2YSGA

Solution structure of the ww domain from the human syntaxin-binding protein 4
Total Genus 2
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
2
sequence length
40
structure length
40
Chain Sequence
GSSGSSGLPYGWEEAYTADGIKYFINHVTQTTSWIHPVMS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Syntaxin-binding protein 4
publication title Solution structure of the WW domain from the human syntaxin-binding protein 4
rcsb
source organism Homo sapiens
molecule tags Protein binding
total genus 2
structure length 40
sequence length 40
ec nomenclature
pdb deposition date 2007-04-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00397 WW WW domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.20.70.10 Mainly Beta Single Sheet Ubiquitin Ligase Nedd4; Chain: W; Ubiquitin Ligase Nedd4; Chain: W; 2ysgA01
2LAJA 2DJYA 2DMVA 3NTPA 1F8AB 2KXQA 2YSBA 2YSGA 2JXWA 2MDIA 4U86A 1YW5A 2XP9A 2XP8A 2JMFA 2M3OW 2XPAA 3OOBA 3KABA 4E5RA 2ITKA 2ZQTA 2ZR4A 3KADA 2XP7A 2BA1A 2YSFA 3KCEA 2ZR6A 2ZQUA 2XP4A 1NMVA 3CNGA 2YSIA 2DK1A 1EG4A 3TC5A 3KAIA 2XP3A 2M8JA 4REXA 2RE3A 3ODKA 4U84A 1WR7A 2XP6A 1PINA 2JX8A 1JMQA 3KAHA 1EG3A 1K9RA 3KAFA 2ZQVA 2ZAJA 5CQ2A 3KAGA 2ZQSA 1WMVA 1I5HW 2F21A 1O6WA 3M85A 2JV4A 3TCZA 2ZR5A 2Q5AA 2M8IA 3TDBA 2DWVA 2E45A 3WH0A 3M7NA 2XPBA 2EZ5W 5AHTA 2DK7A 1K9QA 1TK7A 2YSHA 2XP5A 3LE4A 4U85A 1ZCNA 3L4HA 2L4JA 4QIBA
chains in the Genus database with same CATH superfamily
3MQHA 2WAEA 2LAJA 4GLXA 3LKXA 2DJYA 2DMVA 3NTPA 1F8AB 3MCBB 2KXQA 2YSBA 2YSGA 4A0TA 2JXWA 2Y8NB 2MDIA 4U86A 1YW5A 2QRVA 4A0UA 2XP9A 2YAJB 2XP8A 2JMFA 2M3OW 2XPAA 3OOBA 3KABA 4E5RA 2ITKA 2ZQTA 2ZR4A 3KADA 2XP7A 2BA1A 2YSFA 3KCEA 2ZR6A 2ZQUA 1RP5A 3FSBA 2XP4A 5E62A 3PQHA 1NMVA 3FSCA 3CNGA 5E64A 3LKXB 2YSIA 2DK1A 1EG4A 3TC5A 3KAIA 2XP3A 2M8JA 5U47A 4REXA 2RE3A 3ODKA 4U84A 1WR7A 2XP6A 1PINA 2JX8A 1JMQA 3KAHA 1EG3A 1K9RA 3KAFA 2ZQVA 5E65A 2ZAJA 5CQ2A 3KAGA 2ZQSA 1WMVA 3MCBA 1I5HW 5E66A 2F21A 1O6WA 3M85A 2JV4A 3FS8A 3TCZA 2ZR5A 2OWOA 2Q5AA 2M8IA 3TDBA 1TR8A 2DWVA 2E45A 3WH0A 3M7NA 2XPBA 2EZ5W 5AHTA 2DK7A 1K9QA 1TK7A 2YSHA 1FLCA 2XP5A 3LE4A 3MQGA 2WADA 5E5WA 4U85A 1ZCNA 3L4HA 2L4JA 4QIBA
chains in the Genus database with same CATH topology
3MQHA 2WAEA 2LAJA 4GLXA 3LKXA 2DJYA 2DMVA 3NTPA 1F8AB 3MCBB 2KXQA 2YSBA 2YSGA 4A0TA 2JXWA 2Y8NB 2MDIA 4U86A 1YW5A 2QRVA 4A0UA 2XP9A 2YAJB 2XP8A 2JMFA 2M3OW 2XPAA 3OOBA 3KABA 4E5RA 2ITKA 2ZQTA 2ZR4A 3KADA 2XP7A 2BA1A 2YSFA 3KCEA 2ZR6A 2ZQUA 1RP5A 3FSBA 2XP4A 5E62A 3PQHA 1NMVA 3FSCA 3CNGA 5E64A 3LKXB 2YSIA 2DK1A 1EG4A 3TC5A 3KAIA 2XP3A 2M8JA 5U47A 4REXA 2RE3A 3ODKA 4U84A 1WR7A 2XP6A 1PINA 2JX8A 1JMQA 3KAHA 1EG3A 1K9RA 3KAFA 2ZQVA 5E65A 2ZAJA 5CQ2A 3KAGA 2ZQSA 1WMVA 3MCBA 1I5HW 5E66A 2F21A 1O6WA 3M85A 2JV4A 3FS8A 3TCZA 2ZR5A 2OWOA 2Q5AA 2M8IA 3TDBA 1TR8A 2DWVA 2E45A 3WH0A 3M7NA 2XPBA 2EZ5W 5AHTA 2DK7A 1K9QA 1TK7A 2YSHA 1FLCA 2XP5A 3LE4A 3MQGA 2WADA 5E5WA 4U85A 1ZCNA 3L4HA 2L4JA 4QIBA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2LAJ A;  2DJY A;  2DMV A;  3NTP A;  1F8A B;  2KXQ A;  2YSB A;  2YSG A;  2JXW A;  2MDI A;  4U86 A;  1YW5 A;  2XP9 A;  2XP8 A;  2JMF A;  2M3O W;  2XPA A;  3OOB A;  3KAB A;  4E5R A;  2ITK A;  2ZQT A;  2ZR4 A;  3KAD A;  2XP7 A;  2BA1 A;  2YSF A;  3KCE A;  2ZR6 A;  2ZQU A;  2XP4 A;  1NMV A;  3CNG A;  2YSI A;  2DK1 A;  1EG4 A;  3TC5 A;  3KAI A;  2XP3 A;  2M8J A;  4REX A;  2RE3 A;  3ODK A;  4U84 A;  1WR7 A;  2XP6 A;  1PIN A;  2JX8 A;  1JMQ A;  3KAH A;  1EG3 A;  1K9R A;  3KAF A;  2ZQV A;  2ZAJ A;  5CQ2 A;  3KAG A;  2ZQS A;  1WMV A;  1I5H W;  2F21 A;  1O6W A;  3M85 A;  2JV4 A;  3TCZ A;  2ZR5 A;  2Q5A A;  2M8I A;  3TDB A;  2DWV A;  2E45 A;  3WH0 A;  3M7N A;  2XPB A;  2EZ5 W;  5AHT A;  2DK7 A;  1K9Q A;  1TK7 A;  2YSH A;  2XP5 A;  3LE4 A;  4U85 A;  1ZCN A;  3L4H A;  2L4J A;  4QIB A; 
#chains in the Genus database with same CATH topology
 3MQH A;  2WAE A;  2LAJ A;  4GLX A;  3LKX A;  2DJY A;  2DMV A;  3NTP A;  1F8A B;  3MCB B;  2KXQ A;  2YSB A;  2YSG A;  4A0T A;  2JXW A;  2Y8N B;  2MDI A;  4U86 A;  1YW5 A;  2QRV A;  4A0U A;  2XP9 A;  2YAJ B;  2XP8 A;  2JMF A;  2M3O W;  2XPA A;  3OOB A;  3KAB A;  4E5R A;  2ITK A;  2ZQT A;  2ZR4 A;  3KAD A;  2XP7 A;  2BA1 A;  2YSF A;  3KCE A;  2ZR6 A;  2ZQU A;  1RP5 A;  3FSB A;  2XP4 A;  5E62 A;  3PQH A;  1NMV A;  3FSC A;  3CNG A;  5E64 A;  3LKX B;  2YSI A;  2DK1 A;  1EG4 A;  3TC5 A;  3KAI A;  2XP3 A;  2M8J A;  5U47 A;  4REX A;  2RE3 A;  3ODK A;  4U84 A;  1WR7 A;  2XP6 A;  1PIN A;  2JX8 A;  1JMQ A;  3KAH A;  1EG3 A;  1K9R A;  3KAF A;  2ZQV A;  5E65 A;  2ZAJ A;  5CQ2 A;  3KAG A;  2ZQS A;  1WMV A;  3MCB A;  1I5H W;  5E66 A;  2F21 A;  1O6W A;  3M85 A;  2JV4 A;  3FS8 A;  3TCZ A;  2ZR5 A;  2OWO A;  2Q5A A;  2M8I A;  3TDB A;  1TR8 A;  2DWV A;  2E45 A;  3WH0 A;  3M7N A;  2XPB A;  2EZ5 W;  5AHT A;  2DK7 A;  1K9Q A;  1TK7 A;  2YSH A;  1FLC A;  2XP5 A;  3LE4 A;  3MQG A;  2WAD A;  5E5W A;  4U85 A;  1ZCN A;  3L4H A;  2L4J A;  4QIB A; 
#chains in the Genus database with same CATH homology
 3MQH A;  2WAE A;  2LAJ A;  4GLX A;  3LKX A;  2DJY A;  2DMV A;  3NTP A;  1F8A B;  3MCB B;  2KXQ A;  2YSB A;  2YSG A;  4A0T A;  2JXW A;  2Y8N B;  2MDI A;  4U86 A;  1YW5 A;  2QRV A;  4A0U A;  2XP9 A;  2YAJ B;  2XP8 A;  2JMF A;  2M3O W;  2XPA A;  3OOB A;  3KAB A;  4E5R A;  2ITK A;  2ZQT A;  2ZR4 A;  3KAD A;  2XP7 A;  2BA1 A;  2YSF A;  3KCE A;  2ZR6 A;  2ZQU A;  1RP5 A;  3FSB A;  2XP4 A;  5E62 A;  3PQH A;  1NMV A;  3FSC A;  3CNG A;  5E64 A;  3LKX B;  2YSI A;  2DK1 A;  1EG4 A;  3TC5 A;  3KAI A;  2XP3 A;  2M8J A;  5U47 A;  4REX A;  2RE3 A;  3ODK A;  4U84 A;  1WR7 A;  2XP6 A;  1PIN A;  2JX8 A;  1JMQ A;  3KAH A;  1EG3 A;  1K9R A;  3KAF A;  2ZQV A;  5E65 A;  2ZAJ A;  5CQ2 A;  3KAG A;  2ZQS A;  1WMV A;  3MCB A;  1I5H W;  5E66 A;  2F21 A;  1O6W A;  3M85 A;  2JV4 A;  3FS8 A;  3TCZ A;  2ZR5 A;  2OWO A;  2Q5A A;  2M8I A;  3TDB A;  1TR8 A;  2DWV A;  2E45 A;  3WH0 A;  3M7N A;  2XPB A;  2EZ5 W;  5AHT A;  2DK7 A;  1K9Q A;  1TK7 A;  2YSH A;  1FLC A;  2XP5 A;  3LE4 A;  3MQG A;  2WAD A;  5E5W A;  4U85 A;  1ZCN A;  3L4H A;  2L4J A;  4QIB A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...