3TCZA

Human pin1 bound to cis peptidomimetic inhibitor
Total Genus 45
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
45
sequence length
158
structure length
146
Chain Sequence
KLPPGWEKAMSRSSGRVYYFNHITNASQWERPSEPARVRCSHLLVKHSQSRRPSSWRQEKITRTKEEALELINGYIQKIKSGEEDFESLASQFSDCSSAKARGDLGAFSRGQMQKPFEDASFALRTGEMSGPVFTDSGIHIILRTE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Isomerase/inhibitor
molecule keywords Peptidyl-prolyl cis-trans isomerase NIMA-interacting 1
publication title Structural and Kinetic Analysis of Prolyl-isomerization/Phosphorylation Cross-Talk in the CTD Code.
pubmed doi rcsb
source organism Homo sapiens
total genus 45
structure length 146
sequence length 158
ec nomenclature ec 5.2.1.8: Peptidylprolyl isomerase.
pdb deposition date 2011-08-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00397 WW WW domain
A PF00639 Rotamase PPIC-type PPIASE domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.20.70.10 Mainly Beta Single Sheet Ubiquitin Ligase Nedd4; Chain: W; Ubiquitin Ligase Nedd4; Chain: W; 3tczA01
3.10.50.40 Alpha Beta Roll Chitinase A; domain 3 Chitinase A; domain 3 3tczA02
3O5MA 4DT4A 4ODPA 3O5EA 2XP8A 4DIPA 1Q6IA 1QZ2A 1N1AA 2ZAJA 5HWBA 1U79A 4QT2A 1FKTA 3IHZA 4U85A 1JNSA 4QIBA 3CGNA 2BA1A 2MLZA 1W26A 2PPPA 1FKDA 2F2DA 3MDYB 3UI6A 4W9OA 3UQBA 2L2SA 5AHTA 3O5OA 4R0XA 2PPOA 3JYMA 2ZQSA 2KR7A 2RSEA 2M1IA 4O2TA 1K9QA 2DG9A 3KACA 3O5JA 2LGOA 1D7IA 3FAPA 2M2AA 2LJ4A 1C9HA 5HUAA 1M5YA 2VN1A 5HWCA 3KZ7A 2YSFA 3KADA 4DH0A 3RGCA 3LUOA 2DJYA 2D9FA 2MDIA 3KCEA 3UQAA 1QPFA 2IF4A 3KAIA 4BF8A 4TW8A 4DRJA 4TW7A 1FKJA 1J4HA 4W9QA 2XPBA 4NNRA 1ROUA 2PBCA 2PV3A 2ZQUA 3KABA 4FN2A 1F8AB 4LAYA 1B6CA 3I6CA 2ZR6A 2RE3A 2RUDA 2VCDA 2JX8A 1Y0OA 3OOBA 3UI4A 2JXWA 1KT0A 1FKGA 1FKHA 1FKBA 2YSBA 1EYMA 1PINA 2DK1A 4E5RA 4JFJA 4DZ3A 3O5FA 2KFWA 1HXVA 5GPGA 2PPNA 1EQ3A 1FKRA 3IK8A 2XPAA 4ODLA 4TX0A 2EZ5W 5HW8A 3O5GA 2LAJA 4IQCA 3TDBA 3O5LA 5I98A 1EG4A 2PV1A 4IQ2A 2N87A 3VAWA 2ZR4A 3UQIA 2XP6A 2L4JA 1BKFA 4JFMA 2ZQTA 1PBKA 4MSPA 2Y78A 2Q5AA 2AWGA 2LPVA 1QPLA 2XP4A 2ZQVA 1D7JA 3H9RB 5CQ2A 3JXVA 4C02B 2XP7A 3O5IA 2YSIA 4J4NA 3PA7A 4DRHA 2RUCA 3NTPA 2RQSA 2YSGA 4JFLA 3LE4A 4REXA 1L1PA 4TW6A 2F21A 3O5DA 4DZ2A 5HKGA 2DG3A 1P5QA 1BL4A 4MGVA 4DRIA 4ITZA 4TNSA 3EY6A 3O5KA 1J4IA 2PV2A 1TK7A 2ZR5A 1JNTA 2KE0A 1FKFA 2XP5A 1FKKA 1WR7A 1J4RA 4G50A 1I5HW 1FAPA 4IPXA 2XP9A 3L4HA 4DRQA 1NMWA 2MF9A 3M85A 2JMFA 1FKSA 4JFIA 3IKGA 1NSGA 2DK7A 2MLYA 4U84A 4GGQA 4LAXA 1K9RA 4DRPA 2E45A 2M8JA 1D7HA 4N19A 4DRNA 1T11A 4ODKA 5B8IC 4ODRA 3TC5A 3KAGA 3TCZA 4ODOA 2F4EA 2KO7A 1YATA 2LKNA 4DRMA 3KAFA 4LAVA 3UI5A 4W9PA 1Q6UA 4JYSA 2M8IA 2FAPA 3PRDA 1NMVA 3O5QA 4G2PA 1Q6HA 5BXJA 4J4OA 3WH0A 2RURA 5HT1A 3UF8A 1ZK6A 2DWVA 5HTGA 2OFNA 1R9HA 3RFWA 3O5PA 3O5RA 1O6WA 5DITA 1A7XA 4ODMA 4DROA 1EG3A 3CNGA 4LAWA 4ODNA 1JMQA 3PRBA 3NRKA 1FD9A 1JVWA 1F40A 3CGMA 1FKIA 1FKLA 5DIVA 1YW5A 1J6YA 2M3OW 4FAPA 2DMVA 2JV4A 4JFKA 4TYOA 2RUQA 3B7XA 4U86A 4DRKA 2KI3A 2ITKA 2MPHA 2YSHA 4GIVA 2MNTA 2MLXA 2XP3A 1Q1CA 2FKEA 2UZ5A 2JZVA 3JYJA 3M7NA 5DIUA 5J6EA 3ODKA 1ROTA 3KAHA 3NI6A 2KXQA 2M08A 1TCOC 5HW6A 1KT1A 1WMVA 1ZCNA 2K8IA 4QT3A 2KGJA 2DG4A 5D75A 4ODQA 1FJDA 1D6OA 3IKDA 5HW7A 3GPKA
chains in the Genus database with same CATH superfamily
1GRJA 3O5MA 4DT4A 4ODPA 3WIJA 3O5EA 3ARZA 2XP8A 4DIPA 1LL7A 4WKFA 1Q6IA 3B9EA 4Q22A 3FS8A 4ZPVR 1QZ2A 3ARWA 1N1AA 2ZAJA 1NWRA 3CHEA 1U79A 5HWBA 4QT2A 1FKTA 3IHZA 1JCHB 4NSBA 1W1PA 4U85A 1JNSA 4QIBA 4WKHA 2QRVA 1XRVA 3CGNA 5JH8A 2BA1A 2MLZA 1W26A 4ML4A 2PPPA 1FKDA 2F2DA 2IUZA 3MDYB 3UI6A 4W9OA 1UR8A 2DSWA 3UQBA 2L2SA 5AHTA 1OGGA 4S3JA 3AS3A 3O5OA 4R0XA 3RM9A 2O92A 4S3KA 4MAVA 2FDMA 3B9DA 2PPOA 3JYMA 2O9OA 1SR0A 2A3EA 2ZQSA 1HKKA 2KR7A 2QF8A 4ZPTR 2RSEA 1RP5A 3LKXB 1OGBA 2M1IA 4WIWA 3WKZA 4O2TA 1K9QA 2DG9A 3KACA 3O5JA 1WNOA 2LGOA 1D7IA 3FAPA 2M2AA 4WKAA 2LJ4A 1C9HA 2ETNA 5HUAA 1M5YA 4Z2LA 2VN1A 5HWCA 3KZ7A 3RMEA 2DT0A 2YSFA 1FFQA 3KADA 3OA5A 1ZL1A 2AOSA 4DH0A 3RGCA 2DSUA 4XAKA 4GLXA 3LUOA 3WL1A 2DJYA 5DO2A 1ZU8A 2D9FA 2MDIA 3MQGA 3KCEA 3UQAA 1QPFA 1EHNA 4P8XA 2IF4A 3KAIA 1RD6A 3AS0A 4BF8A 4TW8A 4DRJA 4TW7A 1FKJA 1J4HA 4W9QA 4URIA 2XPBA 4NNRA 3G6LA 1ROUA 2PBCA 3ARPA 1FLCA 2PV3A 2ZQUA 3KABA 3GTYX 1W9VA 3G6MA 4FN2A 1F8AB 4LAYA 4MNKA 3RM4A 1LG1A 1B6CA 1O6IA 4L3NA 3I6CA 4A0UA 1W1VA 2ZR6A 4IT6A 2RE3A 4W5UA 1NWSA 2RUDA 2VCDA 1W9PA 2JX8A 1GUVA 3OOBA 1Y0OA 1W1YA 3UI4A 2JXWA 1KT0A 4DWSC 1FKGA 1FKHA 1FKBA 2YSBA 1EYMA 1PINA 2DK1A 4E5RA 4ZPWR 2G41A 4JFJA 1ZBVA 2A3CA 5E66A 5E5WA 4DZ3A 3O5FA 2KFWA 1HXVA 5GPGA 2WADA 1LG2A 2PPNA 1EQ3A 1FKRA 3IK8A 2XPAA 4ODLA 4TX0A 2EZ5W 3W4RA 5GPRA 5HW8A 1NH6A 1X6LA 3O5GA 4MNMA 2LAJA 4IQCA 1HKJA 1H0GA 4P8WA 3TDBA 3FXYA 3O5LA 5I98A 4Z2JA 4AY1A 1EG4A 2PV1A 4IQ2A 3BXWA 2N87A 3ARRA 4KQZA 4WJXA 3VAWA 2ZR4A 3UQIA 2XP6A 3CH9A 2L4JA 4A0TA 1BKFA 4JFMA 3LKXA 3WQWA 2ZQTA 1PBKA 4MSPA 2Y78A 2YBTA 1D2KA 2Q5AA 1ZBCA 2AWGA 4P8UA 2LPVA 3ARYA 2EULA 1QPLA 3ARTA 3BMBA 1GPFA 2XP4A 1NWUA 2ZQVA 1D7JA 3H9RB 5CQ2A 3JXVA 2ESCA 2WLYA 2XP7A 3FSBA 2YBUA 3O5IA 2YSIA 3ARQA 4C02B 1HJXA 4J4NA 3CHFA 3PA7A 1NWTA 3MQHA 3EIPA 4HBOA 3FSCA 4DRHA 2RUCA 3AS2A 3B9AA 3NTPA 2B5UB 2YSGA 2RQSA 4JFLA 3LE4A 4REXA 1H0IA 1L1PA 4TW6A 1EDQA 4Z2HA 1X6NA 2F21A 3O5DA 4DZ2A 3ALFA 5HKGA 4HARA 4WK9A 2DG3A 1LJYA 1P5QA 1KFWA 1BL4A 4MGVA 4DRIA 4ITZA 4TNSA 3EY6A 3O5KA 1J4IA 2PV2A 1TK7A 2ZR5A 1JNTA 1UR9A 2KE0A 1FKFA 4KR0B 3WD2A 1JNEA 2XP5A 1FKKA 1WR7A 1W1TA 1J4RA 4G50A 1GOIA 1I5HW 1FAPA 3RM8A 1EIBA 1E6NA 2DT1A 2A3AA 4IPXA 2XP9A 3L4HA 1JNDA 2G8ZA 3WD4A 4DRQA 1NMWA 1WB0A 2MF9A 4Z2GA 3M85A 3ARVA 2JMFA 4DWSD 1FKSA 4JFIA 3IKGA 1W9UA 4ZS6A 1ZBWA 1NSGA 2DK7A 2MLYA 4U84A 5E65A 4GGQA 4LAXA 1ZBKA 3AQUA 2A3BA 2F23A 2PN0A 1K9RA 2PI6A 4DRPA 5GQBA 2E45A 4MTVA 2DPEA 2M8JA 1D7HA 4N19A 3CZ8A 2Y8NB 1TFVA 4DRNA 1T11A 4ODKA 5E64A 1ZB5A 4MNJA 5B8IC 2YAJB 4ODRA 3QOKA 3B8SA 3TC5A 1VF8A 5E62A 3KAGA 3TCZA 1E9LA 2F4EA 4ODOA 1SYTA 2KO7A 1YATA 2LKNA 4DRMA 2B31A 3PR9A 3CHDA 4HBEA 3KAFA 4LAVA 3UI5A 4W9PA 1Q6UA 4JYSA 2M8IA 5DEZA 1TR8A 4PTMA 2FAPA 3PRDA 1NMVA 3O5QA 4G2PA 1Q6HA 1LL6A 5BXJA 4DWSA 4J4OA 3WH0A 1E6RA 2RURA 5HT1A 4L72B 3MCBA 1K9TA 4R5EA 3UF8A 2OWOA 4DWSB 3ARUA 1ZK6A 2DWVA 5HTGA 3MCBB 3WQVA 2OFNA 4NZCA 1R9HA 1IX5A 3RFWA 3O5PA 3O5RA 1O6WA 5DITA 1A7XA 1FFRA 4ODMA 4DROA 3GU0A 3CHCA 5U47A 3WD3A 1EG3A 1HKIA 3PQHA 4MNLA 1ITXA 3CNGA 4Z2KA 4LAWA 4P8VA 3WD0A 4ODNA 1JMQA 3PRBA 3PRAA 2WK2A 3NRKA 2WAEA 1FD9A 1JVWA 1F40A 1OWQA 3CGMA 1FKIA 3AROA 2WM0A 2DSVA 2DSZA 1FKLA 2WLZA 5DIVA 4UDMA 1YW5A 2DT2A 1J6YA 2M3OW 3ALGA 1HJVA 4IT4A 2DMVA 4FAPA 2JV4A 4JFKA 4TYOA 2RUQA 3B7XA 4U86A 4DRKA 5DF0A 2KI3A 2ITKA 1HJWA 2DT3A 2MPHA 2P4VA 2YSHA 3ARXA 1LQ0A 1CTNA 4GIVA 2OLHA 2MNTA 4QZVB 2MLXA 1E6ZA 3FY1A 2XP3A 1Q1CA 1E15A 2FKEA 2UZ5A 5HBFA 2JZVA 3JYJA 3M7NA 5DIUA 5J6EA 1HKMA 3ARSA 1WAWA 4Z2IA 3ODKA 1ROTA 1XHGA 1LL4A 3KAHA 3NI6A 2KXQA 2M08A 1TCOC 5HW6A 1KT1A 4MPKA 3WL0A 3WD1A 1WMVA 1ZCNA 2K8IA 4QT3A 2KGJA 2DG4A 5D75A 4ODQA 1FJDA 1D6OA 3IKDA 1E6PA 3AS1A 4LGXA 4Q7NA 5HW7A 1E44A 3GPKA
chains in the Genus database with same CATH topology
3O5MA 4DT4A 4ODPA 3WIJA 3O5EA 3ARZA 2XP8A 4DIPA 1LL7A 4WKFA 1Q6IA 3B9EA 4Q22A 3FS8A 4ZPVR 1QZ2A 3ARWA 1N1AA 2ZAJA 1NWRA 3CHEA 1U79A 5HWBA 4QT2A 1FKTA 3IHZA 4NSBA 1W1PA 4U85A 1JNSA 4QIBA 4WKHA 2QRVA 1XRVA 3CGNA 5JH8A 2BA1A 2MLZA 1W26A 4ML4A 2PPPA 1FKDA 2F2DA 2IUZA 3MDYB 3UI6A 4W9OA 1UR8A 2DSWA 3UQBA 2L2SA 5AHTA 1OGGA 4S3JA 3AS3A 3O5OA 4R0XA 3RM9A 2O92A 4S3KA 4MAVA 2FDMA 3B9DA 2PPOA 3JYMA 2O9OA 1SR0A 2A3EA 2ZQSA 1HKKA 2KR7A 2QF8A 4ZPTR 2RSEA 1RP5A 3LKXB 1OGBA 2M1IA 4WIWA 3WKZA 4O2TA 1K9QA 2DG9A 3KACA 3O5JA 1WNOA 2LGOA 1D7IA 3FAPA 2M2AA 4WKAA 2LJ4A 1C9HA 5HUAA 1M5YA 4Z2LA 2VN1A 5HWCA 3KZ7A 3RMEA 2DT0A 2YSFA 1FFQA 3KADA 3OA5A 1ZL1A 2AOSA 4DH0A 3RGCA 2DSUA 4XAKA 4GLXA 3LUOA 3WL1A 2DJYA 5DO2A 1ZU8A 2D9FA 2MDIA 3MQGA 3KCEA 3UQAA 1QPFA 1EHNA 4P8XA 2IF4A 3KAIA 1RD6A 3AS0A 4BF8A 4TW8A 4DRJA 4TW7A 1FKJA 1J4HA 4W9QA 4URIA 2XPBA 4NNRA 3G6LA 1ROUA 2PBCA 3ARPA 1FLCA 2PV3A 2ZQUA 3KABA 1W9VA 3G6MA 4FN2A 1F8AB 4LAYA 4MNKA 3RM4A 1LG1A 1B6CA 1O6IA 4L3NA 3I6CA 4A0UA 1W1VA 2ZR6A 4IT6A 2RE3A 4W5UA 1NWSA 2RUDA 2VCDA 1W9PA 2JX8A 1GUVA 3OOBA 1Y0OA 1W1YA 3UI4A 2JXWA 1KT0A 4DWSC 1FKGA 1FKHA 1FKBA 2YSBA 1EYMA 1PINA 2DK1A 4E5RA 4ZPWR 2G41A 4JFJA 1ZBVA 2A3CA 5E66A 5E5WA 4DZ3A 3O5FA 2KFWA 1HXVA 5GPGA 2WADA 1LG2A 2PPNA 1EQ3A 1FKRA 3IK8A 2XPAA 4ODLA 4TX0A 2EZ5W 3W4RA 5GPRA 5HW8A 1NH6A 1X6LA 3O5GA 4MNMA 2LAJA 4IQCA 1HKJA 1H0GA 4P8WA 3TDBA 3FXYA 3O5LA 5I98A 4Z2JA 4AY1A 1EG4A 2PV1A 4IQ2A 3BXWA 2N87A 3ARRA 4KQZA 4WJXA 3VAWA 2ZR4A 3UQIA 2XP6A 3CH9A 2L4JA 4A0TA 1BKFA 4JFMA 3LKXA 3WQWA 2ZQTA 1PBKA 4MSPA 2Y78A 2YBTA 1D2KA 2Q5AA 1ZBCA 2AWGA 4P8UA 2LPVA 3ARYA 1QPLA 3ARTA 1GPFA 2XP4A 1NWUA 2ZQVA 1D7JA 3H9RB 5CQ2A 3JXVA 2ESCA 2WLYA 2XP7A 3FSBA 2YBUA 3O5IA 2YSIA 3ARQA 4C02B 1HJXA 4J4NA 3CHFA 3PA7A 1NWTA 3MQHA 4HBOA 3FSCA 4DRHA 2RUCA 3AS2A 3B9AA 3NTPA 2YSGA 2RQSA 4JFLA 3LE4A 4REXA 1H0IA 1L1PA 4TW6A 1EDQA 4Z2HA 1X6NA 2F21A 3O5DA 4DZ2A 3ALFA 5HKGA 4HARA 4WK9A 2DG3A 1LJYA 1P5QA 1KFWA 1BL4A 4MGVA 4DRIA 4ITZA 4TNSA 3EY6A 3O5KA 1J4IA 2PV2A 1TK7A 2ZR5A 1JNTA 1UR9A 2KE0A 1FKFA 4KR0B 3WD2A 1JNEA 2XP5A 1FKKA 1WR7A 1W1TA 1J4RA 4G50A 1GOIA 1I5HW 1FAPA 3RM8A 1EIBA 1E6NA 2DT1A 2A3AA 4IPXA 2XP9A 3L4HA 1JNDA 2G8ZA 3WD4A 4DRQA 1NMWA 1WB0A 2MF9A 4Z2GA 3M85A 3ARVA 2JMFA 4DWSD 1FKSA 4JFIA 3IKGA 1W9UA 4ZS6A 1ZBWA 1NSGA 2DK7A 2MLYA 4U84A 5E65A 4GGQA 4LAXA 1ZBKA 3AQUA 2A3BA 1K9RA 2PI6A 4DRPA 5GQBA 2E45A 4MTVA 2DPEA 2M8JA 1D7HA 4N19A 3CZ8A 2Y8NB 1TFVA 4DRNA 1T11A 4ODKA 5E64A 1ZB5A 4MNJA 5B8IC 2YAJB 4ODRA 3QOKA 3B8SA 3TC5A 1VF8A 5E62A 3KAGA 3TCZA 1E9LA 2F4EA 4ODOA 1SYTA 2KO7A 1YATA 2LKNA 4DRMA 2B31A 3PR9A 3CHDA 4HBEA 3KAFA 4LAVA 3UI5A 4W9PA 1Q6UA 4JYSA 2M8IA 5DEZA 1TR8A 4PTMA 2FAPA 3PRDA 1NMVA 3O5QA 4G2PA 1Q6HA 1LL6A 5BXJA 4DWSA 4J4OA 3WH0A 1E6RA 2RURA 5HT1A 4L72B 3MCBA 1K9TA 4R5EA 3UF8A 2OWOA 4DWSB 3ARUA 1ZK6A 2DWVA 5HTGA 3MCBB 3WQVA 2OFNA 4NZCA 1R9HA 1IX5A 3RFWA 3O5PA 3O5RA 1O6WA 5DITA 1A7XA 1FFRA 4ODMA 4DROA 3CHCA 5U47A 3WD3A 1EG3A 1HKIA 3PQHA 4MNLA 1ITXA 3CNGA 4Z2KA 4LAWA 4P8VA 3WD0A 4ODNA 1JMQA 3PRBA 3PRAA 2WK2A 3NRKA 2WAEA 1FD9A 1JVWA 1F40A 1OWQA 3CGMA 1FKIA 3AROA 2WM0A 2DSVA 2DSZA 1FKLA 2WLZA 5DIVA 1YW5A 2DT2A 1J6YA 2M3OW 3ALGA 1HJVA 4IT4A 2DMVA 4FAPA 2JV4A 4JFKA 4TYOA 2RUQA 3B7XA 4U86A 4DRKA 5DF0A 2KI3A 2ITKA 1HJWA 2DT3A 2MPHA 2YSHA 3ARXA 1LQ0A 1CTNA 4GIVA 2OLHA 2MNTA 4QZVB 2MLXA 1E6ZA 3FY1A 2XP3A 1Q1CA 1E15A 2FKEA 2UZ5A 5HBFA 2JZVA 3JYJA 3M7NA 5DIUA 5J6EA 1HKMA 3ARSA 1WAWA 4Z2IA 3ODKA 1ROTA 1XHGA 1LL4A 3KAHA 3NI6A 2KXQA 2M08A 1TCOC 5HW6A 1KT1A 4MPKA 3WL0A 3WD1A 1WMVA 1ZCNA 2K8IA 4QT3A 2KGJA 2DG4A 5D75A 4ODQA 1FJDA 1D6OA 3IKDA 1E6PA 3AS1A 4LGXA 4Q7NA 5HW7A 3GPKA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3O5M A;  4DT4 A;  4ODP A;  3O5E A;  2XP8 A;  4DIP A;  1Q6I A;  1QZ2 A;  1N1A A;  2ZAJ A;  5HWB A;  1U79 A;  4QT2 A;  1FKT A;  3IHZ A;  4U85 A;  1JNS A;  4QIB A;  3CGN A;  2BA1 A;  2MLZ A;  1W26 A;  2PPP A;  1FKD A;  2F2D A;  3MDY B;  3UI6 A;  4W9O A;  3UQB A;  2L2S A;  5AHT A;  3O5O A;  4R0X A;  2PPO A;  3JYM A;  2ZQS A;  2KR7 A;  2RSE A;  2M1I A;  4O2T A;  1K9Q A;  2DG9 A;  3KAC A;  3O5J A;  2LGO A;  1D7I A;  3FAP A;  2M2A A;  2LJ4 A;  1C9H A;  5HUA A;  1M5Y A;  2VN1 A;  5HWC A;  3KZ7 A;  2YSF A;  3KAD A;  4DH0 A;  3RGC A;  3LUO A;  2DJY A;  2D9F A;  2MDI A;  3KCE A;  3UQA A;  1QPF A;  2IF4 A;  3KAI A;  4BF8 A;  4TW8 A;  4DRJ A;  4TW7 A;  1FKJ A;  1J4H A;  4W9Q A;  2XPB A;  4NNR A;  1ROU A;  2PBC A;  2PV3 A;  2ZQU A;  3KAB A;  4FN2 A;  1F8A B;  4LAY A;  1B6C A;  3I6C A;  2ZR6 A;  2RE3 A;  2RUD A;  2VCD A;  2JX8 A;  1Y0O A;  3OOB A;  3UI4 A;  2JXW A;  1KT0 A;  1FKG A;  1FKH A;  1FKB A;  2YSB A;  1EYM A;  1PIN A;  2DK1 A;  4E5R A;  4JFJ A;  4DZ3 A;  3O5F A;  2KFW A;  1HXV A;  5GPG A;  2PPN A;  1EQ3 A;  1FKR A;  3IK8 A;  2XPA A;  4ODL A;  4TX0 A;  2EZ5 W;  5HW8 A;  3O5G A;  2LAJ A;  4IQC A;  3TDB A;  3O5L A;  5I98 A;  1EG4 A;  2PV1 A;  4IQ2 A;  2N87 A;  3VAW A;  2ZR4 A;  3UQI A;  2XP6 A;  2L4J A;  1BKF A;  4JFM A;  2ZQT A;  1PBK A;  4MSP A;  2Y78 A;  2Q5A A;  2AWG A;  2LPV A;  1QPL A;  2XP4 A;  2ZQV A;  1D7J A;  3H9R B;  5CQ2 A;  3JXV A;  4C02 B;  2XP7 A;  3O5I A;  2YSI A;  4J4N A;  3PA7 A;  4DRH A;  2RUC A;  3NTP A;  2RQS A;  2YSG A;  4JFL A;  3LE4 A;  4REX A;  1L1P A;  4TW6 A;  2F21 A;  3O5D A;  4DZ2 A;  5HKG A;  2DG3 A;  1P5Q A;  1BL4 A;  4MGV A;  4DRI A;  4ITZ A;  4TNS A;  3EY6 A;  3O5K A;  1J4I A;  2PV2 A;  1TK7 A;  2ZR5 A;  1JNT A;  2KE0 A;  1FKF A;  2XP5 A;  1FKK A;  1WR7 A;  1J4R A;  4G50 A;  1I5H W;  1FAP A;  4IPX A;  2XP9 A;  3L4H A;  4DRQ A;  1NMW A;  2MF9 A;  3M85 A;  2JMF A;  1FKS A;  4JFI A;  3IKG A;  1NSG A;  2DK7 A;  2MLY A;  4U84 A;  4GGQ A;  4LAX A;  1K9R A;  4DRP A;  2E45 A;  2M8J A;  1D7H A;  4N19 A;  4DRN A;  1T11 A;  4ODK A;  5B8I C;  4ODR A;  3TC5 A;  3KAG A;  3TCZ A;  4ODO A;  2F4E A;  2KO7 A;  1YAT A;  2LKN A;  4DRM A;  3KAF A;  4LAV A;  3UI5 A;  4W9P A;  1Q6U A;  4JYS A;  2M8I A;  2FAP A;  3PRD A;  1NMV A;  3O5Q A;  4G2P A;  1Q6H A;  5BXJ A;  4J4O A;  3WH0 A;  2RUR A;  5HT1 A;  3UF8 A;  1ZK6 A;  2DWV A;  5HTG A;  2OFN A;  1R9H A;  3RFW A;  3O5P A;  3O5R A;  1O6W A;  5DIT A;  1A7X A;  4ODM A;  4DRO A;  1EG3 A;  3CNG A;  4LAW A;  4ODN A;  1JMQ A;  3PRB A;  3NRK A;  1FD9 A;  1JVW A;  1F40 A;  3CGM A;  1FKI A;  1FKL A;  5DIV A;  1YW5 A;  1J6Y A;  2M3O W;  4FAP A;  2DMV A;  2JV4 A;  4JFK A;  4TYO A;  2RUQ A;  3B7X A;  4U86 A;  4DRK A;  2KI3 A;  2ITK A;  2MPH A;  2YSH A;  4GIV A;  2MNT A;  2MLX A;  2XP3 A;  1Q1C A;  2FKE A;  2UZ5 A;  2JZV A;  3JYJ A;  3M7N A;  5DIU A;  5J6E A;  3ODK A;  1ROT A;  3KAH A;  3NI6 A;  2KXQ A;  2M08 A;  1TCO C;  5HW6 A;  1KT1 A;  1WMV A;  1ZCN A;  2K8I A;  4QT3 A;  2KGJ A;  2DG4 A;  5D75 A;  4ODQ A;  1FJD A;  1D6O A;  3IKD A;  5HW7 A;  3GPK A; 
#chains in the Genus database with same CATH topology
 1GRJ A;  3O5M A;  4DT4 A;  4ODP A;  3WIJ A;  3O5E A;  3ARZ A;  2XP8 A;  4DIP A;  1LL7 A;  4WKF A;  1Q6I A;  3B9E A;  4Q22 A;  3FS8 A;  4ZPV R;  1QZ2 A;  3ARW A;  1N1A A;  2ZAJ A;  1NWR A;  3CHE A;  1U79 A;  5HWB A;  4QT2 A;  1FKT A;  3IHZ A;  1JCH B;  4NSB A;  1W1P A;  4U85 A;  1JNS A;  4QIB A;  4WKH A;  2QRV A;  1XRV A;  3CGN A;  5JH8 A;  2BA1 A;  2MLZ A;  1W26 A;  4ML4 A;  2PPP A;  1FKD A;  2F2D A;  2IUZ A;  3MDY B;  3UI6 A;  4W9O A;  1UR8 A;  2DSW A;  3UQB A;  2L2S A;  5AHT A;  1OGG A;  4S3J A;  3AS3 A;  3O5O A;  4R0X A;  3RM9 A;  2O92 A;  4S3K A;  4MAV A;  2FDM A;  3B9D A;  2PPO A;  3JYM A;  2O9O A;  1SR0 A;  2A3E A;  2ZQS A;  1HKK A;  2KR7 A;  2QF8 A;  4ZPT R;  2RSE A;  1RP5 A;  3LKX B;  1OGB A;  2M1I A;  4WIW A;  3WKZ A;  4O2T A;  1K9Q A;  2DG9 A;  3KAC A;  3O5J A;  1WNO A;  2LGO A;  1D7I A;  3FAP A;  2M2A A;  4WKA A;  2LJ4 A;  1C9H A;  2ETN A;  5HUA A;  1M5Y A;  4Z2L A;  2VN1 A;  5HWC A;  3KZ7 A;  3RME A;  2DT0 A;  2YSF A;  1FFQ A;  3KAD A;  3OA5 A;  1ZL1 A;  2AOS A;  4DH0 A;  3RGC A;  2DSU A;  4XAK A;  4GLX A;  3LUO A;  3WL1 A;  2DJY A;  5DO2 A;  1ZU8 A;  2D9F A;  2MDI A;  3MQG A;  3KCE A;  3UQA A;  1QPF A;  1EHN A;  4P8X A;  2IF4 A;  3KAI A;  1RD6 A;  3AS0 A;  4BF8 A;  4TW8 A;  4DRJ A;  4TW7 A;  1FKJ A;  1J4H A;  4W9Q A;  4URI A;  2XPB A;  4NNR A;  3G6L A;  1ROU A;  2PBC A;  3ARP A;  1FLC A;  2PV3 A;  2ZQU A;  3KAB A;  3GTY X;  1W9V A;  3G6M A;  4FN2 A;  1F8A B;  4LAY A;  4MNK A;  3RM4 A;  1LG1 A;  1B6C A;  1O6I A;  4L3N A;  3I6C A;  4A0U A;  1W1V A;  2ZR6 A;  4IT6 A;  2RE3 A;  4W5U A;  1NWS A;  2RUD A;  2VCD A;  1W9P A;  2JX8 A;  1GUV A;  3OOB A;  1Y0O A;  1W1Y A;  3UI4 A;  2JXW A;  1KT0 A;  4DWS C;  1FKG A;  1FKH A;  1FKB A;  2YSB A;  1EYM A;  1PIN A;  2DK1 A;  4E5R A;  4ZPW R;  2G41 A;  4JFJ A;  1ZBV A;  2A3C A;  5E66 A;  5E5W A;  4DZ3 A;  3O5F A;  2KFW A;  1HXV A;  5GPG A;  2WAD A;  1LG2 A;  2PPN A;  1EQ3 A;  1FKR A;  3IK8 A;  2XPA A;  4ODL A;  4TX0 A;  2EZ5 W;  3W4R A;  5GPR A;  5HW8 A;  1NH6 A;  1X6L A;  3O5G A;  4MNM A;  2LAJ A;  4IQC A;  1HKJ A;  1H0G A;  4P8W A;  3TDB A;  3FXY A;  3O5L A;  5I98 A;  4Z2J A;  4AY1 A;  1EG4 A;  2PV1 A;  4IQ2 A;  3BXW A;  2N87 A;  3ARR A;  4KQZ A;  4WJX A;  3VAW A;  2ZR4 A;  3UQI A;  2XP6 A;  3CH9 A;  2L4J A;  4A0T A;  1BKF A;  4JFM A;  3LKX A;  3WQW A;  2ZQT A;  1PBK A;  4MSP A;  2Y78 A;  2YBT A;  1D2K A;  2Q5A A;  1ZBC A;  2AWG A;  4P8U A;  2LPV A;  3ARY A;  2EUL A;  1QPL A;  3ART A;  3BMB A;  1GPF A;  2XP4 A;  1NWU A;  2ZQV A;  1D7J A;  3H9R B;  5CQ2 A;  3JXV A;  2ESC A;  2WLY A;  2XP7 A;  3FSB A;  2YBU A;  3O5I A;  2YSI A;  3ARQ A;  4C02 B;  1HJX A;  4J4N A;  3CHF A;  3PA7 A;  1NWT A;  3MQH A;  3EIP A;  4HBO A;  3FSC A;  4DRH A;  2RUC A;  3AS2 A;  3B9A A;  3NTP A;  2B5U B;  2YSG A;  2RQS A;  4JFL A;  3LE4 A;  4REX A;  1H0I A;  1L1P A;  4TW6 A;  1EDQ A;  4Z2H A;  1X6N A;  2F21 A;  3O5D A;  4DZ2 A;  3ALF A;  5HKG A;  4HAR A;  4WK9 A;  2DG3 A;  1LJY A;  1P5Q A;  1KFW A;  1BL4 A;  4MGV A;  4DRI A;  4ITZ A;  4TNS A;  3EY6 A;  3O5K A;  1J4I A;  2PV2 A;  1TK7 A;  2ZR5 A;  1JNT A;  1UR9 A;  2KE0 A;  1FKF A;  4KR0 B;  3WD2 A;  1JNE A;  2XP5 A;  1FKK A;  1WR7 A;  1W1T A;  1J4R A;  4G50 A;  1GOI A;  1I5H W;  1FAP A;  3RM8 A;  1EIB A;  1E6N A;  2DT1 A;  2A3A A;  4IPX A;  2XP9 A;  3L4H A;  1JND A;  2G8Z A;  3WD4 A;  4DRQ A;  1NMW A;  1WB0 A;  2MF9 A;  4Z2G A;  3M85 A;  3ARV A;  2JMF A;  4DWS D;  1FKS A;  4JFI A;  3IKG A;  1W9U A;  4ZS6 A;  1ZBW A;  1NSG A;  2DK7 A;  2MLY A;  4U84 A;  5E65 A;  4GGQ A;  4LAX A;  1ZBK A;  3AQU A;  2A3B A;  2F23 A;  2PN0 A;  1K9R A;  2PI6 A;  4DRP A;  5GQB A;  2E45 A;  4MTV A;  2DPE A;  2M8J A;  1D7H A;  4N19 A;  3CZ8 A;  2Y8N B;  1TFV A;  4DRN A;  1T11 A;  4ODK A;  5E64 A;  1ZB5 A;  4MNJ A;  5B8I C;  2YAJ B;  4ODR A;  3QOK A;  3B8S A;  3TC5 A;  1VF8 A;  5E62 A;  3KAG A;  3TCZ A;  1E9L A;  2F4E A;  4ODO A;  1SYT A;  2KO7 A;  1YAT A;  2LKN A;  4DRM A;  2B31 A;  3PR9 A;  3CHD A;  4HBE A;  3KAF A;  4LAV A;  3UI5 A;  4W9P A;  1Q6U A;  4JYS A;  2M8I A;  5DEZ A;  1TR8 A;  4PTM A;  2FAP A;  3PRD A;  1NMV A;  3O5Q A;  4G2P A;  1Q6H A;  1LL6 A;  5BXJ A;  4DWS A;  4J4O A;  3WH0 A;  1E6R A;  2RUR A;  5HT1 A;  4L72 B;  3MCB A;  1K9T A;  4R5E A;  3UF8 A;  2OWO A;  4DWS B;  3ARU A;  1ZK6 A;  2DWV A;  5HTG A;  3MCB B;  3WQV A;  2OFN A;  4NZC A;  1R9H A;  1IX5 A;  3RFW A;  3O5P A;  3O5R A;  1O6W A;  5DIT A;  1A7X A;  1FFR A;  4ODM A;  4DRO A;  3GU0 A;  3CHC A;  5U47 A;  3WD3 A;  1EG3 A;  1HKI A;  3PQH A;  4MNL A;  1ITX A;  3CNG A;  4Z2K A;  4LAW A;  4P8V A;  3WD0 A;  4ODN A;  1JMQ A;  3PRB A;  3PRA A;  2WK2 A;  3NRK A;  2WAE A;  1FD9 A;  1JVW A;  1F40 A;  1OWQ A;  3CGM A;  1FKI A;  3ARO A;  2WM0 A;  2DSV A;  2DSZ A;  1FKL A;  2WLZ A;  5DIV A;  4UDM A;  1YW5 A;  2DT2 A;  1J6Y A;  2M3O W;  3ALG A;  1HJV A;  4IT4 A;  2DMV A;  4FAP A;  2JV4 A;  4JFK A;  4TYO A;  2RUQ A;  3B7X A;  4U86 A;  4DRK A;  5DF0 A;  2KI3 A;  2ITK A;  1HJW A;  2DT3 A;  2MPH A;  2P4V A;  2YSH A;  3ARX A;  1LQ0 A;  1CTN A;  4GIV A;  2OLH A;  2MNT A;  4QZV B;  2MLX A;  1E6Z A;  3FY1 A;  2XP3 A;  1Q1C A;  1E15 A;  2FKE A;  2UZ5 A;  5HBF A;  2JZV A;  3JYJ A;  3M7N A;  5DIU A;  5J6E A;  1HKM A;  3ARS A;  1WAW A;  4Z2I A;  3ODK A;  1ROT A;  1XHG A;  1LL4 A;  3KAH A;  3NI6 A;  2KXQ A;  2M08 A;  1TCO C;  5HW6 A;  1KT1 A;  4MPK A;  3WL0 A;  3WD1 A;  1WMV A;  1ZCN A;  2K8I A;  4QT3 A;  2KGJ A;  2DG4 A;  5D75 A;  4ODQ A;  1FJD A;  1D6O A;  3IKD A;  1E6P A;  3AS1 A;  4LGX A;  4Q7N A;  5HW7 A;  1E44 A;  3GPK A; 
#chains in the Genus database with same CATH homology
 3O5M A;  4DT4 A;  4ODP A;  3WIJ A;  3O5E A;  3ARZ A;  2XP8 A;  4DIP A;  1LL7 A;  4WKF A;  1Q6I A;  3B9E A;  4Q22 A;  3FS8 A;  4ZPV R;  1QZ2 A;  3ARW A;  1N1A A;  2ZAJ A;  1NWR A;  3CHE A;  1U79 A;  5HWB A;  4QT2 A;  1FKT A;  3IHZ A;  4NSB A;  1W1P A;  4U85 A;  1JNS A;  4QIB A;  4WKH A;  2QRV A;  1XRV A;  3CGN A;  5JH8 A;  2BA1 A;  2MLZ A;  1W26 A;  4ML4 A;  2PPP A;  1FKD A;  2F2D A;  2IUZ A;  3MDY B;  3UI6 A;  4W9O A;  1UR8 A;  2DSW A;  3UQB A;  2L2S A;  5AHT A;  1OGG A;  4S3J A;  3AS3 A;  3O5O A;  4R0X A;  3RM9 A;  2O92 A;  4S3K A;  4MAV A;  2FDM A;  3B9D A;  2PPO A;  3JYM A;  2O9O A;  1SR0 A;  2A3E A;  2ZQS A;  1HKK A;  2KR7 A;  2QF8 A;  4ZPT R;  2RSE A;  1RP5 A;  3LKX B;  1OGB A;  2M1I A;  4WIW A;  3WKZ A;  4O2T A;  1K9Q A;  2DG9 A;  3KAC A;  3O5J A;  1WNO A;  2LGO A;  1D7I A;  3FAP A;  2M2A A;  4WKA A;  2LJ4 A;  1C9H A;  5HUA A;  1M5Y A;  4Z2L A;  2VN1 A;  5HWC A;  3KZ7 A;  3RME A;  2DT0 A;  2YSF A;  1FFQ A;  3KAD A;  3OA5 A;  1ZL1 A;  2AOS A;  4DH0 A;  3RGC A;  2DSU A;  4XAK A;  4GLX A;  3LUO A;  3WL1 A;  2DJY A;  5DO2 A;  1ZU8 A;  2D9F A;  2MDI A;  3MQG A;  3KCE A;  3UQA A;  1QPF A;  1EHN A;  4P8X A;  2IF4 A;  3KAI A;  1RD6 A;  3AS0 A;  4BF8 A;  4TW8 A;  4DRJ A;  4TW7 A;  1FKJ A;  1J4H A;  4W9Q A;  4URI A;  2XPB A;  4NNR A;  3G6L A;  1ROU A;  2PBC A;  3ARP A;  1FLC A;  2PV3 A;  2ZQU A;  3KAB A;  1W9V A;  3G6M A;  4FN2 A;  1F8A B;  4LAY A;  4MNK A;  3RM4 A;  1LG1 A;  1B6C A;  1O6I A;  4L3N A;  3I6C A;  4A0U A;  1W1V A;  2ZR6 A;  4IT6 A;  2RE3 A;  4W5U A;  1NWS A;  2RUD A;  2VCD A;  1W9P A;  2JX8 A;  1GUV A;  3OOB A;  1Y0O A;  1W1Y A;  3UI4 A;  2JXW A;  1KT0 A;  4DWS C;  1FKG A;  1FKH A;  1FKB A;  2YSB A;  1EYM A;  1PIN A;  2DK1 A;  4E5R A;  4ZPW R;  2G41 A;  4JFJ A;  1ZBV A;  2A3C A;  5E66 A;  5E5W A;  4DZ3 A;  3O5F A;  2KFW A;  1HXV A;  5GPG A;  2WAD A;  1LG2 A;  2PPN A;  1EQ3 A;  1FKR A;  3IK8 A;  2XPA A;  4ODL A;  4TX0 A;  2EZ5 W;  3W4R A;  5GPR A;  5HW8 A;  1NH6 A;  1X6L A;  3O5G A;  4MNM A;  2LAJ A;  4IQC A;  1HKJ A;  1H0G A;  4P8W A;  3TDB A;  3FXY A;  3O5L A;  5I98 A;  4Z2J A;  4AY1 A;  1EG4 A;  2PV1 A;  4IQ2 A;  3BXW A;  2N87 A;  3ARR A;  4KQZ A;  4WJX A;  3VAW A;  2ZR4 A;  3UQI A;  2XP6 A;  3CH9 A;  2L4J A;  4A0T A;  1BKF A;  4JFM A;  3LKX A;  3WQW A;  2ZQT A;  1PBK A;  4MSP A;  2Y78 A;  2YBT A;  1D2K A;  2Q5A A;  1ZBC A;  2AWG A;  4P8U A;  2LPV A;  3ARY A;  1QPL A;  3ART A;  1GPF A;  2XP4 A;  1NWU A;  2ZQV A;  1D7J A;  3H9R B;  5CQ2 A;  3JXV A;  2ESC A;  2WLY A;  2XP7 A;  3FSB A;  2YBU A;  3O5I A;  2YSI A;  3ARQ A;  4C02 B;  1HJX A;  4J4N A;  3CHF A;  3PA7 A;  1NWT A;  3MQH A;  4HBO A;  3FSC A;  4DRH A;  2RUC A;  3AS2 A;  3B9A A;  3NTP A;  2YSG A;  2RQS A;  4JFL A;  3LE4 A;  4REX A;  1H0I A;  1L1P A;  4TW6 A;  1EDQ A;  4Z2H A;  1X6N A;  2F21 A;  3O5D A;  4DZ2 A;  3ALF A;  5HKG A;  4HAR A;  4WK9 A;  2DG3 A;  1LJY A;  1P5Q A;  1KFW A;  1BL4 A;  4MGV A;  4DRI A;  4ITZ A;  4TNS A;  3EY6 A;  3O5K A;  1J4I A;  2PV2 A;  1TK7 A;  2ZR5 A;  1JNT A;  1UR9 A;  2KE0 A;  1FKF A;  4KR0 B;  3WD2 A;  1JNE A;  2XP5 A;  1FKK A;  1WR7 A;  1W1T A;  1J4R A;  4G50 A;  1GOI A;  1I5H W;  1FAP A;  3RM8 A;  1EIB A;  1E6N A;  2DT1 A;  2A3A A;  4IPX A;  2XP9 A;  3L4H A;  1JND A;  2G8Z A;  3WD4 A;  4DRQ A;  1NMW A;  1WB0 A;  2MF9 A;  4Z2G A;  3M85 A;  3ARV A;  2JMF A;  4DWS D;  1FKS A;  4JFI A;  3IKG A;  1W9U A;  4ZS6 A;  1ZBW A;  1NSG A;  2DK7 A;  2MLY A;  4U84 A;  5E65 A;  4GGQ A;  4LAX A;  1ZBK A;  3AQU A;  2A3B A;  1K9R A;  2PI6 A;  4DRP A;  5GQB A;  2E45 A;  4MTV A;  2DPE A;  2M8J A;  1D7H A;  4N19 A;  3CZ8 A;  2Y8N B;  1TFV A;  4DRN A;  1T11 A;  4ODK A;  5E64 A;  1ZB5 A;  4MNJ A;  5B8I C;  2YAJ B;  4ODR A;  3QOK A;  3B8S A;  3TC5 A;  1VF8 A;  5E62 A;  3KAG A;  3TCZ A;  1E9L A;  2F4E A;  4ODO A;  1SYT A;  2KO7 A;  1YAT A;  2LKN A;  4DRM A;  2B31 A;  3PR9 A;  3CHD A;  4HBE A;  3KAF A;  4LAV A;  3UI5 A;  4W9P A;  1Q6U A;  4JYS A;  2M8I A;  5DEZ A;  1TR8 A;  4PTM A;  2FAP A;  3PRD A;  1NMV A;  3O5Q A;  4G2P A;  1Q6H A;  1LL6 A;  5BXJ A;  4DWS A;  4J4O A;  3WH0 A;  1E6R A;  2RUR A;  5HT1 A;  4L72 B;  3MCB A;  1K9T A;  4R5E A;  3UF8 A;  2OWO A;  4DWS B;  3ARU A;  1ZK6 A;  2DWV A;  5HTG A;  3MCB B;  3WQV A;  2OFN A;  4NZC A;  1R9H A;  1IX5 A;  3RFW A;  3O5P A;  3O5R A;  1O6W A;  5DIT A;  1A7X A;  1FFR A;  4ODM A;  4DRO A;  3CHC A;  5U47 A;  3WD3 A;  1EG3 A;  1HKI A;  3PQH A;  4MNL A;  1ITX A;  3CNG A;  4Z2K A;  4LAW A;  4P8V A;  3WD0 A;  4ODN A;  1JMQ A;  3PRB A;  3PRA A;  2WK2 A;  3NRK A;  2WAE A;  1FD9 A;  1JVW A;  1F40 A;  1OWQ A;  3CGM A;  1FKI A;  3ARO A;  2WM0 A;  2DSV A;  2DSZ A;  1FKL A;  2WLZ A;  5DIV A;  1YW5 A;  2DT2 A;  1J6Y A;  2M3O W;  3ALG A;  1HJV A;  4IT4 A;  2DMV A;  4FAP A;  2JV4 A;  4JFK A;  4TYO A;  2RUQ A;  3B7X A;  4U86 A;  4DRK A;  5DF0 A;  2KI3 A;  2ITK A;  1HJW A;  2DT3 A;  2MPH A;  2YSH A;  3ARX A;  1LQ0 A;  1CTN A;  4GIV A;  2OLH A;  2MNT A;  4QZV B;  2MLX A;  1E6Z A;  3FY1 A;  2XP3 A;  1Q1C A;  1E15 A;  2FKE A;  2UZ5 A;  5HBF A;  2JZV A;  3JYJ A;  3M7N A;  5DIU A;  5J6E A;  1HKM A;  3ARS A;  1WAW A;  4Z2I A;  3ODK A;  1ROT A;  1XHG A;  1LL4 A;  3KAH A;  3NI6 A;  2KXQ A;  2M08 A;  1TCO C;  5HW6 A;  1KT1 A;  4MPK A;  3WL0 A;  3WD1 A;  1WMV A;  1ZCN A;  2K8I A;  4QT3 A;  2KGJ A;  2DG4 A;  5D75 A;  4ODQ A;  1FJD A;  1D6O A;  3IKD A;  1E6P A;  3AS1 A;  4LGX A;  4Q7N A;  5HW7 A;  3GPK A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...