3TCZA

Human pin1 bound to cis peptidomimetic inhibitor
Total Genus 45
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
45
sequence length
158
structure length
146
Chain Sequence
KLPPGWEKAMSRSSGRVYYFNHITNASQWERPSEPARVRCSHLLVKHSQSRRPSSWRQEKITRTKEEALELINGYIQKIKSGEEDFESLASQFSDCSSAKARGDLGAFSRGQMQKPFEDASFALRTGEMSGPVFTDSGIHIILRTE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural and Kinetic Analysis of Prolyl-isomerization/Phosphorylation Cross-Talk in the CTD Code.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Isomerase/inhibitor
molecule keywords Peptidyl-prolyl cis-trans isomerase NIMA-interacting 1
total genus 45
structure length 146
sequence length 158
ec nomenclature ec 5.2.1.8: Peptidylprolyl isomerase.
pdb deposition date 2011-08-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00397 WW WW domain
A PF00639 Rotamase PPIC-type PPIASE domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.20.70.10 Mainly Beta Single Sheet Ubiquitin Ligase Nedd4; Chain: W; Ubiquitin Ligase Nedd4; Chain: W; 3tczA01
3.10.50.40 Alpha Beta Roll Chitinase A; domain 3 Chitinase A; domain 3 3tczA02
1Q6IA 3UQIA 1O6WA 2M08A 3O5FA 2YSIA 3EY6A 3RFWA 4LAWA 1T11A 3O5MA 2LGOA 4U85A 1FKGA 2DG3A 5B8IC 1K9RA 5AHTA 3KCEA 3LE4A 2KFWA 1FKHA 2RUCA 1FKRA 2ZR6A 1TCOC 3O5LA 3O5GA 4U86A 2RURA 2JXWA 3LUOA 1FAPA 1QZ2A 2Y78A 3UI6A 1NMWA 4DZ2A 1FKIA 1M5YA 1FKSA 3O5KA 2EZ5W 4U84A 1NSGA 4GIVA 2RQSA 4TYOA 2ITKA 3O5DA 2XP6A 2YSFA 4DRHA 3IKDA 3OOBA 4J4NA 4DRIA 4FAPA 4DH0A 1K9QA 4MGVA 2XP9A 2PV3A 4R0XA 4TW7A 3TC5A 4BF8A 2PPNA 4TW6A 3IKGA 3O5IA 2KI3A 1FJDA 3PA7A 4JFLA 3UF8A 3RGCA 4DRNA 2ZQUA 3IK8A 3L4HA 3GPKA 4LAYA 3NTPA 1FKFA 3PRBA 5D75A 2M8JA 1I5HW 4DT4A 1WR7A 5CQ2A 1U79A 1FKBA 1JNTA 2PBCA 1EG4A 1W26A 2DG9A 4IPXA 4QT3A 4DZ3A 3NRKA 1FKTA 3M7NA 2XP8A 1KT0A 3KACA 2DJYA 4QIBA 3CGMA 4JFKA 4JFIA 4QT2A 4LAXA 2MF9A 1Y0OA 2LJ4A 3KABA 2MPHA 2YSHA 4ODKA 4ODOA 2M3OW 5BXJA 2VCDA 4NNRA 2OFNA 4LAVA 2ZR5A 5HW6A 3KAIA 2XP7A 1ROTA 4GGQA 2LPVA 4JFMA 2FKEA 4ODNA 3MDYB 5DIVA 2AWGA 1ROUA 3CGNA 4JFJA 1FD9A 4E5RA 2MNTA 2M8IA 3UQAA 2L4JA 2DG4A 1C9HA 1J4IA 1KT1A 2MLZA 1Q6HA 3NI6A 1NMVA 3CNGA 2RUDA 4ODQA 4DRMA 4N19A 2PPPA 3O5QA 1EYMA 2DMVA 1ZCNA 1JVWA 2RE3A 4TNSA 4DRJA 1JNSA 4G50A 3O5JA 3FAPA 4DROA 4MSPA 1JMQA 5HUAA 3TCZA 2XP3A 2PV1A 3I6CA 2E45A 2F2DA 4ODPA 1PINA 4DRKA 2XPBA 2VN1A 5HKGA 2ZQSA 5HT1A 1J6YA 1Q1CA 3PRDA 4FN2A 4W9PA 1YATA 2UZ5A 4ITZA 3KAHA 2DWVA 2DK1A 2LAJA 2XPAA 1D7IA 4W9QA 2PV2A 2F21A 2Q5AA 2YSGA 1QPLA 5HTGA 3UI5A 1EQ3A 2BA1A 4DRPA 1F8AB 4JYSA 1BKFA 4DRQA 3B7XA 3M85A 4ODMA 3KAGA 4TW8A 1R9HA 2XP5A 2MLXA 2F4EA 1HXVA 2M1IA 4ODLA 4IQCA 2PPOA 1FKLA 4DIPA 1BL4A 2KGJA 2MDIA 5DIUA 2JMFA 2K8IA 3UI4A 3JYJA 2M2AA 2RUQA 3O5PA 3KAFA 1D6OA 4W9OA 1J4RA 3UQBA 2ZR4A 2ZQVA 3JYMA 3O5OA 5DITA 5J6EA 1WMVA 1FKKA 5GPGA 1N1AA 1D7JA 1L1PA 1ZK6A 2ZQTA 4O2TA 3KADA 1EG3A 1QPFA 1FKJA 1Q6UA 2L2SA 1D7HA 4J4OA 1TK7A 3O5EA 3JXVA 4C02B 4TX0A 1F40A 2RSEA 4REXA 3WH0A 2DK7A 2JV4A 2JZVA 1P5QA 2XP4A 2FAPA 2YSBA 2JX8A 2MLYA 1A7XA 4G2PA 2KO7A 5HW8A 4ODRA 5I98A 2ZAJA 4IQ2A 2KE0A 5HWBA 5HWCA 1J4HA 2KR7A 3KZ7A 1B6CA 3H9RB 2KXQA 3TDBA 1FKDA 2IF4A 2LKNA 3O5RA 3VAWA 5HW7A 2N87A 3ODKA 2D9FA 1YW5A 3IHZA 1PBKA
chains in the Genus database with same CATH superfamily
1GOIA 3UQIA 3EY6A 4LAWA 1T11A 2KFWA 2RUCA 2O9OA 2ZR6A 5E66A 1NWTA 4U86A 2JXWA 3PQHA 2DSVA 1FKIA 4GIVA 4Q7NA 2EZ5W 2XP6A 1E6NA 3WQWA 1NWUA 3BXWA 2ETNA 1JCHB 4GLXA 1ZBKA 1FJDA 2IUZA 3ARQA 3IK8A 1LL7A 3QOKA 4DT4A 5CQ2A 2PBCA 1W26A 4QT3A 1E15A 1FKTA 4DH0A 1Y0OA 2LJ4A 3KABA 1FFRA 2M3OW 2WM0A 4LAVA 5HW6A 4JFMA 2FKEA 5DIVA 2YBTA 3CGNA 2WLYA 4DWSA 1W9UA 4DRMA 4N19A 3ARRA 3WD2A 3O5QA 1ZCNA 4TNSA 4Z2JA 1JNSA 4G50A 4A0UA 4L3NA 4DROA 4KR0B 2PV1A 4S3KA 2XPBA 2VN1A 5GQBA 1Q1CA 4W9PA 1YATA 3MCBA 2UZ5A 4QZVB 3G6MA 2FDMA 4W9QA 1GUVA 2F21A 4ML4A 1F8AB 3MQHA 4P8XA 1HXVA 4WK9A 1WB0A 1VF8A 4DWSC 2A3CA 5DIUA 1NH6A 2M2AA 2RUQA 3KAFA 1WAWA 5DITA 1FKKA 1NWSA 1FKJA 2L2SA 4J4OA 1TK7A 3G6LA 2JZVA 2XP4A 2YSBA 2JX8A 5HW8A 3AS0A 4IQ2A 2KE0A 5HWBA 5HWCA 1B6CA 3VAWA 5HW7A 3O5RA 4R5EA 1PBKA 4W5UA 1Q6IA 1O6WA 1JNEA 2M08A 2PN0A 3ARVA 3O5MA 2LGOA 1FKGA 2DG3A 1K9RA 2EULA 3WD3A 1FKHA 3O5LA 3O5GA 3WD4A 3LUOA 1FAPA 1FKSA 2Y8NB 1NSGA 3O5DA 1LG1A 3IKDA 4J4NA 4P8VA 1K9QA 1W1VA 2XP9A 2PV3A 4ZPWR 3IKGA 3FSCA 2KI3A 1TFVA 4JFLA 3UF8A 1HJWA 3L4HA 1UR9A 1FKFA 5D75A 4Z2KA 1D2KA 1U79A 1FKBA 1JNTA 1L1PA 2DG9A 3NRKA 1KT0A 3KACA 4JFKA 4QT2A 4Z2LA 5I98A 1GPFA 4JFIA 4ODKA 2DT0A 2YSHA 1E44A 2VCDA 1OGGA 1X6NA 1LL6A 3AROA 4JFJA 1FD9A 4E5RA 2MNTA 2M8IA 5U47A 2P4VA 2DG4A 3FXYA 3NI6A 4URIA 1Q6HA 1NMVA 1WNOA 4ODQA 5DEZA 1ZU8A 1EYMA 2DMVA 2DSWA 2RE3A 3O5JA 3MQGA 4DRKA 2XP3A 5HKGA 1W1TA 2F2DA 3RM8A 1J6YA 5HT1A 4MTVA 4MNMA 2DT2A 4ITZA 2DWVA 2DK1A 2XPAA 1LL4A 2YAJB 2PV2A 3ARUA 4Z2IA 2YSGA 3UI5A 1EQ3A 2BA1A 4DRPA 1BKFA 4DRQA 2YBUA 3B7XA 3BMBA 1XHGA 2XP5A 1OWQA 4ODLA 1FKLA 2KGJA 2B31A 3JYMA 5J6EA 2OWOA 3LKXB 1D7JA 5HBFA 4WKFA 3CHFA 1Q6UA 4IT6A 4C02B 4Q22A 1F40A 2RSEA 3WH0A 2QF8A 2DK7A 4MNKA 1P5QA 2FAPA 3B9AA 1A7XA 4G2PA 3WL1A 3PR9A 4DWSB 2ZAJA 3LKXA 2KR7A 3H9RB 2IF4A 4Z2GA 1KFWA 3AS3A 1FFQA 2ESCA 1GRJA 3RFWA 1IX5A 4U85A 5B8IC 5E62A 5AHTA 3KCEA 1FKRA 1TCOC 3WD1A 3ARZA 1K9TA 3FS8A 1NMWA 4HBOA 3UI6A 4DZ2A 1M5YA 4WKAA 4U84A 2ITKA 4DRHA 2YSFA 3B9EA 2WLZA 1LJYA 4MGVA 4R0XA 2G8ZA 3TC5A 5DF0A 4WJXA 4TW6A 2A3BA 3PA7A 1W9VA 3RGCA 4DRNA 2ZQUA 3GPKA 3PRBA 5E64A 2O92A 1EG4A 5GPRA 3CGMA 4QIBA 4LAXA 4NNRA 2ZR5A 2DT1A 4GGQA 2LPVA 3GTYX 3MDYB 3ARPA 4HARA 1ROUA 4WKHA 3CZ8A 5DO2A 3UQAA 1HKIA 1SYTA 1SR0A 1C9HA 1J4IA 1KT1A 2MLZA 3CNGA 4PTMA 2RUDA 4P8WA 2PPPA 1ZBWA 4DRJA 4WIWA 4ZPVR 3WD0A 5HUAA 1JMQA 3ALFA 3TCZA 3I6CA 3WIJA 2E45A 1W1PA 1TR8A 4MNJA 4FN2A 1E9LA 1D7IA 2Q5AA 1EIBA 1E6RA 1W1YA 2AOSA 4ODMA 1R9HA 1ZBVA 2F4EA 4MNLA 3CHDA 4IQCA 2PPOA 2MDIA 2JMFA 3UI4A 1LQ0A 3O5PA 1D6OA 1LG2A 2ZQVA 3O5OA 3ARSA 1NWRA 1WMVA 3B8SA 2WAEA 1N1AA 2QRVA 1ZK6A 4O2TA 4Z2HA 1RD6A 2F23A 1EG3A 3W4RA 1D7HA 3AS1A 3JXVA 2A3AA 4TX0A 1ITXA 2JV4A 3MCBB 4DWSD 2MLYA 1HJVA 1HKKA 1FLCA 3ARYA 4IT4A 1J4HA 1UR8A 3KZ7A 2KXQA 1FKDA 2LKNA 2N87A 3ODKA 1YW5A 3AS2A 3O5FA 2YSIA 4NZCA 4ZPTR 3LE4A 2WK2A 4S3JA 4AY1A 1JNDA 1EDQA 2RURA 1ZBCA 3WQVA 1QZ2A 2Y78A 3AQUA 4TYOA 3O5KA 2WADA 2RQSA 3OOBA 3PRAA 4DRIA 4FAPA 3EIPA 4TW7A 1HJXA 4BF8A 2PPNA 3GU0A 3O5IA 3ARWA 4MPKA 5JH8A 3ARXA 4LAYA 3NTPA 2M8JA 1I5HW 1WR7A 4DZ3A 4IPXA 3M7NA 2XP8A 1EHNA 2DJYA 3IHZA 5HTGA 2MF9A 1H0GA 2MPHA 4LGXA 1RP5A 4ODOA 5BXJA 3ARTA 2OLHA 2OFNA 3OA5A 1X6LA 3KAIA 2XP7A 1ROTA 4L72B 4ODNA 2AWGA 2DT3A 4UDMA 3CH9A 1E6ZA 2L4JA 3ALGA 5E5WA 4XAKA 2DPEA 3CHEA 1JVWA 4A0TA 3RM4A 4ZS6A 2B5UB 3RMEA 1CTNA 1H0IA 3FAPA 4MSPA 4ODPA 3FSBA 1PINA 2DSUA 5E65A 2ZQSA 3FY1A 3PRDA 3RM9A 2A3EA 3KAHA 2LAJA 1OGBA 1QPLA 4JYSA 4TW8A 3M85A 3KAGA 3CHCA 2MLXA 3WL0A 3WKZA 1O6IA 1ZB5A 2M1IA 4DIPA 1BL4A 4NSBA 2K8IA 3JYJA 2G41A 1XRVA 4HBEA 4W9OA 1J4RA 1W9PA 4P8UA 2ZR4A 3UQBA 2DSZA 5GPGA 4MAVA 2ZQTA 3KADA 1QPFA 1E6PA 3O5EA 4REXA 1HKMA 2KO7A 3B9DA 2PI6A 4ODRA 4KQZA 3TDBA 2D9FA 1HKJA 1ZL1A
chains in the Genus database with same CATH topology
1GOIA 3UQIA 3EY6A 4LAWA 1T11A 2KFWA 2RUCA 2O9OA 2ZR6A 5E66A 1NWTA 4U86A 2JXWA 3PQHA 2DSVA 1FKIA 4GIVA 4Q7NA 2EZ5W 2XP6A 1E6NA 3WQWA 1NWUA 3BXWA 4GLXA 1ZBKA 1FJDA 2IUZA 3ARQA 3IK8A 1LL7A 3QOKA 4DT4A 5CQ2A 2PBCA 1W26A 4QT3A 1E15A 1FKTA 4DH0A 1Y0OA 2LJ4A 3KABA 1FFRA 2M3OW 2WM0A 4LAVA 5HW6A 4JFMA 2FKEA 5DIVA 2YBTA 3CGNA 2WLYA 4DWSA 1W9UA 4DRMA 4N19A 3ARRA 3WD2A 3O5QA 1ZCNA 4TNSA 4Z2JA 1JNSA 4G50A 4A0UA 4L3NA 4DROA 4KR0B 2PV1A 4S3KA 2XPBA 2VN1A 5GQBA 1Q1CA 4W9PA 1YATA 3MCBA 2UZ5A 4QZVB 3G6MA 2FDMA 4W9QA 1GUVA 2F21A 4ML4A 1F8AB 3MQHA 4P8XA 1HXVA 4WK9A 1WB0A 1VF8A 4DWSC 2A3CA 5DIUA 1NH6A 2M2AA 2RUQA 3KAFA 1WAWA 5DITA 1FKKA 1NWSA 1FKJA 2L2SA 4J4OA 1TK7A 3G6LA 2JZVA 2XP4A 2YSBA 2JX8A 5HW8A 3AS0A 4IQ2A 2KE0A 5HWBA 5HWCA 1B6CA 3VAWA 5HW7A 3O5RA 4R5EA 1PBKA 4W5UA 1Q6IA 1O6WA 1JNEA 2M08A 3ARVA 3O5MA 2LGOA 1FKGA 2DG3A 1K9RA 3WD3A 1FKHA 3O5LA 3O5GA 3WD4A 3LUOA 1FAPA 1FKSA 2Y8NB 1NSGA 3O5DA 1LG1A 3IKDA 4J4NA 4P8VA 1K9QA 1W1VA 2XP9A 2PV3A 4ZPWR 3IKGA 3FSCA 2KI3A 1TFVA 4JFLA 3UF8A 1HJWA 3L4HA 1UR9A 1FKFA 5D75A 4Z2KA 1D2KA 1U79A 1FKBA 1JNTA 1L1PA 2DG9A 3NRKA 1KT0A 3KACA 4JFKA 4QT2A 4Z2LA 5I98A 1GPFA 4JFIA 4ODKA 2DT0A 2YSHA 2VCDA 1OGGA 1X6NA 1LL6A 3AROA 4JFJA 1FD9A 4E5RA 2MNTA 2M8IA 5U47A 2DG4A 3FXYA 3NI6A 4URIA 1Q6HA 1NMVA 1WNOA 4ODQA 5DEZA 1ZU8A 1EYMA 2DMVA 2DSWA 2RE3A 3O5JA 3MQGA 4DRKA 2XP3A 5HKGA 1W1TA 2F2DA 3RM8A 1J6YA 5HT1A 4MTVA 4MNMA 2DT2A 4ITZA 2DWVA 2DK1A 2XPAA 1LL4A 2YAJB 2PV2A 3ARUA 4Z2IA 2YSGA 3UI5A 1EQ3A 2BA1A 4DRPA 1BKFA 4DRQA 2YBUA 3B7XA 1XHGA 2XP5A 1OWQA 4ODLA 1FKLA 2KGJA 2B31A 3JYMA 5J6EA 2OWOA 3LKXB 1D7JA 5HBFA 4WKFA 3CHFA 1Q6UA 4IT6A 4C02B 4Q22A 1F40A 2RSEA 3WH0A 2QF8A 2DK7A 4MNKA 1P5QA 2FAPA 3B9AA 1A7XA 4G2PA 3WL1A 3PR9A 4DWSB 2ZAJA 3LKXA 2KR7A 3H9RB 2IF4A 4Z2GA 1KFWA 3AS3A 1FFQA 2ESCA 3RFWA 1IX5A 4U85A 5B8IC 5E62A 5AHTA 3KCEA 1FKRA 1TCOC 3WD1A 3ARZA 1K9TA 3FS8A 1NMWA 4HBOA 3UI6A 4DZ2A 1M5YA 4WKAA 4U84A 2ITKA 4DRHA 2YSFA 3B9EA 2WLZA 1LJYA 4MGVA 4R0XA 2G8ZA 3TC5A 5DF0A 4WJXA 4TW6A 2A3BA 3PA7A 1W9VA 3RGCA 4DRNA 2ZQUA 3GPKA 3PRBA 5E64A 2O92A 1EG4A 5GPRA 3CGMA 4QIBA 4LAXA 4NNRA 2ZR5A 2DT1A 4GGQA 2LPVA 3MDYB 3ARPA 4HARA 1ROUA 4WKHA 3CZ8A 5DO2A 3UQAA 1HKIA 1SYTA 1SR0A 1C9HA 1J4IA 1KT1A 2MLZA 3CNGA 4PTMA 2RUDA 4P8WA 2PPPA 1ZBWA 4DRJA 4WIWA 4ZPVR 3WD0A 5HUAA 1JMQA 3ALFA 3TCZA 3I6CA 3WIJA 2E45A 1W1PA 1TR8A 4MNJA 4FN2A 1E9LA 1D7IA 2Q5AA 1EIBA 1E6RA 1W1YA 2AOSA 4ODMA 1R9HA 1ZBVA 2F4EA 4MNLA 3CHDA 4IQCA 2PPOA 2MDIA 2JMFA 3UI4A 1LQ0A 3O5PA 1D6OA 1LG2A 2ZQVA 3O5OA 3ARSA 1NWRA 1WMVA 3B8SA 2WAEA 1N1AA 2QRVA 1ZK6A 4O2TA 4Z2HA 1RD6A 1EG3A 3W4RA 1D7HA 3AS1A 3JXVA 2A3AA 4TX0A 1ITXA 2JV4A 3MCBB 4DWSD 2MLYA 1HJVA 1HKKA 1FLCA 3ARYA 4IT4A 1J4HA 1UR8A 3KZ7A 2KXQA 1FKDA 2LKNA 2N87A 3ODKA 1YW5A 3AS2A 3O5FA 2YSIA 4NZCA 4ZPTR 3LE4A 2WK2A 4S3JA 4AY1A 1JNDA 1EDQA 2RURA 1ZBCA 3WQVA 1QZ2A 2Y78A 3AQUA 4TYOA 3O5KA 2WADA 2RQSA 3OOBA 3PRAA 4DRIA 4FAPA 4TW7A 1HJXA 4BF8A 2PPNA 3O5IA 3ARWA 4MPKA 5JH8A 3ARXA 4LAYA 3NTPA 2M8JA 1I5HW 1WR7A 4DZ3A 4IPXA 3M7NA 2XP8A 1EHNA 2DJYA 3IHZA 5HTGA 2MF9A 1H0GA 2MPHA 4LGXA 1RP5A 4ODOA 5BXJA 3ARTA 2OLHA 2OFNA 3OA5A 1X6LA 3KAIA 2XP7A 1ROTA 4L72B 4ODNA 2AWGA 2DT3A 3CH9A 1E6ZA 2L4JA 3ALGA 5E5WA 4XAKA 2DPEA 3CHEA 1JVWA 4A0TA 3RM4A 4ZS6A 3RMEA 1CTNA 1H0IA 3FAPA 4MSPA 4ODPA 3FSBA 1PINA 2DSUA 5E65A 2ZQSA 3FY1A 3PRDA 3RM9A 2A3EA 3KAHA 2LAJA 1OGBA 1QPLA 4JYSA 4TW8A 3M85A 3KAGA 3CHCA 2MLXA 3WL0A 3WKZA 1O6IA 1ZB5A 2M1IA 4DIPA 1BL4A 4NSBA 2K8IA 3JYJA 2G41A 1XRVA 4HBEA 4W9OA 1J4RA 1W9PA 4P8UA 2ZR4A 3UQBA 2DSZA 5GPGA 4MAVA 2ZQTA 3KADA 1QPFA 1E6PA 3O5EA 4REXA 1HKMA 2KO7A 3B9DA 2PI6A 4ODRA 4KQZA 3TDBA 2D9FA 1HKJA 1ZL1A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1Q6I A;  3UQI A;  1O6W A;  2M08 A;  3O5F A;  2YSI A;  3EY6 A;  3RFW A;  4LAW A;  1T11 A;  3O5M A;  2LGO A;  4U85 A;  1FKG A;  2DG3 A;  5B8I C;  1K9R A;  5AHT A;  3KCE A;  3LE4 A;  2KFW A;  1FKH A;  2RUC A;  1FKR A;  2ZR6 A;  1TCO C;  3O5L A;  3O5G A;  4U86 A;  2RUR A;  2JXW A;  3LUO A;  1FAP A;  1QZ2 A;  2Y78 A;  3UI6 A;  1NMW A;  4DZ2 A;  1FKI A;  1M5Y A;  1FKS A;  3O5K A;  2EZ5 W;  4U84 A;  1NSG A;  4GIV A;  2RQS A;  4TYO A;  2ITK A;  3O5D A;  2XP6 A;  2YSF A;  4DRH A;  3IKD A;  3OOB A;  4J4N A;  4DRI A;  4FAP A;  4DH0 A;  1K9Q A;  4MGV A;  2XP9 A;  2PV3 A;  4R0X A;  4TW7 A;  3TC5 A;  4BF8 A;  2PPN A;  4TW6 A;  3IKG A;  3O5I A;  2KI3 A;  1FJD A;  3PA7 A;  4JFL A;  3UF8 A;  3RGC A;  4DRN A;  2ZQU A;  3IK8 A;  3L4H A;  3GPK A;  4LAY A;  3NTP A;  1FKF A;  3PRB A;  5D75 A;  2M8J A;  1I5H W;  4DT4 A;  1WR7 A;  5CQ2 A;  1U79 A;  1FKB A;  1JNT A;  2PBC A;  1EG4 A;  1W26 A;  2DG9 A;  4IPX A;  4QT3 A;  4DZ3 A;  3NRK A;  1FKT A;  3M7N A;  2XP8 A;  1KT0 A;  3KAC A;  2DJY A;  4QIB A;  3CGM A;  4JFK A;  4JFI A;  4QT2 A;  4LAX A;  2MF9 A;  1Y0O A;  2LJ4 A;  3KAB A;  2MPH A;  2YSH A;  4ODK A;  4ODO A;  2M3O W;  5BXJ A;  2VCD A;  4NNR A;  2OFN A;  4LAV A;  2ZR5 A;  5HW6 A;  3KAI A;  2XP7 A;  1ROT A;  4GGQ A;  2LPV A;  4JFM A;  2FKE A;  4ODN A;  3MDY B;  5DIV A;  2AWG A;  1ROU A;  3CGN A;  4JFJ A;  1FD9 A;  4E5R A;  2MNT A;  2M8I A;  3UQA A;  2L4J A;  2DG4 A;  1C9H A;  1J4I A;  1KT1 A;  2MLZ A;  1Q6H A;  3NI6 A;  1NMV A;  3CNG A;  2RUD A;  4ODQ A;  4DRM A;  4N19 A;  2PPP A;  3O5Q A;  1EYM A;  2DMV A;  1ZCN A;  1JVW A;  2RE3 A;  4TNS A;  4DRJ A;  1JNS A;  4G50 A;  3O5J A;  3FAP A;  4DRO A;  4MSP A;  1JMQ A;  5HUA A;  3TCZ A;  2XP3 A;  2PV1 A;  3I6C A;  2E45 A;  2F2D A;  4ODP A;  1PIN A;  4DRK A;  2XPB A;  2VN1 A;  5HKG A;  2ZQS A;  5HT1 A;  1J6Y A;  1Q1C A;  3PRD A;  4FN2 A;  4W9P A;  1YAT A;  2UZ5 A;  4ITZ A;  3KAH A;  2DWV A;  2DK1 A;  2LAJ A;  2XPA A;  1D7I A;  4W9Q A;  2PV2 A;  2F21 A;  2Q5A A;  2YSG A;  1QPL A;  5HTG A;  3UI5 A;  1EQ3 A;  2BA1 A;  4DRP A;  1F8A B;  4JYS A;  1BKF A;  4DRQ A;  3B7X A;  3M85 A;  4ODM A;  3KAG A;  4TW8 A;  1R9H A;  2XP5 A;  2MLX A;  2F4E A;  1HXV A;  2M1I A;  4ODL A;  4IQC A;  2PPO A;  1FKL A;  4DIP A;  1BL4 A;  2KGJ A;  2MDI A;  5DIU A;  2JMF A;  2K8I A;  3UI4 A;  3JYJ A;  2M2A A;  2RUQ A;  3O5P A;  3KAF A;  1D6O A;  4W9O A;  1J4R A;  3UQB A;  2ZR4 A;  2ZQV A;  3JYM A;  3O5O A;  5DIT A;  5J6E A;  1WMV A;  1FKK A;  5GPG A;  1N1A A;  1D7J A;  1L1P A;  1ZK6 A;  2ZQT A;  4O2T A;  3KAD A;  1EG3 A;  1QPF A;  1FKJ A;  1Q6U A;  2L2S A;  1D7H A;  4J4O A;  1TK7 A;  3O5E A;  3JXV A;  4C02 B;  4TX0 A;  1F40 A;  2RSE A;  4REX A;  3WH0 A;  2DK7 A;  2JV4 A;  2JZV A;  1P5Q A;  2XP4 A;  2FAP A;  2YSB A;  2JX8 A;  2MLY A;  1A7X A;  4G2P A;  2KO7 A;  5HW8 A;  4ODR A;  5I98 A;  2ZAJ A;  4IQ2 A;  2KE0 A;  5HWB A;  5HWC A;  1J4H A;  2KR7 A;  3KZ7 A;  1B6C A;  3H9R B;  2KXQ A;  3TDB A;  1FKD A;  2IF4 A;  2LKN A;  3O5R A;  3VAW A;  5HW7 A;  2N87 A;  3ODK A;  2D9F A;  1YW5 A;  3IHZ A;  1PBK A; 
#chains in the Genus database with same CATH topology
 1GOI A;  3UQI A;  3EY6 A;  4LAW A;  1T11 A;  2KFW A;  2RUC A;  2O9O A;  2ZR6 A;  5E66 A;  1NWT A;  4U86 A;  2JXW A;  3PQH A;  2DSV A;  1FKI A;  4GIV A;  4Q7N A;  2EZ5 W;  2XP6 A;  1E6N A;  3WQW A;  1NWU A;  3BXW A;  2ETN A;  1JCH B;  4GLX A;  1ZBK A;  1FJD A;  2IUZ A;  3ARQ A;  3IK8 A;  1LL7 A;  3QOK A;  4DT4 A;  5CQ2 A;  2PBC A;  1W26 A;  4QT3 A;  1E15 A;  1FKT A;  4DH0 A;  1Y0O A;  2LJ4 A;  3KAB A;  1FFR A;  2M3O W;  2WM0 A;  4LAV A;  5HW6 A;  4JFM A;  2FKE A;  5DIV A;  2YBT A;  3CGN A;  2WLY A;  4DWS A;  1W9U A;  4DRM A;  4N19 A;  3ARR A;  3WD2 A;  3O5Q A;  1ZCN A;  4TNS A;  4Z2J A;  1JNS A;  4G50 A;  4A0U A;  4L3N A;  4DRO A;  4KR0 B;  2PV1 A;  4S3K A;  2XPB A;  2VN1 A;  5GQB A;  1Q1C A;  4W9P A;  1YAT A;  3MCB A;  2UZ5 A;  4QZV B;  3G6M A;  2FDM A;  4W9Q A;  1GUV A;  2F21 A;  4ML4 A;  1F8A B;  3MQH A;  4P8X A;  1HXV A;  4WK9 A;  1WB0 A;  1VF8 A;  4DWS C;  2A3C A;  5DIU A;  1NH6 A;  2M2A A;  2RUQ A;  3KAF A;  1WAW A;  5DIT A;  1FKK A;  1NWS A;  1FKJ A;  2L2S A;  4J4O A;  1TK7 A;  3G6L A;  2JZV A;  2XP4 A;  2YSB A;  2JX8 A;  5HW8 A;  3AS0 A;  4IQ2 A;  2KE0 A;  5HWB A;  5HWC A;  1B6C A;  3VAW A;  5HW7 A;  3O5R A;  4R5E A;  1PBK A;  4W5U A;  1Q6I A;  1O6W A;  1JNE A;  2M08 A;  2PN0 A;  3ARV A;  3O5M A;  2LGO A;  1FKG A;  2DG3 A;  1K9R A;  2EUL A;  3WD3 A;  1FKH A;  3O5L A;  3O5G A;  3WD4 A;  3LUO A;  1FAP A;  1FKS A;  2Y8N B;  1NSG A;  3O5D A;  1LG1 A;  3IKD A;  4J4N A;  4P8V A;  1K9Q A;  1W1V A;  2XP9 A;  2PV3 A;  4ZPW R;  3IKG A;  3FSC A;  2KI3 A;  1TFV A;  4JFL A;  3UF8 A;  1HJW A;  3L4H A;  1UR9 A;  1FKF A;  5D75 A;  4Z2K A;  1D2K A;  1U79 A;  1FKB A;  1JNT A;  1L1P A;  2DG9 A;  3NRK A;  1KT0 A;  3KAC A;  4JFK A;  4QT2 A;  4Z2L A;  5I98 A;  1GPF A;  4JFI A;  4ODK A;  2DT0 A;  2YSH A;  1E44 A;  2VCD A;  1OGG A;  1X6N A;  1LL6 A;  3ARO A;  4JFJ A;  1FD9 A;  4E5R A;  2MNT A;  2M8I A;  5U47 A;  2P4V A;  2DG4 A;  3FXY A;  3NI6 A;  4URI A;  1Q6H A;  1NMV A;  1WNO A;  4ODQ A;  5DEZ A;  1ZU8 A;  1EYM A;  2DMV A;  2DSW A;  2RE3 A;  3O5J A;  3MQG A;  4DRK A;  2XP3 A;  5HKG A;  1W1T A;  2F2D A;  3RM8 A;  1J6Y A;  5HT1 A;  4MTV A;  4MNM A;  2DT2 A;  4ITZ A;  2DWV A;  2DK1 A;  2XPA A;  1LL4 A;  2YAJ B;  2PV2 A;  3ARU A;  4Z2I A;  2YSG A;  3UI5 A;  1EQ3 A;  2BA1 A;  4DRP A;  1BKF A;  4DRQ A;  2YBU A;  3B7X A;  3BMB A;  1XHG A;  2XP5 A;  1OWQ A;  4ODL A;  1FKL A;  2KGJ A;  2B31 A;  3JYM A;  5J6E A;  2OWO A;  3LKX B;  1D7J A;  5HBF A;  4WKF A;  3CHF A;  1Q6U A;  4IT6 A;  4C02 B;  4Q22 A;  1F40 A;  2RSE A;  3WH0 A;  2QF8 A;  2DK7 A;  4MNK A;  1P5Q A;  2FAP A;  3B9A A;  1A7X A;  4G2P A;  3WL1 A;  3PR9 A;  4DWS B;  2ZAJ A;  3LKX A;  2KR7 A;  3H9R B;  2IF4 A;  4Z2G A;  1KFW A;  3AS3 A;  1FFQ A;  2ESC A;  1GRJ A;  3RFW A;  1IX5 A;  4U85 A;  5B8I C;  5E62 A;  5AHT A;  3KCE A;  1FKR A;  1TCO C;  3WD1 A;  3ARZ A;  1K9T A;  3FS8 A;  1NMW A;  4HBO A;  3UI6 A;  4DZ2 A;  1M5Y A;  4WKA A;  4U84 A;  2ITK A;  4DRH A;  2YSF A;  3B9E A;  2WLZ A;  1LJY A;  4MGV A;  4R0X A;  2G8Z A;  3TC5 A;  5DF0 A;  4WJX A;  4TW6 A;  2A3B A;  3PA7 A;  1W9V A;  3RGC A;  4DRN A;  2ZQU A;  3GPK A;  3PRB A;  5E64 A;  2O92 A;  1EG4 A;  5GPR A;  3CGM A;  4QIB A;  4LAX A;  4NNR A;  2ZR5 A;  2DT1 A;  4GGQ A;  2LPV A;  3GTY X;  3MDY B;  3ARP A;  4HAR A;  1ROU A;  4WKH A;  3CZ8 A;  5DO2 A;  3UQA A;  1HKI A;  1SYT A;  1SR0 A;  1C9H A;  1J4I A;  1KT1 A;  2MLZ A;  3CNG A;  4PTM A;  2RUD A;  4P8W A;  2PPP A;  1ZBW A;  4DRJ A;  4WIW A;  4ZPV R;  3WD0 A;  5HUA A;  1JMQ A;  3ALF A;  3TCZ A;  3I6C A;  3WIJ A;  2E45 A;  1W1P A;  1TR8 A;  4MNJ A;  4FN2 A;  1E9L A;  1D7I A;  2Q5A A;  1EIB A;  1E6R A;  1W1Y A;  2AOS A;  4ODM A;  1R9H A;  1ZBV A;  2F4E A;  4MNL A;  3CHD A;  4IQC A;  2PPO A;  2MDI A;  2JMF A;  3UI4 A;  1LQ0 A;  3O5P A;  1D6O A;  1LG2 A;  2ZQV A;  3O5O A;  3ARS A;  1NWR A;  1WMV A;  3B8S A;  2WAE A;  1N1A A;  2QRV A;  1ZK6 A;  4O2T A;  4Z2H A;  1RD6 A;  2F23 A;  1EG3 A;  3W4R A;  1D7H A;  3AS1 A;  3JXV A;  2A3A A;  4TX0 A;  1ITX A;  2JV4 A;  3MCB B;  4DWS D;  2MLY A;  1HJV A;  1HKK A;  1FLC A;  3ARY A;  4IT4 A;  1J4H A;  1UR8 A;  3KZ7 A;  2KXQ A;  1FKD A;  2LKN A;  2N87 A;  3ODK A;  1YW5 A;  3AS2 A;  3O5F A;  2YSI A;  4NZC A;  4ZPT R;  3LE4 A;  2WK2 A;  4S3J A;  4AY1 A;  1JND A;  1EDQ A;  2RUR A;  1ZBC A;  3WQV A;  1QZ2 A;  2Y78 A;  3AQU A;  4TYO A;  3O5K A;  2WAD A;  2RQS A;  3OOB A;  3PRA A;  4DRI A;  4FAP A;  3EIP A;  4TW7 A;  1HJX A;  4BF8 A;  2PPN A;  3GU0 A;  3O5I A;  3ARW A;  4MPK A;  5JH8 A;  3ARX A;  4LAY A;  3NTP A;  2M8J A;  1I5H W;  1WR7 A;  4DZ3 A;  4IPX A;  3M7N A;  2XP8 A;  1EHN A;  2DJY A;  3IHZ A;  5HTG A;  2MF9 A;  1H0G A;  2MPH A;  4LGX A;  1RP5 A;  4ODO A;  5BXJ A;  3ART A;  2OLH A;  2OFN A;  3OA5 A;  1X6L A;  3KAI A;  2XP7 A;  1ROT A;  4L72 B;  4ODN A;  2AWG A;  2DT3 A;  4UDM A;  3CH9 A;  1E6Z A;  2L4J A;  3ALG A;  5E5W A;  4XAK A;  2DPE A;  3CHE A;  1JVW A;  4A0T A;  3RM4 A;  4ZS6 A;  2B5U B;  3RME A;  1CTN A;  1H0I A;  3FAP A;  4MSP A;  4ODP A;  3FSB A;  1PIN A;  2DSU A;  5E65 A;  2ZQS A;  3FY1 A;  3PRD A;  3RM9 A;  2A3E A;  3KAH A;  2LAJ A;  1OGB A;  1QPL A;  4JYS A;  4TW8 A;  3M85 A;  3KAG A;  3CHC A;  2MLX A;  3WL0 A;  3WKZ A;  1O6I A;  1ZB5 A;  2M1I A;  4DIP A;  1BL4 A;  4NSB A;  2K8I A;  3JYJ A;  2G41 A;  1XRV A;  4HBE A;  4W9O A;  1J4R A;  1W9P A;  4P8U A;  2ZR4 A;  3UQB A;  2DSZ A;  5GPG A;  4MAV A;  2ZQT A;  3KAD A;  1QPF A;  1E6P A;  3O5E A;  4REX A;  1HKM A;  2KO7 A;  3B9D A;  2PI6 A;  4ODR A;  4KQZ A;  3TDB A;  2D9F A;  1HKJ A;  1ZL1 A; 
#chains in the Genus database with same CATH homology
 1GOI A;  3UQI A;  3EY6 A;  4LAW A;  1T11 A;  2KFW A;  2RUC A;  2O9O A;  2ZR6 A;  5E66 A;  1NWT A;  4U86 A;  2JXW A;  3PQH A;  2DSV A;  1FKI A;  4GIV A;  4Q7N A;  2EZ5 W;  2XP6 A;  1E6N A;  3WQW A;  1NWU A;  3BXW A;  4GLX A;  1ZBK A;  1FJD A;  2IUZ A;  3ARQ A;  3IK8 A;  1LL7 A;  3QOK A;  4DT4 A;  5CQ2 A;  2PBC A;  1W26 A;  4QT3 A;  1E15 A;  1FKT A;  4DH0 A;  1Y0O A;  2LJ4 A;  3KAB A;  1FFR A;  2M3O W;  2WM0 A;  4LAV A;  5HW6 A;  4JFM A;  2FKE A;  5DIV A;  2YBT A;  3CGN A;  2WLY A;  4DWS A;  1W9U A;  4DRM A;  4N19 A;  3ARR A;  3WD2 A;  3O5Q A;  1ZCN A;  4TNS A;  4Z2J A;  1JNS A;  4G50 A;  4A0U A;  4L3N A;  4DRO A;  4KR0 B;  2PV1 A;  4S3K A;  2XPB A;  2VN1 A;  5GQB A;  1Q1C A;  4W9P A;  1YAT A;  3MCB A;  2UZ5 A;  4QZV B;  3G6M A;  2FDM A;  4W9Q A;  1GUV A;  2F21 A;  4ML4 A;  1F8A B;  3MQH A;  4P8X A;  1HXV A;  4WK9 A;  1WB0 A;  1VF8 A;  4DWS C;  2A3C A;  5DIU A;  1NH6 A;  2M2A A;  2RUQ A;  3KAF A;  1WAW A;  5DIT A;  1FKK A;  1NWS A;  1FKJ A;  2L2S A;  4J4O A;  1TK7 A;  3G6L A;  2JZV A;  2XP4 A;  2YSB A;  2JX8 A;  5HW8 A;  3AS0 A;  4IQ2 A;  2KE0 A;  5HWB A;  5HWC A;  1B6C A;  3VAW A;  5HW7 A;  3O5R A;  4R5E A;  1PBK A;  4W5U A;  1Q6I A;  1O6W A;  1JNE A;  2M08 A;  3ARV A;  3O5M A;  2LGO A;  1FKG A;  2DG3 A;  1K9R A;  3WD3 A;  1FKH A;  3O5L A;  3O5G A;  3WD4 A;  3LUO A;  1FAP A;  1FKS A;  2Y8N B;  1NSG A;  3O5D A;  1LG1 A;  3IKD A;  4J4N A;  4P8V A;  1K9Q A;  1W1V A;  2XP9 A;  2PV3 A;  4ZPW R;  3IKG A;  3FSC A;  2KI3 A;  1TFV A;  4JFL A;  3UF8 A;  1HJW A;  3L4H A;  1UR9 A;  1FKF A;  5D75 A;  4Z2K A;  1D2K A;  1U79 A;  1FKB A;  1JNT A;  1L1P A;  2DG9 A;  3NRK A;  1KT0 A;  3KAC A;  4JFK A;  4QT2 A;  4Z2L A;  5I98 A;  1GPF A;  4JFI A;  4ODK A;  2DT0 A;  2YSH A;  2VCD A;  1OGG A;  1X6N A;  1LL6 A;  3ARO A;  4JFJ A;  1FD9 A;  4E5R A;  2MNT A;  2M8I A;  5U47 A;  2DG4 A;  3FXY A;  3NI6 A;  4URI A;  1Q6H A;  1NMV A;  1WNO A;  4ODQ A;  5DEZ A;  1ZU8 A;  1EYM A;  2DMV A;  2DSW A;  2RE3 A;  3O5J A;  3MQG A;  4DRK A;  2XP3 A;  5HKG A;  1W1T A;  2F2D A;  3RM8 A;  1J6Y A;  5HT1 A;  4MTV A;  4MNM A;  2DT2 A;  4ITZ A;  2DWV A;  2DK1 A;  2XPA A;  1LL4 A;  2YAJ B;  2PV2 A;  3ARU A;  4Z2I A;  2YSG A;  3UI5 A;  1EQ3 A;  2BA1 A;  4DRP A;  1BKF A;  4DRQ A;  2YBU A;  3B7X A;  1XHG A;  2XP5 A;  1OWQ A;  4ODL A;  1FKL A;  2KGJ A;  2B31 A;  3JYM A;  5J6E A;  2OWO A;  3LKX B;  1D7J A;  5HBF A;  4WKF A;  3CHF A;  1Q6U A;  4IT6 A;  4C02 B;  4Q22 A;  1F40 A;  2RSE A;  3WH0 A;  2QF8 A;  2DK7 A;  4MNK A;  1P5Q A;  2FAP A;  3B9A A;  1A7X A;  4G2P A;  3WL1 A;  3PR9 A;  4DWS B;  2ZAJ A;  3LKX A;  2KR7 A;  3H9R B;  2IF4 A;  4Z2G A;  1KFW A;  3AS3 A;  1FFQ A;  2ESC A;  3RFW A;  1IX5 A;  4U85 A;  5B8I C;  5E62 A;  5AHT A;  3KCE A;  1FKR A;  1TCO C;  3WD1 A;  3ARZ A;  1K9T A;  3FS8 A;  1NMW A;  4HBO A;  3UI6 A;  4DZ2 A;  1M5Y A;  4WKA A;  4U84 A;  2ITK A;  4DRH A;  2YSF A;  3B9E A;  2WLZ A;  1LJY A;  4MGV A;  4R0X A;  2G8Z A;  3TC5 A;  5DF0 A;  4WJX A;  4TW6 A;  2A3B A;  3PA7 A;  1W9V A;  3RGC A;  4DRN A;  2ZQU A;  3GPK A;  3PRB A;  5E64 A;  2O92 A;  1EG4 A;  5GPR A;  3CGM A;  4QIB A;  4LAX A;  4NNR A;  2ZR5 A;  2DT1 A;  4GGQ A;  2LPV A;  3MDY B;  3ARP A;  4HAR A;  1ROU A;  4WKH A;  3CZ8 A;  5DO2 A;  3UQA A;  1HKI A;  1SYT A;  1SR0 A;  1C9H A;  1J4I A;  1KT1 A;  2MLZ A;  3CNG A;  4PTM A;  2RUD A;  4P8W A;  2PPP A;  1ZBW A;  4DRJ A;  4WIW A;  4ZPV R;  3WD0 A;  5HUA A;  1JMQ A;  3ALF A;  3TCZ A;  3I6C A;  3WIJ A;  2E45 A;  1W1P A;  1TR8 A;  4MNJ A;  4FN2 A;  1E9L A;  1D7I A;  2Q5A A;  1EIB A;  1E6R A;  1W1Y A;  2AOS A;  4ODM A;  1R9H A;  1ZBV A;  2F4E A;  4MNL A;  3CHD A;  4IQC A;  2PPO A;  2MDI A;  2JMF A;  3UI4 A;  1LQ0 A;  3O5P A;  1D6O A;  1LG2 A;  2ZQV A;  3O5O A;  3ARS A;  1NWR A;  1WMV A;  3B8S A;  2WAE A;  1N1A A;  2QRV A;  1ZK6 A;  4O2T A;  4Z2H A;  1RD6 A;  1EG3 A;  3W4R A;  1D7H A;  3AS1 A;  3JXV A;  2A3A A;  4TX0 A;  1ITX A;  2JV4 A;  3MCB B;  4DWS D;  2MLY A;  1HJV A;  1HKK A;  1FLC A;  3ARY A;  4IT4 A;  1J4H A;  1UR8 A;  3KZ7 A;  2KXQ A;  1FKD A;  2LKN A;  2N87 A;  3ODK A;  1YW5 A;  3AS2 A;  3O5F A;  2YSI A;  4NZC A;  4ZPT R;  3LE4 A;  2WK2 A;  4S3J A;  4AY1 A;  1JND A;  1EDQ A;  2RUR A;  1ZBC A;  3WQV A;  1QZ2 A;  2Y78 A;  3AQU A;  4TYO A;  3O5K A;  2WAD A;  2RQS A;  3OOB A;  3PRA A;  4DRI A;  4FAP A;  4TW7 A;  1HJX A;  4BF8 A;  2PPN A;  3O5I A;  3ARW A;  4MPK A;  5JH8 A;  3ARX A;  4LAY A;  3NTP A;  2M8J A;  1I5H W;  1WR7 A;  4DZ3 A;  4IPX A;  3M7N A;  2XP8 A;  1EHN A;  2DJY A;  3IHZ A;  5HTG A;  2MF9 A;  1H0G A;  2MPH A;  4LGX A;  1RP5 A;  4ODO A;  5BXJ A;  3ART A;  2OLH A;  2OFN A;  3OA5 A;  1X6L A;  3KAI A;  2XP7 A;  1ROT A;  4L72 B;  4ODN A;  2AWG A;  2DT3 A;  3CH9 A;  1E6Z A;  2L4J A;  3ALG A;  5E5W A;  4XAK A;  2DPE A;  3CHE A;  1JVW A;  4A0T A;  3RM4 A;  4ZS6 A;  3RME A;  1CTN A;  1H0I A;  3FAP A;  4MSP A;  4ODP A;  3FSB A;  1PIN A;  2DSU A;  5E65 A;  2ZQS A;  3FY1 A;  3PRD A;  3RM9 A;  2A3E A;  3KAH A;  2LAJ A;  1OGB A;  1QPL A;  4JYS A;  4TW8 A;  3M85 A;  3KAG A;  3CHC A;  2MLX A;  3WL0 A;  3WKZ A;  1O6I A;  1ZB5 A;  2M1I A;  4DIP A;  1BL4 A;  4NSB A;  2K8I A;  3JYJ A;  2G41 A;  1XRV A;  4HBE A;  4W9O A;  1J4R A;  1W9P A;  4P8U A;  2ZR4 A;  3UQB A;  2DSZ A;  5GPG A;  4MAV A;  2ZQT A;  3KAD A;  1QPF A;  1E6P A;  3O5E A;  4REX A;  1HKM A;  2KO7 A;  3B9D A;  2PI6 A;  4ODR A;  4KQZ A;  3TDB A;  2D9F A;  1HKJ A;  1ZL1 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...