2YSGA

Solution structure of the ww domain from the human syntaxin-binding protein 4
Total Genus 2
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
2
sequence length
40
structure length
40
Chain Sequence
GSSGSSGLPYGWEEAYTADGIKYFINHVTQTTSWIHPVMS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Protein binding
molecule keywords Syntaxin-binding protein 4
publication title Solution structure of the WW domain from the human syntaxin-binding protein 4
rcsb
source organism Homo sapiens
total genus 2
structure length 40
sequence length 40
ec nomenclature
pdb deposition date 2007-04-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00397 WW WW domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.20.70.10 Mainly Beta Single Sheet Ubiquitin Ligase Nedd4; Chain: W; Ubiquitin Ligase Nedd4; Chain: W; 2ysgA01
1PINA 2YSFA 2DWVA 1WMVA 1ZCNA 2DMVA 2JXWA 2XP5A 2BA1A 2ZR5A 2M8JA 2F21A 2YSGA 1JMQA 2ZQUA 2JMFA 2XP3A 1F8AB 3M85A 5AHTA 2DK7A 1YW5A 3KAIA 2XP9A 3KCEA 2XPAA 3ODKA 2XPBA 3TCZA 2XP8A 2XP4A 2ZQVA 2EZ5W 1I5HW 4U85A 2E45A 1WR7A 3WH0A 1TK7A 3KAFA 5CQ2A 2Q5AA 2XP7A 2M8IA 1EG4A 3TC5A 2ZQSA 2RE3A 2YSHA 3KAGA 3TDBA 2ZQTA 2YSIA 2XP6A 2DJYA 2DK1A 2LAJA 3NTPA 1K9RA 2MDIA 2L4JA 2ZR6A 1NMVA 2ZR4A 4E5RA 3CNGA 1O6WA 3M7NA 2KXQA 3LE4A 4U86A 2JV4A 2ZAJA 3KADA 1EG3A 4REXA 4U84A 3KABA 2ITKA 3L4HA 1K9QA 3OOBA 4QIBA 2YSBA 2M3OW 2JX8A 3KAHA
chains in the Genus database with same CATH superfamily
1PINA 2YSFA 2DWVA 2WADA 1WMVA 1ZCNA 2DMVA 2JXWA 2XP5A 2BA1A 2ZR5A 2YAJB 2M8JA 2F21A 2OWOA 2YSGA 1JMQA 2ZQUA 3MCBA 1RP5A 5E66A 1FLCA 2JMFA 2XP3A 1F8AB 3FS8A 3M85A 5AHTA 5U47A 3PQHA 2DK7A 1YW5A 3KAIA 2QRVA 5E65A 2XP9A 3KCEA 2XPAA 3ODKA 2XPBA 2WAEA 2Y8NB 3TCZA 2XP8A 2XP4A 2ZQVA 2EZ5W 1I5HW 4U85A 2E45A 1WR7A 5E5WA 3WH0A 1TK7A 3KAFA 5CQ2A 2Q5AA 2XP7A 3MCBB 2M8IA 1EG4A 3TC5A 2ZQSA 2RE3A 2YSHA 3KAGA 4A0TA 3MQGA 3TDBA 5E62A 5E64A 4GLXA 2ZQTA 2YSIA 3LKXA 2XP6A 2DJYA 1TR8A 2DK1A 2LAJA 3NTPA 1K9RA 2MDIA 2L4JA 2ZR6A 3LKXB 1NMVA 2ZR4A 3FSBA 4E5RA 3CNGA 1O6WA 3M7NA 2KXQA 3LE4A 4U86A 2JV4A 2ZAJA 3KADA 4A0UA 3FSCA 1EG3A 4REXA 4U84A 3KABA 2ITKA 3L4HA 1K9QA 3OOBA 4QIBA 2YSBA 2M3OW 3MQHA 2JX8A 3KAHA
chains in the Genus database with same CATH topology
1PINA 2YSFA 2DWVA 2WADA 1WMVA 1ZCNA 2DMVA 2JXWA 2XP5A 2BA1A 2ZR5A 2YAJB 2M8JA 2F21A 2OWOA 2YSGA 1JMQA 2ZQUA 3MCBA 1RP5A 5E66A 1FLCA 2JMFA 2XP3A 1F8AB 3FS8A 3M85A 5AHTA 5U47A 3PQHA 2DK7A 1YW5A 3KAIA 2QRVA 5E65A 2XP9A 3KCEA 2XPAA 3ODKA 2XPBA 2WAEA 2Y8NB 3TCZA 2XP8A 2XP4A 2ZQVA 2EZ5W 1I5HW 4U85A 2E45A 1WR7A 5E5WA 3WH0A 1TK7A 3KAFA 5CQ2A 2Q5AA 2XP7A 3MCBB 2M8IA 1EG4A 3TC5A 2ZQSA 2RE3A 2YSHA 3KAGA 4A0TA 3MQGA 3TDBA 5E62A 5E64A 4GLXA 2ZQTA 2YSIA 3LKXA 2XP6A 2DJYA 1TR8A 2DK1A 2LAJA 3NTPA 1K9RA 2MDIA 2L4JA 2ZR6A 3LKXB 1NMVA 2ZR4A 3FSBA 4E5RA 3CNGA 1O6WA 3M7NA 2KXQA 3LE4A 4U86A 2JV4A 2ZAJA 3KADA 4A0UA 3FSCA 1EG3A 4REXA 4U84A 3KABA 2ITKA 3L4HA 1K9QA 3OOBA 4QIBA 2YSBA 2M3OW 3MQHA 2JX8A 3KAHA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1PIN A;  2YSF A;  2DWV A;  1WMV A;  1ZCN A;  2DMV A;  2JXW A;  2XP5 A;  2BA1 A;  2ZR5 A;  2M8J A;  2F21 A;  2YSG A;  1JMQ A;  2ZQU A;  2JMF A;  2XP3 A;  1F8A B;  3M85 A;  5AHT A;  2DK7 A;  1YW5 A;  3KAI A;  2XP9 A;  3KCE A;  2XPA A;  3ODK A;  2XPB A;  3TCZ A;  2XP8 A;  2XP4 A;  2ZQV A;  2EZ5 W;  1I5H W;  4U85 A;  2E45 A;  1WR7 A;  3WH0 A;  1TK7 A;  3KAF A;  5CQ2 A;  2Q5A A;  2XP7 A;  2M8I A;  1EG4 A;  3TC5 A;  2ZQS A;  2RE3 A;  2YSH A;  3KAG A;  3TDB A;  2ZQT A;  2YSI A;  2XP6 A;  2DJY A;  2DK1 A;  2LAJ A;  3NTP A;  1K9R A;  2MDI A;  2L4J A;  2ZR6 A;  1NMV A;  2ZR4 A;  4E5R A;  3CNG A;  1O6W A;  3M7N A;  2KXQ A;  3LE4 A;  4U86 A;  2JV4 A;  2ZAJ A;  3KAD A;  1EG3 A;  4REX A;  4U84 A;  3KAB A;  2ITK A;  3L4H A;  1K9Q A;  3OOB A;  4QIB A;  2YSB A;  2M3O W;  2JX8 A;  3KAH A; 
#chains in the Genus database with same CATH topology
 1PIN A;  2YSF A;  2DWV A;  2WAD A;  1WMV A;  1ZCN A;  2DMV A;  2JXW A;  2XP5 A;  2BA1 A;  2ZR5 A;  2YAJ B;  2M8J A;  2F21 A;  2OWO A;  2YSG A;  1JMQ A;  2ZQU A;  3MCB A;  1RP5 A;  5E66 A;  1FLC A;  2JMF A;  2XP3 A;  1F8A B;  3FS8 A;  3M85 A;  5AHT A;  5U47 A;  3PQH A;  2DK7 A;  1YW5 A;  3KAI A;  2QRV A;  5E65 A;  2XP9 A;  3KCE A;  2XPA A;  3ODK A;  2XPB A;  2WAE A;  2Y8N B;  3TCZ A;  2XP8 A;  2XP4 A;  2ZQV A;  2EZ5 W;  1I5H W;  4U85 A;  2E45 A;  1WR7 A;  5E5W A;  3WH0 A;  1TK7 A;  3KAF A;  5CQ2 A;  2Q5A A;  2XP7 A;  3MCB B;  2M8I A;  1EG4 A;  3TC5 A;  2ZQS A;  2RE3 A;  2YSH A;  3KAG A;  4A0T A;  3MQG A;  3TDB A;  5E62 A;  5E64 A;  4GLX A;  2ZQT A;  2YSI A;  3LKX A;  2XP6 A;  2DJY A;  1TR8 A;  2DK1 A;  2LAJ A;  3NTP A;  1K9R A;  2MDI A;  2L4J A;  2ZR6 A;  3LKX B;  1NMV A;  2ZR4 A;  3FSB A;  4E5R A;  3CNG A;  1O6W A;  3M7N A;  2KXQ A;  3LE4 A;  4U86 A;  2JV4 A;  2ZAJ A;  3KAD A;  4A0U A;  3FSC A;  1EG3 A;  4REX A;  4U84 A;  3KAB A;  2ITK A;  3L4H A;  1K9Q A;  3OOB A;  4QIB A;  2YSB A;  2M3O W;  3MQH A;  2JX8 A;  3KAH A; 
#chains in the Genus database with same CATH homology
 1PIN A;  2YSF A;  2DWV A;  2WAD A;  1WMV A;  1ZCN A;  2DMV A;  2JXW A;  2XP5 A;  2BA1 A;  2ZR5 A;  2YAJ B;  2M8J A;  2F21 A;  2OWO A;  2YSG A;  1JMQ A;  2ZQU A;  3MCB A;  1RP5 A;  5E66 A;  1FLC A;  2JMF A;  2XP3 A;  1F8A B;  3FS8 A;  3M85 A;  5AHT A;  5U47 A;  3PQH A;  2DK7 A;  1YW5 A;  3KAI A;  2QRV A;  5E65 A;  2XP9 A;  3KCE A;  2XPA A;  3ODK A;  2XPB A;  2WAE A;  2Y8N B;  3TCZ A;  2XP8 A;  2XP4 A;  2ZQV A;  2EZ5 W;  1I5H W;  4U85 A;  2E45 A;  1WR7 A;  5E5W A;  3WH0 A;  1TK7 A;  3KAF A;  5CQ2 A;  2Q5A A;  2XP7 A;  3MCB B;  2M8I A;  1EG4 A;  3TC5 A;  2ZQS A;  2RE3 A;  2YSH A;  3KAG A;  4A0T A;  3MQG A;  3TDB A;  5E62 A;  5E64 A;  4GLX A;  2ZQT A;  2YSI A;  3LKX A;  2XP6 A;  2DJY A;  1TR8 A;  2DK1 A;  2LAJ A;  3NTP A;  1K9R A;  2MDI A;  2L4J A;  2ZR6 A;  3LKX B;  1NMV A;  2ZR4 A;  3FSB A;  4E5R A;  3CNG A;  1O6W A;  3M7N A;  2KXQ A;  3LE4 A;  4U86 A;  2JV4 A;  2ZAJ A;  3KAD A;  4A0U A;  3FSC A;  1EG3 A;  4REX A;  4U84 A;  3KAB A;  2ITK A;  3L4H A;  1K9Q A;  3OOB A;  4QIB A;  2YSB A;  2M3O W;  3MQH A;  2JX8 A;  3KAH A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...