3TCZA

Human pin1 bound to cis peptidomimetic inhibitor
Total Genus 45
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
45
sequence length
158
structure length
146
Chain Sequence
KLPPGWEKAMSRSSGRVYYFNHITNASQWERPSEPARVRCSHLLVKHSQSRRPSSWRQEKITRTKEEALELINGYIQKIKSGEEDFESLASQFSDCSSAKARGDLGAFSRGQMQKPFEDASFALRTGEMSGPVFTDSGIHIILRTE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Peptidyl-prolyl cis-trans isomerase NIMA-interacting 1
publication title Structural and Kinetic Analysis of Prolyl-isomerization/Phosphorylation Cross-Talk in the CTD Code.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Isomerase/inhibitor
total genus 45
structure length 146
sequence length 158
ec nomenclature ec 5.2.1.8: Peptidylprolyl isomerase.
pdb deposition date 2011-08-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00397 WW WW domain
A PF00639 Rotamase PPIC-type PPIASE domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.20.70.10 Mainly Beta Single Sheet Ubiquitin Ligase Nedd4; Chain: W; Ubiquitin Ligase Nedd4; Chain: W; 3tczA01
3.10.50.40 Alpha Beta Roll Chitinase A; domain 3 Chitinase A; domain 3 3tczA02
1FKRA 1TK7A 2DG9A 2LPVA 4DRMA 4DRJA 2JX8A 4IQ2A 1QPFA 2DWVA 5DIUA 3GPKA 4DRPA 4ODMA 4ODPA 3UI4A 3FAPA 5HWCA 2RURA 2EZ5W 1BL4A 1FKGA 3O5KA 2YSGA 3PA7A 1F40A 5HUAA 2ZQSA 2DJYA 1T11A 3JYMA 3KAHA 1JMQA 2M2AA 4MSPA 1C9HA 2YSIA 4JFKA 1NSGA 1QZ2A 2D9FA 2IF4A 5DIVA 2MNTA 4G50A 2Q5AA 4DZ3A 1WMVA 2XP5A 2LKNA 4NNRA 3LE4A 1J4IA 3NTPA 2XP9A 3EY6A 1FKDA 2M8JA 2PV2A 1YW5A 3O5QA 1Q6HA 2E45A 2FAPA 1J4HA 2XPAA 4TYOA 1FKHA 4DRNA 2KGJA 2JMFA 3O5JA 4LAXA 1EG3A 4DRIA 2JZVA 2JXWA 2ZAJA 1JVWA 1FKBA 3KAGA 2M1IA 1KT0A 4TW6A 1KT1A 2PPPA 1ZCNA 3WH0A 4DROA 1FKLA 5HT1A 1FKJA 2XP4A 4DRQA 1EQ3A 4DZ2A 2F4EA 3JXVA 1W26A 1P5QA 4TX0A 5B8IC 1K9RA 2KO7A 3UI5A 1FKTA 4DRKA 1Q6IA 2DMVA 1L1PA 1FAPA 3B7XA 4JFMA 1PINA 2RE3A 2K8IA 1ROTA 1HXVA 4TNSA 3O5DA 2ZQVA 2ZQTA 4LAYA 4U85A 2DK1A 2XP3A 4ODKA 4ODLA 2PV3A 3PRDA 1U79A 4MGVA 1TCOC 4REXA 4LAVA 2FKEA 3I6CA 2VN1A 3M7NA 3LUOA 1EYMA 4QIBA 3UQIA 3O5EA 5HW7A 4FAPA 3O5MA 1D7IA 2OFNA 5HW6A 3O5FA 4BF8A 5D75A 4W9OA 5AHTA 2L2SA 2MPHA 1NMWA 5J6EA 2RUCA 1A7XA 2YSHA 2PPNA 4ODQA 2M8IA 3KABA 4JFIA 5BXJA 3O5OA 3O5IA 1FJDA 1ROUA 4JFJA 3UI6A 2KE0A 2XP8A 1Y0OA 4ODNA 1F8AB 4ODRA 3O5PA 3IKDA 2DG4A 1WR7A 4J4NA 1BKFA 4DH0A 2PBCA 2KI3A 3UQBA 4TW8A 3ODKA 1I5HW 2RSEA 3O5LA 2AWGA 2MLXA 4U86A 2UZ5A 3TCZA 2JV4A 2ZR6A 3IKGA 1FKKA 4ODOA 2YSBA 1FKIA 4DRHA 3KACA 3OOBA 2N87A 4LAWA 4W9QA 3IHZA 4O2TA 2XP6A 1J4RA 4FN2A 5HWBA 4G2PA 4DIPA 2LAJA 2MLYA 1JNTA 2RUDA 2BA1A 3UF8A 1QPLA 2ZR4A 4U84A 1D7JA 1M5YA 3CNGA 4ITZA 3CGNA 5HTGA 4E5RA 2MLZA 4R0XA 1D7HA 1PBKA 3JYJA 1R9HA 4C02B 2M08A 3KAFA 3PRBA 3KZ7A 5HW8A 1YATA 2MF9A 2RUQA 4IPXA 3NI6A 1B6CA 1NMVA 4J4OA 3MDYB 3KAIA 2KFWA 5I98A 2VCDA 2DG3A 5DITA 1JNSA 3RGCA 2KXQA 5CQ2A 2XP7A 3NRKA 1J6YA 3KCEA 1ZK6A 2RQSA 4DT4A 3H9RB 2F2DA 3RFWA 3VAWA 4IQCA 2LJ4A 2XPBA 3M85A 4GIVA 2Y78A 1Q6UA 2M3OW 2ITKA 2YSFA 5GPGA 2PPOA 4GGQA 2DK7A 2ZR5A 1O6WA 1K9QA 3L4HA 4QT2A 4W9PA 1N1AA 3IK8A 4JFLA 3TC5A 4TW7A 3CGMA 2ZQUA 1FKSA 1D6OA 2LGOA 5HKGA 1FD9A 3O5GA 3UQAA 2F21A 2MDIA 2PV1A 4JYSA 3O5RA 3TDBA 2L4JA 3KADA 1Q1CA 1EG4A 1FKFA 2KR7A 4N19A 4QT3A
chains in the Genus database with same CATH superfamily
1W9UA 1K9TA 1FKRA 1TK7A 2DG9A 2DT1A 2LPVA 1E9LA 4DRMA 2QRVA 2P4VA 2JX8A 2DT0A 4DRJA 4IQ2A 1QPFA 2DWVA 1FFRA 5DIUA 3WQWA 3GPKA 4DRPA 1ITXA 2OLHA 3EIPA 4ODMA 3WQVA 4ODPA 3UI4A 4HARA 3FAPA 4MPKA 5HWCA 4ZPWR 2RURA 2EZ5W 1BL4A 2DSZA 1FKGA 4MTVA 3W4RA 3O5KA 2YSGA 1W9VA 4MNMA 1TFVA 4NSBA 3PA7A 1F40A 3FSCA 1ZBVA 2DT2A 5HUAA 1LG2A 1OWQA 4WKHA 3ALGA 2ZQSA 2DJYA 4IT6A 5E62A 3AS3A 5JH8A 2A3BA 1T11A 1OGGA 3JYMA 1O6IA 1W1TA 3KAHA 1ZU8A 1JMQA 3ARUA 2M2AA 4MSPA 4Z2LA 3G6MA 1C9HA 2YSIA 1ZBKA 4JFKA 1NSGA 4DWSC 3ARSA 1W1YA 2EULA 1QZ2A 2D9FA 2IF4A 5DIVA 2MNTA 4G50A 2Q5AA 3CHCA 4QZVB 1WMVA 4DZ3A 1EIBA 3WIJA 2XP5A 2A3EA 2LKNA 1WNOA 4NNRA 4WK9A 1LL4A 3LE4A 1J4IA 3NTPA 2XP9A 3EY6A 1FKDA 2M8JA 2PV2A 1YW5A 3O5QA 1Q6HA 4WIWA 2E45A 2FAPA 1J4HA 2XPAA 4S3KA 4TYOA 2AOSA 4Q22A 1FKHA 4DRNA 2KGJA 3BMBA 3G6LA 2JMFA 1D2KA 1NWUA 4P8UA 3O5JA 4LAXA 1EG3A 4DRIA 2JZVA 2JXWA 2ZAJA 1JVWA 2G41A 1FKBA 1HJVA 4PTMA 3KAGA 2B5UB 4P8VA 3WD3A 2M1IA 3RMEA 1KT0A 2DPEA 3PQHA 4TW6A 1CTNA 1LG1A 1KT1A 2PPPA 1ZCNA 2O92A 4WKAA 3WH0A 4DROA 1GOIA 1FKLA 5HT1A 4S3JA 1FKJA 5GQBA 2XP4A 1SYTA 4DRQA 1EQ3A 1E6RA 4DZ2A 2F4EA 3JXVA 1W26A 4A0UA 5DEZA 4ZPVR 1P5QA 4TX0A 5E66A 5B8IC 4MAVA 1K9RA 2KO7A 3UI5A 1FKTA 4DRKA 2YBTA 1EDQA 1XRVA 1Q6IA 2DMVA 1L1PA 1FAPA 3B7XA 4JFMA 3B9EA 5E5WA 1VF8A 1PINA 5E65A 2RE3A 3MQGA 2K8IA 4L3NA 1E15A 1ROTA 1HXVA 4TNSA 1IX5A 3OA5A 4MNJA 3O5DA 2ZQVA 2ZQTA 4LAYA 4U85A 2DSUA 4WKFA 4AY1A 3ARPA 2DK1A 2XP3A 4ODKA 2YBUA 4ODLA 1NWTA 2PV3A 2WAEA 1WAWA 3GU0A 3PRDA 1U79A 3ALFA 1HJWA 1TR8A 4MGVA 1TCOC 4REXA 1H0GA 1XHGA 4LAVA 3B8SA 4MNKA 3ARTA 4Z2HA 3MCBA 4P8XA 2FKEA 1EHNA 3MCBB 1FLCA 3I6CA 3FY1A 2VN1A 3M7NA 2DT3A 3LUOA 1EYMA 4QIBA 3UQIA 3O5EA 5HW7A 4FAPA 1NWSA 3O5MA 1D7IA 2A3AA 2OFNA 3BXWA 3AS2A 3FS8A 1X6NA 1HKIA 3B9DA 5HW6A 3O5FA 4BF8A 4W9OA 5D75A 2L2SA 5AHTA 1ZL1A 2MPHA 1NMWA 5J6EA 4DWSA 2RUCA 1A7XA 2YSHA 4DWSB 2PPNA 4ODQA 2M8IA 1ZBWA 3KABA 4JFIA 5BXJA 3O5OA 1HKKA 3O5IA 4Z2JA 1E44A 2ETNA 1ROUA 1FJDA 4JFJA 3UI6A 2KE0A 1W1PA 2XP8A 1OGBA 1Y0OA 2WK2A 4ODNA 5DF0A 4Z2GA 1F8AB 1GUVA 4ODRA 3O5PA 4ZS6A 3IKDA 2DG4A 2A3CA 1WR7A 4XAKA 4J4NA 1BKFA 3WD0A 4DH0A 3CHEA 2PBCA 4MNLA 3WKZA 4A0TA 3AS1A 2KI3A 3UQBA 4TW8A 3ODKA 5U47A 1I5HW 2RSEA 3O5LA 2AWGA 1JNDA 4KQZA 2MLXA 1E6NA 4U86A 1HJXA 2B31A 2UZ5A 3TCZA 2JV4A 2ZR6A 3IKGA 4WJXA 3WD2A 1FKKA 3RM9A 4ODOA 2YSBA 4P8WA 1GRJA 1FKIA 3WL1A 4DRHA 3KACA 3WL0A 3OOBA 2N87A 2G8ZA 4LAWA 1RD6A 4W9QA 2O9OA 3IHZA 4O2TA 2XP6A 1J4RA 4FN2A 5HWBA 4G2PA 3CHDA 4DIPA 2LAJA 3LKXA 2Y8NB 2MLYA 1UR8A 3LKXB 3FXYA 1JNTA 1NWRA 2RUDA 2BA1A 4DWSD 3UF8A 1QPLA 2ZR4A 4U84A 1D7JA 1M5YA 4Q7NA 3CNGA 4ITZA 4GLXA 3CGNA 1LJYA 5HTGA 4L72B 1WB0A 1ZBCA 4E5RA 2MLZA 4R0XA 4Z2KA 1D7HA 4HBEA 5DO2A 3PRAA 4URIA 1PBKA 3JYJA 1R9HA 3AQUA 4C02B 1X6LA 2M08A 3KAFA 3PRBA 3MQHA 3CHFA 3KZ7A 5HW8A 1YATA 2MF9A 2RUQA 1LQ0A 3ARXA 4IPXA 2YAJB 3NI6A 4Z2IA 1B6CA 2ESCA 1NMVA 4J4OA 3MDYB 3GTYX 3KAIA 2KFWA 5I98A 4HBOA 2VCDA 1UR9A 2F23A 2DG3A 1ZB5A 5DITA 1JNSA 4KR0B 3RGCA 1JNEA 3ARYA 2KXQA 5CQ2A 3QOKA 2XP7A 3NRKA 4LGXA 3KCEA 4R5EA 1ZK6A 1J6YA 2RQSA 2DSVA 4DT4A 3H9RB 2DSWA 3RM4A 3CH9A 2FDMA 2WM0A 2IUZA 1RP5A 2F2DA 3CZ8A 3RFWA 3VAWA 4NZCA 4IQCA 4ZPTR 1SR0A 3FSBA 2LJ4A 2XPBA 3M85A 4GIVA 2Y78A 3ARWA 1Q6UA 2M3OW 2ITKA 2YSFA 1HKMA 5GPGA 2PPOA 4GGQA 2DK7A 2ZR5A 2QF8A 2WLYA 3WD1A 3ARVA 3B9AA 1HKJA 2PI6A 1O6WA 1K9QA 5E64A 4UDMA 3L4HA 4QT2A 4W9PA 4W5UA 1N1AA 1JCHB 1LL7A 1E6PA 3IK8A 3ARRA 5HBFA 3PR9A 3RM8A 1GPFA 4JFLA 3WD4A 4ML4A 3ARZA 1E6ZA 5GPRA 3TC5A 4TW7A 4IT4A 1W9PA 3CGMA 3AROA 2ZQUA 1FKSA 1D6OA 1W1VA 1FFQA 2LGOA 5HKGA 1FD9A 3O5GA 3UQAA 2F21A 1KFWA 2PN0A 1LL6A 1NH6A 2MDIA 2PV1A 4JYSA 2WLZA 3ARQA 3TDBA 3O5RA 2L4JA 2WADA 3KADA 1Q1CA 3AS0A 1EG4A 1FKFA 2KR7A 4N19A 2OWOA 1H0IA 4QT3A
chains in the Genus database with same CATH topology
1W9UA 1K9TA 1FKRA 1TK7A 2DG9A 2DT1A 2LPVA 1E9LA 4DRMA 2QRVA 4DRJA 2JX8A 2DT0A 4IQ2A 1QPFA 2DWVA 1FFRA 5DIUA 3WQWA 3GPKA 4DRPA 1ITXA 2OLHA 4ODMA 3WQVA 4ODPA 3UI4A 4HARA 3FAPA 4MPKA 5HWCA 4ZPWR 2RURA 2EZ5W 1BL4A 2DSZA 1FKGA 4MTVA 3W4RA 3O5KA 2YSGA 1W9VA 4MNMA 1TFVA 4NSBA 3PA7A 1F40A 3FSCA 1ZBVA 2DT2A 5HUAA 1LG2A 1OWQA 4WKHA 3ALGA 2ZQSA 2DJYA 4IT6A 5E62A 3AS3A 5JH8A 2A3BA 1T11A 1OGGA 3JYMA 1O6IA 1W1TA 3KAHA 1ZU8A 1JMQA 3ARUA 2M2AA 4MSPA 4Z2LA 3G6MA 1C9HA 2YSIA 1ZBKA 4JFKA 1NSGA 4DWSC 3ARSA 1W1YA 1QZ2A 2D9FA 2IF4A 5DIVA 2MNTA 4G50A 2Q5AA 3CHCA 4QZVB 1WMVA 4DZ3A 1EIBA 3WIJA 2XP5A 2A3EA 2LKNA 1WNOA 4NNRA 4WK9A 1LL4A 3LE4A 1J4IA 3NTPA 2XP9A 3EY6A 1FKDA 2M8JA 2PV2A 1YW5A 3O5QA 1Q6HA 4WIWA 2E45A 2FAPA 1J4HA 2XPAA 4S3KA 4TYOA 2AOSA 4Q22A 1FKHA 4DRNA 2KGJA 3G6LA 2JMFA 1D2KA 1NWUA 4P8UA 3O5JA 4LAXA 1EG3A 4DRIA 2JZVA 2JXWA 2ZAJA 1JVWA 2G41A 1FKBA 1HJVA 4PTMA 3KAGA 4P8VA 3WD3A 2M1IA 3RMEA 1KT0A 2DPEA 3PQHA 4TW6A 1CTNA 1LG1A 1KT1A 2PPPA 1ZCNA 2O92A 4WKAA 3WH0A 4DROA 1GOIA 1FKLA 5HT1A 4S3JA 1FKJA 5GQBA 2XP4A 1SYTA 4DRQA 1EQ3A 1E6RA 4DZ2A 2F4EA 3JXVA 1W26A 4A0UA 5DEZA 4ZPVR 1P5QA 4TX0A 5E66A 5B8IC 4MAVA 1K9RA 2KO7A 3UI5A 1FKTA 4DRKA 2YBTA 1EDQA 1XRVA 1Q6IA 2DMVA 1L1PA 1FAPA 3B7XA 4JFMA 3B9EA 5E5WA 1VF8A 1PINA 5E65A 2RE3A 3MQGA 2K8IA 4L3NA 1E15A 1ROTA 1HXVA 4TNSA 1IX5A 3OA5A 4MNJA 3O5DA 2ZQVA 2ZQTA 4LAYA 4U85A 2DSUA 4WKFA 4AY1A 3ARPA 2DK1A 2XP3A 4ODKA 2YBUA 4ODLA 1NWTA 2PV3A 2WAEA 1WAWA 3PRDA 1U79A 3ALFA 1HJWA 1TR8A 4MGVA 1TCOC 4REXA 1H0GA 1XHGA 4LAVA 3B8SA 4MNKA 3ARTA 4Z2HA 3MCBA 4P8XA 2FKEA 1EHNA 3MCBB 1FLCA 3I6CA 3FY1A 2VN1A 3M7NA 2DT3A 3LUOA 1EYMA 4QIBA 3UQIA 3O5EA 5HW7A 4FAPA 1NWSA 3O5MA 1D7IA 2A3AA 2OFNA 3BXWA 3AS2A 3FS8A 1X6NA 1HKIA 3B9DA 5HW6A 3O5FA 4BF8A 4W9OA 5D75A 2L2SA 5AHTA 1ZL1A 2MPHA 1NMWA 5J6EA 4DWSA 2RUCA 1A7XA 2YSHA 4DWSB 2PPNA 4ODQA 2M8IA 1ZBWA 3KABA 4JFIA 5BXJA 3O5OA 1HKKA 3O5IA 4Z2JA 1FJDA 1ROUA 4JFJA 3UI6A 2KE0A 1W1PA 2XP8A 1OGBA 1Y0OA 2WK2A 4ODNA 5DF0A 4Z2GA 1F8AB 1GUVA 4ODRA 3O5PA 4ZS6A 3IKDA 2DG4A 2A3CA 1WR7A 4XAKA 4J4NA 1BKFA 3WD0A 4DH0A 3CHEA 2PBCA 4MNLA 3WKZA 4A0TA 3AS1A 2KI3A 3UQBA 4TW8A 3ODKA 5U47A 1I5HW 2RSEA 3O5LA 2AWGA 1JNDA 4KQZA 2MLXA 1E6NA 4U86A 1HJXA 2B31A 2UZ5A 3TCZA 2JV4A 2ZR6A 3IKGA 4WJXA 3WD2A 1FKKA 3RM9A 4ODOA 2YSBA 4P8WA 1FKIA 3WL1A 4DRHA 3KACA 3WL0A 3OOBA 2N87A 2G8ZA 4LAWA 1RD6A 4W9QA 2O9OA 3IHZA 4O2TA 2XP6A 1J4RA 4FN2A 5HWBA 4G2PA 3CHDA 4DIPA 2LAJA 3LKXA 2Y8NB 2MLYA 1UR8A 3LKXB 3FXYA 1JNTA 1NWRA 2RUDA 2BA1A 4DWSD 3UF8A 1QPLA 2ZR4A 4U84A 1D7JA 1M5YA 4Q7NA 3CNGA 4ITZA 4GLXA 3CGNA 1LJYA 5HTGA 4L72B 1WB0A 1ZBCA 4E5RA 2MLZA 4R0XA 4Z2KA 1D7HA 4HBEA 5DO2A 3PRAA 4URIA 1PBKA 3JYJA 1R9HA 3AQUA 4C02B 1X6LA 2M08A 3KAFA 3PRBA 3MQHA 3CHFA 3KZ7A 5HW8A 1YATA 2MF9A 2RUQA 1LQ0A 3ARXA 4IPXA 2YAJB 3NI6A 4Z2IA 1B6CA 2ESCA 1NMVA 4J4OA 3MDYB 3KAIA 2KFWA 5I98A 4HBOA 2VCDA 1UR9A 2DG3A 1ZB5A 5DITA 1JNSA 4KR0B 3RGCA 1JNEA 3ARYA 2KXQA 5CQ2A 3QOKA 2XP7A 3NRKA 4LGXA 3KCEA 4R5EA 1ZK6A 1J6YA 2RQSA 2DSVA 4DT4A 3H9RB 2DSWA 3RM4A 3CH9A 2FDMA 2WM0A 2IUZA 1RP5A 2F2DA 3CZ8A 3RFWA 3VAWA 4NZCA 4IQCA 4ZPTR 1SR0A 3FSBA 2LJ4A 2XPBA 3M85A 4GIVA 2Y78A 3ARWA 1Q6UA 2M3OW 2ITKA 2YSFA 1HKMA 5GPGA 2PPOA 4GGQA 2DK7A 2ZR5A 2QF8A 2WLYA 3WD1A 3ARVA 3B9AA 1HKJA 2PI6A 1O6WA 1K9QA 5E64A 3L4HA 4QT2A 4W9PA 4W5UA 1N1AA 1LL7A 1E6PA 3IK8A 3ARRA 5HBFA 3PR9A 3RM8A 1GPFA 4JFLA 3WD4A 4ML4A 3ARZA 1E6ZA 5GPRA 3TC5A 4TW7A 4IT4A 1W9PA 3CGMA 3AROA 2ZQUA 1FKSA 1D6OA 1W1VA 1FFQA 2LGOA 5HKGA 1FD9A 3O5GA 3UQAA 2F21A 1KFWA 1LL6A 1NH6A 2MDIA 2PV1A 4JYSA 2WLZA 3ARQA 3TDBA 3O5RA 2L4JA 2WADA 3KADA 1Q1CA 3AS0A 1EG4A 1FKFA 2KR7A 4N19A 2OWOA 1H0IA 4QT3A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1FKR A;  1TK7 A;  2DG9 A;  2LPV A;  4DRM A;  4DRJ A;  2JX8 A;  4IQ2 A;  1QPF A;  2DWV A;  5DIU A;  3GPK A;  4DRP A;  4ODM A;  4ODP A;  3UI4 A;  3FAP A;  5HWC A;  2RUR A;  2EZ5 W;  1BL4 A;  1FKG A;  3O5K A;  2YSG A;  3PA7 A;  1F40 A;  5HUA A;  2ZQS A;  2DJY A;  1T11 A;  3JYM A;  3KAH A;  1JMQ A;  2M2A A;  4MSP A;  1C9H A;  2YSI A;  4JFK A;  1NSG A;  1QZ2 A;  2D9F A;  2IF4 A;  5DIV A;  2MNT A;  4G50 A;  2Q5A A;  4DZ3 A;  1WMV A;  2XP5 A;  2LKN A;  4NNR A;  3LE4 A;  1J4I A;  3NTP A;  2XP9 A;  3EY6 A;  1FKD A;  2M8J A;  2PV2 A;  1YW5 A;  3O5Q A;  1Q6H A;  2E45 A;  2FAP A;  1J4H A;  2XPA A;  4TYO A;  1FKH A;  4DRN A;  2KGJ A;  2JMF A;  3O5J A;  4LAX A;  1EG3 A;  4DRI A;  2JZV A;  2JXW A;  2ZAJ A;  1JVW A;  1FKB A;  3KAG A;  2M1I A;  1KT0 A;  4TW6 A;  1KT1 A;  2PPP A;  1ZCN A;  3WH0 A;  4DRO A;  1FKL A;  5HT1 A;  1FKJ A;  2XP4 A;  4DRQ A;  1EQ3 A;  4DZ2 A;  2F4E A;  3JXV A;  1W26 A;  1P5Q A;  4TX0 A;  5B8I C;  1K9R A;  2KO7 A;  3UI5 A;  1FKT A;  4DRK A;  1Q6I A;  2DMV A;  1L1P A;  1FAP A;  3B7X A;  4JFM A;  1PIN A;  2RE3 A;  2K8I A;  1ROT A;  1HXV A;  4TNS A;  3O5D A;  2ZQV A;  2ZQT A;  4LAY A;  4U85 A;  2DK1 A;  2XP3 A;  4ODK A;  4ODL A;  2PV3 A;  3PRD A;  1U79 A;  4MGV A;  1TCO C;  4REX A;  4LAV A;  2FKE A;  3I6C A;  2VN1 A;  3M7N A;  3LUO A;  1EYM A;  4QIB A;  3UQI A;  3O5E A;  5HW7 A;  4FAP A;  3O5M A;  1D7I A;  2OFN A;  5HW6 A;  3O5F A;  4BF8 A;  5D75 A;  4W9O A;  5AHT A;  2L2S A;  2MPH A;  1NMW A;  5J6E A;  2RUC A;  1A7X A;  2YSH A;  2PPN A;  4ODQ A;  2M8I A;  3KAB A;  4JFI A;  5BXJ A;  3O5O A;  3O5I A;  1FJD A;  1ROU A;  4JFJ A;  3UI6 A;  2KE0 A;  2XP8 A;  1Y0O A;  4ODN A;  1F8A B;  4ODR A;  3O5P A;  3IKD A;  2DG4 A;  1WR7 A;  4J4N A;  1BKF A;  4DH0 A;  2PBC A;  2KI3 A;  3UQB A;  4TW8 A;  3ODK A;  1I5H W;  2RSE A;  3O5L A;  2AWG A;  2MLX A;  4U86 A;  2UZ5 A;  3TCZ A;  2JV4 A;  2ZR6 A;  3IKG A;  1FKK A;  4ODO A;  2YSB A;  1FKI A;  4DRH A;  3KAC A;  3OOB A;  2N87 A;  4LAW A;  4W9Q A;  3IHZ A;  4O2T A;  2XP6 A;  1J4R A;  4FN2 A;  5HWB A;  4G2P A;  4DIP A;  2LAJ A;  2MLY A;  1JNT A;  2RUD A;  2BA1 A;  3UF8 A;  1QPL A;  2ZR4 A;  4U84 A;  1D7J A;  1M5Y A;  3CNG A;  4ITZ A;  3CGN A;  5HTG A;  4E5R A;  2MLZ A;  4R0X A;  1D7H A;  1PBK A;  3JYJ A;  1R9H A;  4C02 B;  2M08 A;  3KAF A;  3PRB A;  3KZ7 A;  5HW8 A;  1YAT A;  2MF9 A;  2RUQ A;  4IPX A;  3NI6 A;  1B6C A;  1NMV A;  4J4O A;  3MDY B;  3KAI A;  2KFW A;  5I98 A;  2VCD A;  2DG3 A;  5DIT A;  1JNS A;  3RGC A;  2KXQ A;  5CQ2 A;  2XP7 A;  3NRK A;  1J6Y A;  3KCE A;  1ZK6 A;  2RQS A;  4DT4 A;  3H9R B;  2F2D A;  3RFW A;  3VAW A;  4IQC A;  2LJ4 A;  2XPB A;  3M85 A;  4GIV A;  2Y78 A;  1Q6U A;  2M3O W;  2ITK A;  2YSF A;  5GPG A;  2PPO A;  4GGQ A;  2DK7 A;  2ZR5 A;  1O6W A;  1K9Q A;  3L4H A;  4QT2 A;  4W9P A;  1N1A A;  3IK8 A;  4JFL A;  3TC5 A;  4TW7 A;  3CGM A;  2ZQU A;  1FKS A;  1D6O A;  2LGO A;  5HKG A;  1FD9 A;  3O5G A;  3UQA A;  2F21 A;  2MDI A;  2PV1 A;  4JYS A;  3O5R A;  3TDB A;  2L4J A;  3KAD A;  1Q1C A;  1EG4 A;  1FKF A;  2KR7 A;  4N19 A;  4QT3 A; 
#chains in the Genus database with same CATH topology
 1W9U A;  1K9T A;  1FKR A;  1TK7 A;  2DG9 A;  2DT1 A;  2LPV A;  1E9L A;  4DRM A;  2QRV A;  2P4V A;  2JX8 A;  2DT0 A;  4DRJ A;  4IQ2 A;  1QPF A;  2DWV A;  1FFR A;  5DIU A;  3WQW A;  3GPK A;  4DRP A;  1ITX A;  2OLH A;  3EIP A;  4ODM A;  3WQV A;  4ODP A;  3UI4 A;  4HAR A;  3FAP A;  4MPK A;  5HWC A;  4ZPW R;  2RUR A;  2EZ5 W;  1BL4 A;  2DSZ A;  1FKG A;  4MTV A;  3W4R A;  3O5K A;  2YSG A;  1W9V A;  4MNM A;  1TFV A;  4NSB A;  3PA7 A;  1F40 A;  3FSC A;  1ZBV A;  2DT2 A;  5HUA A;  1LG2 A;  1OWQ A;  4WKH A;  3ALG A;  2ZQS A;  2DJY A;  4IT6 A;  5E62 A;  3AS3 A;  5JH8 A;  2A3B A;  1T11 A;  1OGG A;  3JYM A;  1O6I A;  1W1T A;  3KAH A;  1ZU8 A;  1JMQ A;  3ARU A;  2M2A A;  4MSP A;  4Z2L A;  3G6M A;  1C9H A;  2YSI A;  1ZBK A;  4JFK A;  1NSG A;  4DWS C;  3ARS A;  1W1Y A;  2EUL A;  1QZ2 A;  2D9F A;  2IF4 A;  5DIV A;  2MNT A;  4G50 A;  2Q5A A;  3CHC A;  4QZV B;  1WMV A;  4DZ3 A;  1EIB A;  3WIJ A;  2XP5 A;  2A3E A;  2LKN A;  1WNO A;  4NNR A;  4WK9 A;  1LL4 A;  3LE4 A;  1J4I A;  3NTP A;  2XP9 A;  3EY6 A;  1FKD A;  2M8J A;  2PV2 A;  1YW5 A;  3O5Q A;  1Q6H A;  4WIW A;  2E45 A;  2FAP A;  1J4H A;  2XPA A;  4S3K A;  4TYO A;  2AOS A;  4Q22 A;  1FKH A;  4DRN A;  2KGJ A;  3BMB A;  3G6L A;  2JMF A;  1D2K A;  1NWU A;  4P8U A;  3O5J A;  4LAX A;  1EG3 A;  4DRI A;  2JZV A;  2JXW A;  2ZAJ A;  1JVW A;  2G41 A;  1FKB A;  1HJV A;  4PTM A;  3KAG A;  2B5U B;  4P8V A;  3WD3 A;  2M1I A;  3RME A;  1KT0 A;  2DPE A;  3PQH A;  4TW6 A;  1CTN A;  1LG1 A;  1KT1 A;  2PPP A;  1ZCN A;  2O92 A;  4WKA A;  3WH0 A;  4DRO A;  1GOI A;  1FKL A;  5HT1 A;  4S3J A;  1FKJ A;  5GQB A;  2XP4 A;  1SYT A;  4DRQ A;  1EQ3 A;  1E6R A;  4DZ2 A;  2F4E A;  3JXV A;  1W26 A;  4A0U A;  5DEZ A;  4ZPV R;  1P5Q A;  4TX0 A;  5E66 A;  5B8I C;  4MAV A;  1K9R A;  2KO7 A;  3UI5 A;  1FKT A;  4DRK A;  2YBT A;  1EDQ A;  1XRV A;  1Q6I A;  2DMV A;  1L1P A;  1FAP A;  3B7X A;  4JFM A;  3B9E A;  5E5W A;  1VF8 A;  1PIN A;  5E65 A;  2RE3 A;  3MQG A;  2K8I A;  4L3N A;  1E15 A;  1ROT A;  1HXV A;  4TNS A;  1IX5 A;  3OA5 A;  4MNJ A;  3O5D A;  2ZQV A;  2ZQT A;  4LAY A;  4U85 A;  2DSU A;  4WKF A;  4AY1 A;  3ARP A;  2DK1 A;  2XP3 A;  4ODK A;  2YBU A;  4ODL A;  1NWT A;  2PV3 A;  2WAE A;  1WAW A;  3GU0 A;  3PRD A;  1U79 A;  3ALF A;  1HJW A;  1TR8 A;  4MGV A;  1TCO C;  4REX A;  1H0G A;  1XHG A;  4LAV A;  3B8S A;  4MNK A;  3ART A;  4Z2H A;  3MCB A;  4P8X A;  2FKE A;  1EHN A;  3MCB B;  1FLC A;  3I6C A;  3FY1 A;  2VN1 A;  3M7N A;  2DT3 A;  3LUO A;  1EYM A;  4QIB A;  3UQI A;  3O5E A;  5HW7 A;  4FAP A;  1NWS A;  3O5M A;  1D7I A;  2A3A A;  2OFN A;  3BXW A;  3AS2 A;  3FS8 A;  1X6N A;  1HKI A;  3B9D A;  5HW6 A;  3O5F A;  4BF8 A;  4W9O A;  5D75 A;  2L2S A;  5AHT A;  1ZL1 A;  2MPH A;  1NMW A;  5J6E A;  4DWS A;  2RUC A;  1A7X A;  2YSH A;  4DWS B;  2PPN A;  4ODQ A;  2M8I A;  1ZBW A;  3KAB A;  4JFI A;  5BXJ A;  3O5O A;  1HKK A;  3O5I A;  4Z2J A;  1E44 A;  2ETN A;  1ROU A;  1FJD A;  4JFJ A;  3UI6 A;  2KE0 A;  1W1P A;  2XP8 A;  1OGB A;  1Y0O A;  2WK2 A;  4ODN A;  5DF0 A;  4Z2G A;  1F8A B;  1GUV A;  4ODR A;  3O5P A;  4ZS6 A;  3IKD A;  2DG4 A;  2A3C A;  1WR7 A;  4XAK A;  4J4N A;  1BKF A;  3WD0 A;  4DH0 A;  3CHE A;  2PBC A;  4MNL A;  3WKZ A;  4A0T A;  3AS1 A;  2KI3 A;  3UQB A;  4TW8 A;  3ODK A;  5U47 A;  1I5H W;  2RSE A;  3O5L A;  2AWG A;  1JND A;  4KQZ A;  2MLX A;  1E6N A;  4U86 A;  1HJX A;  2B31 A;  2UZ5 A;  3TCZ A;  2JV4 A;  2ZR6 A;  3IKG A;  4WJX A;  3WD2 A;  1FKK A;  3RM9 A;  4ODO A;  2YSB A;  4P8W A;  1GRJ A;  1FKI A;  3WL1 A;  4DRH A;  3KAC A;  3WL0 A;  3OOB A;  2N87 A;  2G8Z A;  4LAW A;  1RD6 A;  4W9Q A;  2O9O A;  3IHZ A;  4O2T A;  2XP6 A;  1J4R A;  4FN2 A;  5HWB A;  4G2P A;  3CHD A;  4DIP A;  2LAJ A;  3LKX A;  2Y8N B;  2MLY A;  1UR8 A;  3LKX B;  3FXY A;  1JNT A;  1NWR A;  2RUD A;  2BA1 A;  4DWS D;  3UF8 A;  1QPL A;  2ZR4 A;  4U84 A;  1D7J A;  1M5Y A;  4Q7N A;  3CNG A;  4ITZ A;  4GLX A;  3CGN A;  1LJY A;  5HTG A;  4L72 B;  1WB0 A;  1ZBC A;  4E5R A;  2MLZ A;  4R0X A;  4Z2K A;  1D7H A;  4HBE A;  5DO2 A;  3PRA A;  4URI A;  1PBK A;  3JYJ A;  1R9H A;  3AQU A;  4C02 B;  1X6L A;  2M08 A;  3KAF A;  3PRB A;  3MQH A;  3CHF A;  3KZ7 A;  5HW8 A;  1YAT A;  2MF9 A;  2RUQ A;  1LQ0 A;  3ARX A;  4IPX A;  2YAJ B;  3NI6 A;  4Z2I A;  1B6C A;  2ESC A;  1NMV A;  4J4O A;  3MDY B;  3GTY X;  3KAI A;  2KFW A;  5I98 A;  4HBO A;  2VCD A;  1UR9 A;  2F23 A;  2DG3 A;  1ZB5 A;  5DIT A;  1JNS A;  4KR0 B;  3RGC A;  1JNE A;  3ARY A;  2KXQ A;  5CQ2 A;  3QOK A;  2XP7 A;  3NRK A;  4LGX A;  3KCE A;  4R5E A;  1ZK6 A;  1J6Y A;  2RQS A;  2DSV A;  4DT4 A;  3H9R B;  2DSW A;  3RM4 A;  3CH9 A;  2FDM A;  2WM0 A;  2IUZ A;  1RP5 A;  2F2D A;  3CZ8 A;  3RFW A;  3VAW A;  4NZC A;  4IQC A;  4ZPT R;  1SR0 A;  3FSB A;  2LJ4 A;  2XPB A;  3M85 A;  4GIV A;  2Y78 A;  3ARW A;  1Q6U A;  2M3O W;  2ITK A;  2YSF A;  1HKM A;  5GPG A;  2PPO A;  4GGQ A;  2DK7 A;  2ZR5 A;  2QF8 A;  2WLY A;  3WD1 A;  3ARV A;  3B9A A;  1HKJ A;  2PI6 A;  1O6W A;  1K9Q A;  5E64 A;  4UDM A;  3L4H A;  4QT2 A;  4W9P A;  4W5U A;  1N1A A;  1JCH B;  1LL7 A;  1E6P A;  3IK8 A;  3ARR A;  5HBF A;  3PR9 A;  3RM8 A;  1GPF A;  4JFL A;  3WD4 A;  4ML4 A;  3ARZ A;  1E6Z A;  5GPR A;  3TC5 A;  4TW7 A;  4IT4 A;  1W9P A;  3CGM A;  3ARO A;  2ZQU A;  1FKS A;  1D6O A;  1W1V A;  1FFQ A;  2LGO A;  5HKG A;  1FD9 A;  3O5G A;  3UQA A;  2F21 A;  1KFW A;  2PN0 A;  1LL6 A;  1NH6 A;  2MDI A;  2PV1 A;  4JYS A;  2WLZ A;  3ARQ A;  3TDB A;  3O5R A;  2L4J A;  2WAD A;  3KAD A;  1Q1C A;  3AS0 A;  1EG4 A;  1FKF A;  2KR7 A;  4N19 A;  2OWO A;  1H0I A;  4QT3 A; 
#chains in the Genus database with same CATH homology
 1W9U A;  1K9T A;  1FKR A;  1TK7 A;  2DG9 A;  2DT1 A;  2LPV A;  1E9L A;  4DRM A;  2QRV A;  4DRJ A;  2JX8 A;  2DT0 A;  4IQ2 A;  1QPF A;  2DWV A;  1FFR A;  5DIU A;  3WQW A;  3GPK A;  4DRP A;  1ITX A;  2OLH A;  4ODM A;  3WQV A;  4ODP A;  3UI4 A;  4HAR A;  3FAP A;  4MPK A;  5HWC A;  4ZPW R;  2RUR A;  2EZ5 W;  1BL4 A;  2DSZ A;  1FKG A;  4MTV A;  3W4R A;  3O5K A;  2YSG A;  1W9V A;  4MNM A;  1TFV A;  4NSB A;  3PA7 A;  1F40 A;  3FSC A;  1ZBV A;  2DT2 A;  5HUA A;  1LG2 A;  1OWQ A;  4WKH A;  3ALG A;  2ZQS A;  2DJY A;  4IT6 A;  5E62 A;  3AS3 A;  5JH8 A;  2A3B A;  1T11 A;  1OGG A;  3JYM A;  1O6I A;  1W1T A;  3KAH A;  1ZU8 A;  1JMQ A;  3ARU A;  2M2A A;  4MSP A;  4Z2L A;  3G6M A;  1C9H A;  2YSI A;  1ZBK A;  4JFK A;  1NSG A;  4DWS C;  3ARS A;  1W1Y A;  1QZ2 A;  2D9F A;  2IF4 A;  5DIV A;  2MNT A;  4G50 A;  2Q5A A;  3CHC A;  4QZV B;  1WMV A;  4DZ3 A;  1EIB A;  3WIJ A;  2XP5 A;  2A3E A;  2LKN A;  1WNO A;  4NNR A;  4WK9 A;  1LL4 A;  3LE4 A;  1J4I A;  3NTP A;  2XP9 A;  3EY6 A;  1FKD A;  2M8J A;  2PV2 A;  1YW5 A;  3O5Q A;  1Q6H A;  4WIW A;  2E45 A;  2FAP A;  1J4H A;  2XPA A;  4S3K A;  4TYO A;  2AOS A;  4Q22 A;  1FKH A;  4DRN A;  2KGJ A;  3G6L A;  2JMF A;  1D2K A;  1NWU A;  4P8U A;  3O5J A;  4LAX A;  1EG3 A;  4DRI A;  2JZV A;  2JXW A;  2ZAJ A;  1JVW A;  2G41 A;  1FKB A;  1HJV A;  4PTM A;  3KAG A;  4P8V A;  3WD3 A;  2M1I A;  3RME A;  1KT0 A;  2DPE A;  3PQH A;  4TW6 A;  1CTN A;  1LG1 A;  1KT1 A;  2PPP A;  1ZCN A;  2O92 A;  4WKA A;  3WH0 A;  4DRO A;  1GOI A;  1FKL A;  5HT1 A;  4S3J A;  1FKJ A;  5GQB A;  2XP4 A;  1SYT A;  4DRQ A;  1EQ3 A;  1E6R A;  4DZ2 A;  2F4E A;  3JXV A;  1W26 A;  4A0U A;  5DEZ A;  4ZPV R;  1P5Q A;  4TX0 A;  5E66 A;  5B8I C;  4MAV A;  1K9R A;  2KO7 A;  3UI5 A;  1FKT A;  4DRK A;  2YBT A;  1EDQ A;  1XRV A;  1Q6I A;  2DMV A;  1L1P A;  1FAP A;  3B7X A;  4JFM A;  3B9E A;  5E5W A;  1VF8 A;  1PIN A;  5E65 A;  2RE3 A;  3MQG A;  2K8I A;  4L3N A;  1E15 A;  1ROT A;  1HXV A;  4TNS A;  1IX5 A;  3OA5 A;  4MNJ A;  3O5D A;  2ZQV A;  2ZQT A;  4LAY A;  4U85 A;  2DSU A;  4WKF A;  4AY1 A;  3ARP A;  2DK1 A;  2XP3 A;  4ODK A;  2YBU A;  4ODL A;  1NWT A;  2PV3 A;  2WAE A;  1WAW A;  3PRD A;  1U79 A;  3ALF A;  1HJW A;  1TR8 A;  4MGV A;  1TCO C;  4REX A;  1H0G A;  1XHG A;  4LAV A;  3B8S A;  4MNK A;  3ART A;  4Z2H A;  3MCB A;  4P8X A;  2FKE A;  1EHN A;  3MCB B;  1FLC A;  3I6C A;  3FY1 A;  2VN1 A;  3M7N A;  2DT3 A;  3LUO A;  1EYM A;  4QIB A;  3UQI A;  3O5E A;  5HW7 A;  4FAP A;  1NWS A;  3O5M A;  1D7I A;  2A3A A;  2OFN A;  3BXW A;  3AS2 A;  3FS8 A;  1X6N A;  1HKI A;  3B9D A;  5HW6 A;  3O5F A;  4BF8 A;  4W9O A;  5D75 A;  2L2S A;  5AHT A;  1ZL1 A;  2MPH A;  1NMW A;  5J6E A;  4DWS A;  2RUC A;  1A7X A;  2YSH A;  4DWS B;  2PPN A;  4ODQ A;  2M8I A;  1ZBW A;  3KAB A;  4JFI A;  5BXJ A;  3O5O A;  1HKK A;  3O5I A;  4Z2J A;  1FJD A;  1ROU A;  4JFJ A;  3UI6 A;  2KE0 A;  1W1P A;  2XP8 A;  1OGB A;  1Y0O A;  2WK2 A;  4ODN A;  5DF0 A;  4Z2G A;  1F8A B;  1GUV A;  4ODR A;  3O5P A;  4ZS6 A;  3IKD A;  2DG4 A;  2A3C A;  1WR7 A;  4XAK A;  4J4N A;  1BKF A;  3WD0 A;  4DH0 A;  3CHE A;  2PBC A;  4MNL A;  3WKZ A;  4A0T A;  3AS1 A;  2KI3 A;  3UQB A;  4TW8 A;  3ODK A;  5U47 A;  1I5H W;  2RSE A;  3O5L A;  2AWG A;  1JND A;  4KQZ A;  2MLX A;  1E6N A;  4U86 A;  1HJX A;  2B31 A;  2UZ5 A;  3TCZ A;  2JV4 A;  2ZR6 A;  3IKG A;  4WJX A;  3WD2 A;  1FKK A;  3RM9 A;  4ODO A;  2YSB A;  4P8W A;  1FKI A;  3WL1 A;  4DRH A;  3KAC A;  3WL0 A;  3OOB A;  2N87 A;  2G8Z A;  4LAW A;  1RD6 A;  4W9Q A;  2O9O A;  3IHZ A;  4O2T A;  2XP6 A;  1J4R A;  4FN2 A;  5HWB A;  4G2P A;  3CHD A;  4DIP A;  2LAJ A;  3LKX A;  2Y8N B;  2MLY A;  1UR8 A;  3LKX B;  3FXY A;  1JNT A;  1NWR A;  2RUD A;  2BA1 A;  4DWS D;  3UF8 A;  1QPL A;  2ZR4 A;  4U84 A;  1D7J A;  1M5Y A;  4Q7N A;  3CNG A;  4ITZ A;  4GLX A;  3CGN A;  1LJY A;  5HTG A;  4L72 B;  1WB0 A;  1ZBC A;  4E5R A;  2MLZ A;  4R0X A;  4Z2K A;  1D7H A;  4HBE A;  5DO2 A;  3PRA A;  4URI A;  1PBK A;  3JYJ A;  1R9H A;  3AQU A;  4C02 B;  1X6L A;  2M08 A;  3KAF A;  3PRB A;  3MQH A;  3CHF A;  3KZ7 A;  5HW8 A;  1YAT A;  2MF9 A;  2RUQ A;  1LQ0 A;  3ARX A;  4IPX A;  2YAJ B;  3NI6 A;  4Z2I A;  1B6C A;  2ESC A;  1NMV A;  4J4O A;  3MDY B;  3KAI A;  2KFW A;  5I98 A;  4HBO A;  2VCD A;  1UR9 A;  2DG3 A;  1ZB5 A;  5DIT A;  1JNS A;  4KR0 B;  3RGC A;  1JNE A;  3ARY A;  2KXQ A;  5CQ2 A;  3QOK A;  2XP7 A;  3NRK A;  4LGX A;  3KCE A;  4R5E A;  1ZK6 A;  1J6Y A;  2RQS A;  2DSV A;  4DT4 A;  3H9R B;  2DSW A;  3RM4 A;  3CH9 A;  2FDM A;  2WM0 A;  2IUZ A;  1RP5 A;  2F2D A;  3CZ8 A;  3RFW A;  3VAW A;  4NZC A;  4IQC A;  4ZPT R;  1SR0 A;  3FSB A;  2LJ4 A;  2XPB A;  3M85 A;  4GIV A;  2Y78 A;  3ARW A;  1Q6U A;  2M3O W;  2ITK A;  2YSF A;  1HKM A;  5GPG A;  2PPO A;  4GGQ A;  2DK7 A;  2ZR5 A;  2QF8 A;  2WLY A;  3WD1 A;  3ARV A;  3B9A A;  1HKJ A;  2PI6 A;  1O6W A;  1K9Q A;  5E64 A;  3L4H A;  4QT2 A;  4W9P A;  4W5U A;  1N1A A;  1LL7 A;  1E6P A;  3IK8 A;  3ARR A;  5HBF A;  3PR9 A;  3RM8 A;  1GPF A;  4JFL A;  3WD4 A;  4ML4 A;  3ARZ A;  1E6Z A;  5GPR A;  3TC5 A;  4TW7 A;  4IT4 A;  1W9P A;  3CGM A;  3ARO A;  2ZQU A;  1FKS A;  1D6O A;  1W1V A;  1FFQ A;  2LGO A;  5HKG A;  1FD9 A;  3O5G A;  3UQA A;  2F21 A;  1KFW A;  1LL6 A;  1NH6 A;  2MDI A;  2PV1 A;  4JYS A;  2WLZ A;  3ARQ A;  3TDB A;  3O5R A;  2L4J A;  2WAD A;  3KAD A;  1Q1C A;  3AS0 A;  1EG4 A;  1FKF A;  2KR7 A;  4N19 A;  2OWO A;  1H0I A;  4QT3 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...