA 5DIVA 4DT4A 3ARQA 1P5QA 4LAVA 2QF8A 4JFKA 3M7NA 1LG1A 2L2SA 4DROA 3TCZA 3ARUA 1D2KA 4DWSC 1O6IA 5HW8A 3KAHA 3TC5A 4MSPA 3MDYB 5HW7A 1B6CA 4G2PA 4WKAA 3PRBA 4NNRA 1FKLA 1E44A 4DRJA 3WH0A 2DT2A 2UZ5A 4A0TA 2KGJA 4U84A 2YBTA 4ODPA 4LAXA 2PPOA 2ZQTA 1HJWA 4LAWA 4QT3A 1FKGA 2VCDA 5DITA 4MAVA 4DZ3A 3CZ8A 4Z2HA 1ZBCA 2KE0A 3RGCA 3KCEA 2DT3A 1HXVA 2F2DA 2XPAA 1YATA 1H0GA 2M8JA 4PTMA 4DRKA 2Q5AA 5DF0A 3WQWA 3PR9A 3KACA 1UR9A 4ZPTR 1HKMA 5E62A 1HKIA 5HT1A 3WD0A 4BF8A 1WR7A 4MNMA 5U47A 1QZ2A 1FLCA 2MLXA 3WD1A 4E5RA 2DMVA 4DRHA 3B9AA 4Z2KA 2PV3A 3NI6A 4AY1A 1ITXA 4MNKA 1NMVA 1JNSA 1NMWA 4ODOA 5E66A 3B7XA 1L1PA 1E15A 1LJYA 4Z2GA 1WAWA 1W1TA 2DK1A 3CHCA 1JNTA 3CHDA 3LE4A 1Q6HA 1HKJA 5HBFA 1JNDA 4LAYA 1E6NA 1F40A 2ZQUA 1R9HA 2Y78A 1FKKA 5JH8A 1JCHB 4J4NA 2RQSA 3O5FA 2WAEA 4ODRA 1H0IA 2OLHA 4DRNA 3KAGA 4HBOA 2D9FA 2B5UB 3CHEA 4JYSA 3WD3A 2PI6A 1KT0A 1ZL1A 4DRQA 1ZBKA 1T11A 4REXA 3O5PA 4HARA 2LPVA 1KT1A 3L4HA 2PV2A 2F4EA 2RUCA 1FKRA 2F23A 2RUDA 3WD2A 2EULA 1LQ0A 2DT0A 3KZ7A 3O5OA 3AS2A 3ARTA 4S3JA 5HWBA 1EDQA 3O5MA 4QT2A 1QPLA 2KO7A 3BXWA 1ZCNA 1J4IA 3MQGA 1W26A 1XHGA 3O5IA 1FJDA 1W9VA 1E6RA 1HKKA 2A3AA 4TW8A 2B31A 4WKFA 4MNLA 3AS1A 2A3BA 1EQ3A 2JX8A 2IUZA 3RMEA 3VAWA 1F8AB 3UF8A 2ZR5A 1VF8A 2MLZA 1HJXA 3O5GA 4J4OA 4UDMA 3MCBB 1SYTA 4FAPA
chains in the Genus database with same CATH topology
2DG3A 1X6NA 2XP6A 3UQAA 4L72B 4C02B 2ZAJA 1PINA 1OWQA 3ARYA 5E65A 4WK9A 1WB0A 1D7JA 3AS3A 1W1VA 3MQHA 1I5HW 1LG2A 3FS8A 3O5LA 2DG9A 4WKHA 1FFQA 2PPNA 3TDBA 3UQBA 3OOBA 3UI4A 1J6YA 2AOSA 4URIA 3M85A 2E45A 2F21A 2JZVA 1Q1CA 3JXVA 3WL1A 1TFVA 4MPKA 2M2AA 1EYMA 4S3KA 4A0UA 3IKDA 3QOKA 1LL6A 4IT6A 2K8IA 5HKGA 4O2TA 1TK7A 1J4RA 1NH6A 5CQ2A 4P8WA 3RM4A 4XAKA 4HBEA 4JFJA 1Q6IA 4R5EA 2DSVA 2KR7A 5J6EA 3RM8A 4NZCA 5E64A 1C9HA 1ZBVA 2DK7A 2FKEA 1GPFA 1K9TA 1LL4A 3PA7A 4R0XA 3AS0A 4Z2IA 3O5JA 3IKGA 1YW5A 4Q7NA 1U79A 2AWGA 2WM0A 2MDIA 2WLYA 1ZB5A 4TYOA 2M8IA 2KFWA 3ARWA 3WQVA 3FAPA 1Y0OA 1E6ZA 1QPFA 1OGBA 1EIBA 1X6LA 2MPHA 3MCBA 2XP8A 3JYJA 3O5RA 4IQ2A 1RP5A 4W9PA 4DZ2A 5HWCA 1ZK6A 1XRVA 4DRPA 3NTPA 2WADA 2ZQSA 3WD4A 2VN1A 3I6CA 1EG3A 4TX0A 1D7HA 1SR0A 4NSBA 5GQBA 1WMVA 2XP7A 3IHZA 2DG4A 2FAPA 2WK2A 3G6MA 3O5QA 3KADA 4L3NA 4JFLA 3WL0A 1D7IA 1FFRA 2ZR4A 2N87A 1KFWA 4WJXA 4G50A 2OFNA 2YSFA 4JFMA 3B9EA 3O5DA 2XP4A 3EY6A 3FY1A 4IPXA 2FDMA 2M1IA 4DRIA 1FKBA 3AQUA 4Z2LA 1NWRA 3O5EA 1E9LA 1FKIA 3PRDA 3ALGA 1ROTA 3W4RA 2XPBA 1FKHA 2OWOA 4ODQA 4ODNA 4ZPWR 5GPRA 4Q22A 2DSZA 1W9UA 4DWSD 1JMQA 1EHNA 2YBUA 4W5UA 2XP3A 3UQIA 1ROUA 1TCOC 2RURA 3B9DA 4P8XA 4KQZA 2M08A 4QIBA 2O92A 2LKNA 1FKJA 5I98A 4TW6A 2ITKA 4ZS6A 3UI5A 4KR0B 4ODLA 5HUAA 3RFWA 4DWSB 1D6OA 3ARZA 3FXYA 4GIVA 1JVWA 3CGMA 3JYMA 4ODMA 3GPKA 5DIUA 4DRMA 2KI3A 2YSIA 2Y8NB 1NWSA 1FAPA 3NRKA 3CHFA 3KAFA 4ITZA 2QRVA 5GPGA 4W9OA 3O5KA 5AHTA 2EZ5W 1RD6A 4ML4A 3LKXA 1W1PA 2ESCA 4MNJA 1PBKA 4GGQA 1OGGA 2BA1A 1O6WA 2DWVA 3RM9A 5BXJA 4U86A 4DH0A 2DPEA 3ARPA 1FKDA 3B8SA 5DO2A 3WKZA 2DJYA 1TR8A 3UI6A 1FD9A 2ZR6A 2RUQA 2PPPA 2RE3A 2IF4A 1ZU8A 1HJVA 4GLXA 2ZQVA 3OA5A 2JMFA 2JV4A 2YAJB 1IX5A 5B8IC 3CH9A 4P8UA 1K9QA 1LL7A 2G41A 1FKFA 2L4JA 1W1YA 1BKFA 1NSGA 3LUOA 4MGVA 4Z2JA 3ARXA 3FSCA 4U85A 2PV1A 2A3EA 2LAJA 2WLZA 4JFIA 1N1AA 2DSUA 4QZVB 4DIPA 1WNOA 3FSBA 1BL4A 1Q6UA 2DSWA 1K9RA 2A3CA 2KXQA 1E6PA 1ZBWA 1FKSA 1JNEA 3KABA 2M3OW 2YSBA 1CTNA 4IT4A 3ALFA 5D75A 3IK8A 1NWUA 4MTVA 1W9PA 2XP5A 1EG4A 1UR8A 1A7XA 4N19A 3PRAA 5DEZA 4TNSA 2LJ4A 5HW6A 4FN2A 4P8VA 3H9RB 2O9OA 4W9QA 3CNGA 4LGXA 1FKTA 2XP9A 3WIJA 4ZPVR 3AROA 2YSHA 3LKXB 3PQHA 2JXWA 2PBCA 4DWSA 1GOIA 5E5WA 3ARSA 2MNTA 2LGOA 3ODKA 4WIWA 1GUVA 1NWTA 2YSGA 2MF9A 3G6LA 4IQCA 3ARRA 4TW7A 3ARVA 1J4HA 3KAIA 1M5YA 4ODKA 2RSEA 2DT1A 3CGNA 2MLYA 2G8ZA 5HTGA 5DIVA 4DT4A 3ARQA 1P5QA 4LAVA 2QF8A 4JFKA 3M7NA 1LG1A 2L2SA 4DROA 3TCZA 3ARUA 1D2KA 4DWSC 1O6IA 5HW8A 3KAHA 3TC5A 4MSPA 3MDYB 5HW7A 1B6CA 4G2PA 4WKAA 3PRBA 4NNRA 1FKLA 4DRJA 3WH0A 2DT2A 2UZ5A 4A0TA 2KGJA 4U84A 2YBTA 4ODPA 4LAXA 2PPOA 2ZQTA 1HJWA 4LAWA 4QT3A 1FKGA 2VCDA 5DITA 4MAVA 4DZ3A 3CZ8A 4Z2HA 1ZBCA 2KE0A 3RGCA 3KCEA 2DT3A 1HXVA 2F2DA 2XPAA 1YATA 1H0GA 2M8JA 4PTMA 4DRKA 2Q5AA 5DF0A 3WQWA 3PR9A 3KACA 1UR9A 4ZPTR 1HKMA 5E62A 1HKIA 5HT1A 3WD0A 4BF8A 1WR7A 4MNMA 5U47A 1QZ2A 1FLCA 2MLXA 3WD1A 4E5RA 2DMVA 4DRHA 3B9AA 4Z2KA 2PV3A 3NI6A 4AY1A 1ITXA 4MNKA 1NMVA 1JNSA 1NMWA 4ODOA 5E66A 3B7XA 1L1PA 1E15A 1LJYA 4Z2GA 1WAWA 1W1TA 2DK1A 3CHCA 1JNTA 3CHDA 3LE4A 1Q6HA 1HKJA 5HBFA 1JNDA 4LAYA 1E6NA 1F40A 2ZQUA 1R9HA 2Y78A 1FKKA 5JH8A 4J4NA 2RQSA 3O5FA 2WAEA 4ODRA 1H0IA 2OLHA 4DRNA 3KAGA 4HBOA 2D9FA 3CHEA 4JYSA 3WD3A 2PI6A 1KT0A 1ZL1A 4DRQA 1ZBKA 1T11A 4REXA 3O5PA 4HARA 2LPVA 1KT1A 3L4HA 2PV2A 2F4EA 2RUCA 1FKRA 2RUDA 3WD2A 1LQ0A 2DT0A 3KZ7A 3O5OA 3AS2A 3ARTA 4S3JA 5HWBA 1EDQA 3O5MA 4QT2A 1QPLA 2KO7A 3BXWA 1ZCNA 1J4IA 3MQGA 1W26A 1XHGA 3O5IA 1FJDA 1W9VA 1E6RA 1HKKA 2A3AA 4TW8A 2B31A 4WKFA 4MNLA 3AS1A 2A3BA 1EQ3A 2JX8A 2IUZA 3RMEA 3VAWA 1F8AB 3UF8A 2ZR5A 1VF8A 2MLZA 1HJXA 3O5GA 4J4OA 3MCBB 1SYTA 4FAPA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2KE0 A;  2OFN A;  3RGC A;  3KCE A;  2DG3 A;  1HXV A;  2YSF A;  4JFM A;  2F2D A;  2XPA A;  2XP6 A;  3O5D A;  1BL4 A;  2XP4 A;  1Q6U A;  1K9R A;  1YAT A;  3EY6 A;  4C02 B;  3UQA A;  2KXQ A;  1PIN A;  2ZAJ A;  2M1I A;  1FKB A;  4IPX A;  4DRI A;  3O5E A;  1D7J A;  2M8J A;  1FKS A;  1FKI A;  3PRD A;  4DRK A;  3KAB A;  2M3O W;  2YSB A;  2XPB A;  1FKH A;  1ROT A;  5D75 A;  2Q5A A;  1I5H W;  3IK8 A;  4ODQ A;  3O5L A;  4ODN A;  3KAC A;  2DG9 A;  2PPN A;  3TDB A;  3UQB A;  3OOB A;  3UI4 A;  2XP5 A;  1JMQ A;  1J6Y A;  1EG4 A;  1A7X A;  5HT1 A;  2XP3 A;  4BF8 A;  1WR7 A;  4N19 A;  3UQI A;  4TNS A;  2LJ4 A;  3M85 A;  1QZ2 A;  1ROU A;  1TCO C;  2RUR A;  2MLX A;  5HW6 A;  2E45 A;  2F21 A;  2JZV A;  2M08 A;  1Q1C A;  4QIB A;  4FN2 A;  3JXV A;  4E5R A;  2DMV A;  2LKN A;  4DRH A;  1FKJ A;  5I98 A;  3H9R B;  4TW6 A;  2M2A A;  4W9Q A;  3CNG A;  2ITK A;  2XP9 A;  1EYM A;  1FKT A;  2PV3 A;  3NI6 A;  3UI5 A;  3IKD A;  4ODL A;  1NMV A;  5HUA A;  1JNS A;  3RFW A;  2K8I A;  5HKG A;  2YSH A;  1NMW A;  1D6O A;  4O2T A;  4ODO A;  1TK7 A;  1JVW A;  2JXW A;  1J4R A;  2PBC A;  4GIV A;  3B7X A;  1L1P A;  3CGM A;  3JYM A;  5CQ2 A;  4ODM A;  3GPK A;  2MNT A;  2DK1 A;  4JFJ A;  1Q6I A;  5DIU A;  1JNT A;  3ODK A;  2LGO A;  3LE4 A;  1Q6H A;  4DRM A;  2KI3 A;  2KR7 A;  4LAY A;  5J6E A;  1F40 A;  2ZQU A;  2YSI A;  1R9H A;  2Y78 A;  1FAP A;  4MGV A;  1FKK A;  4J4N A;  2YSG A;  3NRK A;  1C9H A;  2RQS A;  2MF9 A;  2DK7 A;  3KAF A;  3O5F A;  4IQC A;  4ITZ A;  2FKE A;  4ODR A;  4TW7 A;  4W9O A;  1J4H A;  5GPG A;  3O5K A;  3KAI A;  1M5Y A;  5AHT A;  4ODK A;  2RSE A;  2EZ5 W;  4DRN A;  3KAG A;  3CGN A;  2MLY A;  3PA7 A;  5HTG A;  1PBK A;  2D9F A;  4R0X A;  5DIV A;  4GGQ A;  4JYS A;  2BA1 A;  4DT4 A;  4LAV A;  1O6W A;  2DWV A;  1KT0 A;  1P5Q A;  3O5J A;  3IKG A;  4U86 A;  1YW5 A;  5BXJ A;  4DH0 A;  4JFK A;  3M7N A;  4DRQ A;  1U79 A;  2AWG A;  2L2S A;  1FKD A;  4DRO A;  1T11 A;  4REX A;  3TCZ A;  3O5P A;  2DJY A;  2MDI A;  2LPV A;  4TYO A;  1KT1 A;  2M8I A;  3L4H A;  2KFW A;  3UI6 A;  2PV2 A;  1Y0O A;  2F4E A;  3FAP A;  3KAH A;  5HW8 A;  2RUC A;  1FKR A;  2RUD A;  3TC5 A;  1QPF A;  1FD9 A;  2ZR6 A;  2MPH A;  2RUQ A;  2PPP A;  2RE3 A;  3MDY B;  4MSP A;  5HW7 A;  1B6C A;  3KZ7 A;  4G2P A;  2XP8 A;  3JYJ A;  2IF4 A;  3O5O A;  3PRB A;  4DZ3 A;  3O5R A;  4IQ2 A;  4NNR A;  4W9P A;  3O5M A;  4DZ2 A;  5HWB A;  1ZK6 A;  5HWC A;  1FKL A;  4DRJ A;  3WH0 A;  4QT2 A;  1QPL A;  2ZQV A;  3NTP A;  2KO7 A;  2KGJ A;  2UZ5 A;  4DRP A;  2ZQS A;  1ZCN A;  2JMF A;  4U84 A;  1J4I A;  1W26 A;  2JV4 A;  2VN1 A;  3O5I A;  1FJD A;  3I6C A;  4ODP A;  1EG3 A;  5B8I C;  4TX0 A;  1D7H A;  4LAX A;  4TW8 A;  1K9Q A;  2PPO A;  3LUO A;  1FKF A;  2L4J A;  2ZQT A;  1WMV A;  2XP7 A;  1BKF A;  1NSG A;  3IHZ A;  2JX8 A;  4LAW A;  4QT3 A;  1EQ3 A;  2DG4 A;  4U85 A;  2FAP A;  1FKG A;  1F8A B;  3VAW A;  2PV1 A;  2VCD A;  3UF8 A;  2ZR5 A;  3O5Q A;  5DIT A;  3KAD A;  2MLZ A;  2LAJ A;  3O5G A;  4J4O A;  4JFL A;  1D7I A;  4JFI A;  1N1A A;  2ZR4 A;  2N87 A;  4DIP A;  4FAP A;  4G50 A; 
#chains in the Genus database with same CATH topology
 2DG3 A;  1X6N A;  2XP6 A;  3UQA A;  4L72 B;  4C02 B;  2ZAJ A;  1PIN A;  1OWQ A;  3ARY A;  5E65 A;  4WK9 A;  1WB0 A;  1D7J A;  3AS3 A;  1W1V A;  3MQH A;  1I5H W;  1LG2 A;  3FS8 A;  3O5L A;  2DG9 A;  4WKH A;  1FFQ A;  2PPN A;  3TDB A;  3UQB A;  3OOB A;  3UI4 A;  1J6Y A;  2AOS A;  4URI A;  3M85 A;  2E45 A;  2F21 A;  2JZV A;  1Q1C A;  3JXV A;  3WL1 A;  1TFV A;  4MPK A;  2M2A A;  1EYM A;  4S3K A;  4A0U A;  3IKD A;  3QOK A;  1LL6 A;  4IT6 A;  2K8I A;  5HKG A;  4O2T A;  1TK7 A;  1J4R A;  1NH6 A;  5CQ2 A;  4P8W A;  3RM4 A;  4XAK A;  4HBE A;  4JFJ A;  1Q6I A;  2PN0 A;  4R5E A;  2DSV A;  2KR7 A;  5J6E A;  3RM8 A;  4NZC A;  5E64 A;  1C9H A;  1ZBV A;  2DK7 A;  2FKE A;  1GPF A;  1K9T A;  1LL4 A;  3PA7 A;  4R0X A;  3AS0 A;  4Z2I A;  2P4V A;  3O5J A;  3IKG A;  1YW5 A;  4Q7N A;  1U79 A;  2AWG A;  2WM0 A;  2MDI A;  2WLY A;  1ZB5 A;  4TYO A;  2M8I A;  2KFW A;  3ARW A;  3WQV A;  3FAP A;  1Y0O A;  1E6Z A;  1QPF A;  1OGB A;  1EIB A;  1X6L A;  2MPH A;  3MCB A;  2XP8 A;  3JYJ A;  3O5R A;  4IQ2 A;  1RP5 A;  4W9P A;  4DZ2 A;  5HWC A;  1ZK6 A;  1XRV A;  4DRP A;  3NTP A;  2WAD A;  2ZQS A;  3BMB A;  3WD4 A;  2VN1 A;  3I6C A;  1EG3 A;  4TX0 A;  1D7H A;  1SR0 A;  4NSB A;  5GQB A;  1WMV A;  2XP7 A;  3IHZ A;  2DG4 A;  2FAP A;  2WK2 A;  3G6M A;  3O5Q A;  3KAD A;  4L3N A;  4JFL A;  3WL0 A;  1D7I A;  1FFR A;  2ZR4 A;  2N87 A;  1KFW A;  4WJX A;  4G50 A;  2OFN A;  2YSF A;  4JFM A;  3B9E A;  3O5D A;  2XP4 A;  3EY6 A;  3FY1 A;  4IPX A;  2FDM A;  2M1I A;  4DRI A;  1FKB A;  3AQU A;  4Z2L A;  1NWR A;  3O5E A;  1E9L A;  1FKI A;  3PRD A;  3ALG A;  1ROT A;  3W4R A;  2XPB A;  1FKH A;  2OWO A;  4ODQ A;  4ODN A;  4ZPW R;  5GPR A;  4Q22 A;  2DSZ A;  1W9U A;  4DWS D;  1JMQ A;  1EHN A;  2YBU A;  4W5U A;  2XP3 A;  3UQI A;  1ROU A;  1TCO C;  2RUR A;  3B9D A;  4P8X A;  4KQZ A;  2M08 A;  4QIB A;  2O92 A;  2LKN A;  1FKJ A;  5I98 A;  4TW6 A;  2ITK A;  4ZS6 A;  3UI5 A;  4KR0 B;  4ODL A;  5HUA A;  3RFW A;  4DWS B;  1D6O A;  3ARZ A;  3FXY A;  4GIV A;  1JVW A;  3CGM A;  3JYM A;  4ODM A;  3GPK A;  5DIU A;  4DRM A;  2KI3 A;  3GTY X;  2YSI A;  2Y8N B;  1NWS A;  1FAP A;  3NRK A;  3CHF A;  3KAF A;  4ITZ A;  2QRV A;  5GPG A;  4W9O A;  3O5K A;  5AHT A;  2EZ5 W;  1RD6 A;  4ML4 A;  3LKX A;  1W1P A;  2ESC A;  4MNJ A;  1PBK A;  4GGQ A;  1OGG A;  2BA1 A;  1O6W A;  2DWV A;  3RM9 A;  5BXJ A;  4U86 A;  4DH0 A;  2DPE A;  3ARP A;  1FKD A;  3B8S A;  5DO2 A;  3WKZ A;  2DJY A;  1TR8 A;  3UI6 A;  1FD9 A;  2ZR6 A;  2RUQ A;  2PPP A;  2RE3 A;  2IF4 A;  1ZU8 A;  1HJV A;  4GLX A;  2ZQV A;  3OA5 A;  2JMF A;  2JV4 A;  2YAJ B;  1IX5 A;  5B8I C;  3CH9 A;  4P8U A;  1K9Q A;  1LL7 A;  2G41 A;  1FKF A;  2L4J A;  1W1Y A;  1BKF A;  1NSG A;  3LUO A;  4MGV A;  4Z2J A;  3ARX A;  3FSC A;  4U85 A;  2PV1 A;  2A3E A;  2LAJ A;  2WLZ A;  4JFI A;  1N1A A;  2DSU A;  4QZV B;  4DIP A;  1WNO A;  3FSB A;  1BL4 A;  1Q6U A;  2DSW A;  1K9R A;  2A3C A;  2KXQ A;  1E6P A;  1ZBW A;  1GRJ A;  1FKS A;  1JNE A;  3KAB A;  2M3O W;  2YSB A;  1CTN A;  4IT4 A;  3ALF A;  5D75 A;  3IK8 A;  1NWU A;  4MTV A;  1W9P A;  2XP5 A;  1EG4 A;  1UR8 A;  1A7X A;  4N19 A;  3PRA A;  5DEZ A;  4TNS A;  2LJ4 A;  5HW6 A;  4FN2 A;  4P8V A;  3H9R B;  2O9O A;  4W9Q A;  3CNG A;  4LGX A;  1FKT A;  2XP9 A;  3WIJ A;  4ZPV R;  3ARO A;  2YSH A;  3LKX B;  3PQH A;  2JXW A;  2PBC A;  4DWS A;  1GOI A;  5E5W A;  3ARS A;  2MNT A;  2LGO A;  3ODK A;  3GU0 A;  4WIW A;  1GUV A;  1NWT A;  2YSG A;  2MF9 A;  3G6L A;  4IQC A;  3ARR A;  4TW7 A;  3ARV A;  1J4H A;  3EIP A;  3KAI A;  1M5Y A;  4ODK A;  2RSE A;  2DT1 A;  3CGN A;  2MLY A;  2G8Z A;  5HTG A;  2ETN A;  5DIV A;  4DT4 A;  3ARQ A;  1P5Q A;  4LAV A;  2QF8 A;  4JFK A;  3M7N A;  1LG1 A;  2L2S A;  4DRO A;  3TCZ A;  3ARU A;  1D2K A;  4DWS C;  1O6I A;  5HW8 A;  3KAH A;  3TC5 A;  4MSP A;  3MDY B;  5HW7 A;  1B6C A;  4G2P A;  4WKA A;  3PRB A;  4NNR A;  1FKL A;  1E44 A;  4DRJ A;  3WH0 A;  2DT2 A;  2UZ5 A;  4A0T A;  2KGJ A;  4U84 A;  2YBT A;  4ODP A;  4LAX A;  2PPO A;  2ZQT A;  1HJW A;  4LAW A;  4QT3 A;  1FKG A;  2VCD A;  5DIT A;  4MAV A;  4DZ3 A;  3CZ8 A;  4Z2H A;  1ZBC A;  2KE0 A;  3RGC A;  3KCE A;  2DT3 A;  1HXV A;  2F2D A;  2XPA A;  1YAT A;  1H0G A;  2M8J A;  4PTM A;  4DRK A;  2Q5A A;  5DF0 A;  3WQW A;  3PR9 A;  3KAC A;  1UR9 A;  4ZPT R;  1HKM A;  5E62 A;  1HKI A;  5HT1 A;  3WD0 A;  4BF8 A;  1WR7 A;  4MNM A;  5U47 A;  1QZ2 A;  1FLC A;  2MLX A;  3WD1 A;  4E5R A;  2DMV A;  4DRH A;  3B9A A;  4Z2K A;  2PV3 A;  3NI6 A;  4AY1 A;  1ITX A;  4MNK A;  1NMV A;  1JNS A;  1NMW A;  4ODO A;  5E66 A;  3B7X A;  1L1P A;  1E15 A;  1LJY A;  4Z2G A;  1WAW A;  1W1T A;  2DK1 A;  3CHC A;  1JNT A;  3CHD A;  3LE4 A;  1Q6H A;  1HKJ A;  5HBF A;  1JND A;  4LAY A;  1E6N A;  1F40 A;  2ZQU A;  1R9H A;  2Y78 A;  1FKK A;  5JH8 A;  1JCH B;  4J4N A;  2RQS A;  3O5F A;  2WAE A;  4ODR A;  1H0I A;  2OLH A;  4DRN A;  3KAG A;  4HBO A;  2D9F A;  2B5U B;  3CHE A;  4JYS A;  3WD3 A;  2PI6 A;  1KT0 A;  1ZL1 A;  4DRQ A;  1ZBK A;  1T11 A;  4REX A;  3O5P A;  4HAR A;  2LPV A;  1KT1 A;  3L4H A;  2PV2 A;  2F4E A;  2RUC A;  1FKR A;  2F23 A;  2RUD A;  3WD2 A;  2EUL A;  1LQ0 A;  2DT0 A;  3KZ7 A;  3O5O A;  3AS2 A;  3ART A;  4S3J A;  5HWB A;  1EDQ A;  3O5M A;  4QT2 A;  1QPL A;  2KO7 A;  3BXW A;  1ZCN A;  1J4I A;  3MQG A;  1W26 A;  1XHG A;  3O5I A;  1FJD A;  1W9V A;  1E6R A;  1HKK A;  2A3A A;  4TW8 A;  2B31 A;  4WKF A;  4MNL A;  3AS1 A;  2A3B A;  1EQ3 A;  2JX8 A;  2IUZ A;  3RME A;  3VAW A;  1F8A B;  3UF8 A;  2ZR5 A;  1VF8 A;  2MLZ A;  1HJX A;  3O5G A;  4J4O A;  4UDM A;  3MCB B;  1SYT A;  4FAP A; 
#chains in the Genus database with same CATH homology
 2DG3 A;  1X6N A;  2XP6 A;  3UQA A;  4L72 B;  4C02 B;  2ZAJ A;  1PIN A;  1OWQ A;  3ARY A;  5E65 A;  4WK9 A;  1WB0 A;  1D7J A;  3AS3 A;  1W1V A;  3MQH A;  1I5H W;  1LG2 A;  3FS8 A;  3O5L A;  2DG9 A;  4WKH A;  1FFQ A;  2PPN A;  3TDB A;  3UQB A;  3OOB A;  3UI4 A;  1J6Y A;  2AOS A;  4URI A;  3M85 A;  2E45 A;  2F21 A;  2JZV A;  1Q1C A;  3JXV A;  3WL1 A;  1TFV A;  4MPK A;  2M2A A;  1EYM A;  4S3K A;  4A0U A;  3IKD A;  3QOK A;  1LL6 A;  4IT6 A;  2K8I A;  5HKG A;  4O2T A;  1TK7 A;  1J4R A;  1NH6 A;  5CQ2 A;  4P8W A;  3RM4 A;  4XAK A;  4HBE A;  4JFJ A;  1Q6I A;  4R5E A;  2DSV A;  2KR7 A;  5J6E A;  3RM8 A;  4NZC A;  5E64 A;  1C9H A;  1ZBV A;  2DK7 A;  2FKE A;  1GPF A;  1K9T A;  1LL4 A;  3PA7 A;  4R0X A;  3AS0 A;  4Z2I A;  3O5J A;  3IKG A;  1YW5 A;  4Q7N A;  1U79 A;  2AWG A;  2WM0 A;  2MDI A;  2WLY A;  1ZB5 A;  4TYO A;  2M8I A;  2KFW A;  3ARW A;  3WQV A;  3FAP A;  1Y0O A;  1E6Z A;  1QPF A;  1OGB A;  1EIB A;  1X6L A;  2MPH A;  3MCB A;  2XP8 A;  3JYJ A;  3O5R A;  4IQ2 A;  1RP5 A;  4W9P A;  4DZ2 A;  5HWC A;  1ZK6 A;  1XRV A;  4DRP A;  3NTP A;  2WAD A;  2ZQS A;  3WD4 A;  2VN1 A;  3I6C A;  1EG3 A;  4TX0 A;  1D7H A;  1SR0 A;  4NSB A;  5GQB A;  1WMV A;  2XP7 A;  3IHZ A;  2DG4 A;  2FAP A;  2WK2 A;  3G6M A;  3O5Q A;  3KAD A;  4L3N A;  4JFL A;  3WL0 A;  1D7I A;  1FFR A;  2ZR4 A;  2N87 A;  1KFW A;  4WJX A;  4G50 A;  2OFN A;  2YSF A;  4JFM A;  3B9E A;  3O5D A;  2XP4 A;  3EY6 A;  3FY1 A;  4IPX A;  2FDM A;  2M1I A;  4DRI A;  1FKB A;  3AQU A;  4Z2L A;  1NWR A;  3O5E A;  1E9L A;  1FKI A;  3PRD A;  3ALG A;  1ROT A;  3W4R A;  2XPB A;  1FKH A;  2OWO A;  4ODQ A;  4ODN A;  4ZPW R;  5GPR A;  4Q22 A;  2DSZ A;  1W9U A;  4DWS D;  1JMQ A;  1EHN A;  2YBU A;  4W5U A;  2XP3 A;  3UQI A;  1ROU A;  1TCO C;  2RUR A;  3B9D A;  4P8X A;  4KQZ A;  2M08 A;  4QIB A;  2O92 A;  2LKN A;  1FKJ A;  5I98 A;  4TW6 A;  2ITK A;  4ZS6 A;  3UI5 A;  4KR0 B;  4ODL A;  5HUA A;  3RFW A;  4DWS B;  1D6O A;  3ARZ A;  3FXY A;  4GIV A;  1JVW A;  3CGM A;  3JYM A;  4ODM A;  3GPK A;  5DIU A;  4DRM A;  2KI3 A;  2YSI A;  2Y8N B;  1NWS A;  1FAP A;  3NRK A;  3CHF A;  3KAF A;  4ITZ A;  2QRV A;  5GPG A;  4W9O A;  3O5K A;  5AHT A;  2EZ5 W;  1RD6 A;  4ML4 A;  3LKX A;  1W1P A;  2ESC A;  4MNJ A;  1PBK A;  4GGQ A;  1OGG A;  2BA1 A;  1O6W A;  2DWV A;  3RM9 A;  5BXJ A;  4U86 A;  4DH0 A;  2DPE A;  3ARP A;  1FKD A;  3B8S A;  5DO2 A;  3WKZ A;  2DJY A;  1TR8 A;  3UI6 A;  1FD9 A;  2ZR6 A;  2RUQ A;  2PPP A;  2RE3 A;  2IF4 A;  1ZU8 A;  1HJV A;  4GLX A;  2ZQV A;  3OA5 A;  2JMF A;  2JV4 A;  2YAJ B;  1IX5 A;  5B8I C;  3CH9 A;  4P8U A;  1K9Q A;  1LL7 A;  2G41 A;  1FKF A;  2L4J A;  1W1Y A;  1BKF A;  1NSG A;  3LUO A;  4MGV A;  4Z2J A;  3ARX A;  3FSC A;  4U85 A;  2PV1 A;  2A3E A;  2LAJ A;  2WLZ A;  4JFI A;  1N1A A;  2DSU A;  4QZV B;  4DIP A;  1WNO A;  3FSB A;  1BL4 A;  1Q6U A;  2DSW A;  1K9R A;  2A3C A;  2KXQ A;  1E6P A;  1ZBW A;  1FKS A;  1JNE A;  3KAB A;  2M3O W;  2YSB A;  1CTN A;  4IT4 A;  3ALF A;  5D75 A;  3IK8 A;  1NWU A;  4MTV A;  1W9P A;  2XP5 A;  1EG4 A;  1UR8 A;  1A7X A;  4N19 A;  3PRA A;  5DEZ A;  4TNS A;  2LJ4 A;  5HW6 A;  4FN2 A;  4P8V A;  3H9R B;  2O9O A;  4W9Q A;  3CNG A;  4LGX A;  1FKT A;  2XP9 A;  3WIJ A;  4ZPV R;  3ARO A;  2YSH A;  3LKX B;  3PQH A;  2JXW A;  2PBC A;  4DWS A;  1GOI A;  5E5W A;  3ARS A;  2MNT A;  2LGO A;  3ODK A;  4WIW A;  1GUV A;  1NWT A;  2YSG A;  2MF9 A;  3G6L A;  4IQC A;  3ARR A;  4TW7 A;  3ARV A;  1J4H A;  3KAI A;  1M5Y A;  4ODK A;  2RSE A;  2DT1 A;  3CGN A;  2MLY A;  2G8Z A;  5HTG A;  5DIV A;  4DT4 A;  3ARQ A;  1P5Q A;  4LAV A;  2QF8 A;  4JFK A;  3M7N A;  1LG1 A;  2L2S A;  4DRO A;  3TCZ A;  3ARU A;  1D2K A;  4DWS C;  1O6I A;  5HW8 A;  3KAH A;  3TC5 A;  4MSP A;  3MDY B;  5HW7 A;  1B6C A;  4G2P A;  4WKA A;  3PRB A;  4NNR A;  1FKL A;  4DRJ A;  3WH0 A;  2DT2 A;  2UZ5 A;  4A0T A;  2KGJ A;  4U84 A;  2YBT A;  4ODP A;  4LAX A;  2PPO A;  2ZQT A;  1HJW A;  4LAW A;  4QT3 A;  1FKG A;  2VCD A;  5DIT A;  4MAV A;  4DZ3 A;  3CZ8 A;  4Z2H A;  1ZBC A;  2KE0 A;  3RGC A;  3KCE A;  2DT3 A;  1HXV A;  2F2D A;  2XPA A;  1YAT A;  1H0G A;  2M8J A;  4PTM A;  4DRK A;  2Q5A A;  5DF0 A;  3WQW A;  3PR9 A;  3KAC A;  1UR9 A;  4ZPT R;  1HKM A;  5E62 A;  1HKI A;  5HT1 A;  3WD0 A;  4BF8 A;  1WR7 A;  4MNM A;  5U47 A;  1QZ2 A;  1FLC A;  2MLX A;  3WD1 A;  4E5R A;  2DMV A;  4DRH A;  3B9A A;  4Z2K A;  2PV3 A;  3NI6 A;  4AY1 A;  1ITX A;  4MNK A;  1NMV A;  1JNS A;  1NMW A;  4ODO A;  5E66 A;  3B7X A;  1L1P A;  1E15 A;  1LJY A;  4Z2G A;  1WAW A;  1W1T A;  2DK1 A;  3CHC A;  1JNT A;  3CHD A;  3LE4 A;  1Q6H A;  1HKJ A;  5HBF A;  1JND A;  4LAY A;  1E6N A;  1F40 A;  2ZQU A;  1R9H A;  2Y78 A;  1FKK A;  5JH8 A;  4J4N A;  2RQS A;  3O5F A;  2WAE A;  4ODR A;  1H0I A;  2OLH A;  4DRN A;  3KAG A;  4HBO A;  2D9F A;  3CHE A;  4JYS A;  3WD3 A;  2PI6 A;  1KT0 A;  1ZL1 A;  4DRQ A;  1ZBK A;  1T11 A;  4REX A;  3O5P A;  4HAR A;  2LPV A;  1KT1 A;  3L4H A;  2PV2 A;  2F4E A;  2RUC A;  1FKR A;  2RUD A;  3WD2 A;  1LQ0 A;  2DT0 A;  3KZ7 A;  3O5O A;  3AS2 A;  3ART A;  4S3J A;  5HWB A;  1EDQ A;  3O5M A;  4QT2 A;  1QPL A;  2KO7 A;  3BXW A;  1ZCN A;  1J4I A;  3MQG A;  1W26 A;  1XHG A;  3O5I A;  1FJD A;  1W9V A;  1E6R A;  1HKK A;  2A3A A;  4TW8 A;  2B31 A;  4WKF A;  4MNL A;  3AS1 A;  2A3B A;  1EQ3 A;  2JX8 A;  2IUZ A;  3RME A;  3VAW A;  1F8A B;  3UF8 A;  2ZR5 A;  1VF8 A;  2MLZ A;  1HJX A;  3O5G A;  4J4O A;  3MCB B;  1SYT A;  4FAP A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...