2ZQSA

Crystal structure of a mutant pin1 peptidyl-prolyl cis-trans isomerase
Total Genus 42
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
42
sequence length
158
structure length
153
Chain Sequence
b'KLPPGWEKRMSRSSGRVYYFNHITNASQWERPSGGKNGQGEPARVRCSHLLVKHSQSRRPSSWRQEKITRTKEEALELINGYIQKIKSGEEDFESLASQFSDASSAKARGDLGAFSRGQMQKPFEDASFALRTGEMSGPVFTDSGIHIILRTE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Peptidyl-prolyl cis-trans isomerase NIMA-interacting 1
publication title Structural studies on PIN1 mutants
rcsb
source organism Homo sapiens
molecule tags Isomerase
total genus 42
structure length 153
sequence length 158
ec nomenclature ec 5.2.1.8: Peptidylprolyl isomerase.
pdb deposition date 2008-08-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00397 WW WW domain
A PF00639 Rotamase PPIC-type PPIASE domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.20.70.10 Mainly Beta Single Sheet Ubiquitin Ligase Nedd4; Chain: W; Ubiquitin Ligase Nedd4; Chain: W; 2zqsA01
3.10.50.40 Alpha Beta Roll Chitinase A; domain 3 Chitinase A; domain 3 2zqsA02
1PBKA 4ODMA 1U79A 1P5QA 3JXVA 1C9HA 2LJ4A 4JFKA 2RSEA 2VN1A 1FKKA 2ITKA 3PA7A 4JYSA 1HXVA 3KACA 4MGVA 5HT1A 3M85A 4DRPA 1M5YA 3IK8A 1JNTA 1ZK6A 4W9QA 1EYMA 2M8IA 4BF8A 4JFMA 4DRHA 4IPXA 2FAPA 5J6EA 2YSBA 3O5OA 1EG4A 2JZVA 4TW6A 3NI6A 4QT2A 1FKIA 1FKBA 1J4RA 4DZ3A 3TC5A 1K9RA 2M8JA 1EG3A 3KAHA 3O5RA 4QIBA 3TDBA 2MLYA 2M1IA 4LAWA 3LE4A 2MF9A 2LPVA 1FAPA 3MDYB 2OFNA 1L1PA 2YSHA 1FKGA 2JV4A 5DIVA 2PV3A 1D7JA 2LGOA 3FAPA 3CNGA 1K9QA 2VCDA 2YSFA 2YSGA 4MSPA 5AHTA 1F8AB 3O5KA 2MDIA 3LUOA 4JFJA 5HWBA 4W9PA 3JYMA 2MNTA 2XP5A 3UF8A 3I6CA 1JVWA 2M08A 3O5DA 2ZR4A 2JXWA 2KFWA 5HUAA 1FKSA 3L4HA 3UI5A 2M3OW 3UI4A 4LAVA 3O5PA 2DG3A 4TW8A 4J4NA 2DK7A 4ODOA 2Q5AA 4DZ2A 2XP8A 5DIUA 2ZAJA 2ZQTA 2DG9A 2EZ5W 4U85A 1Q6IA 3UQAA 4NNRA 2M2AA 4TNSA 2PPNA 2MPHA 4DRKA 4C02B 2D9FA 4DROA 1BL4A 3KCEA 2RE3A 2IF4A 2XP3A 2RUCA 5I98A 2E45A 1NMWA 2MLZA 2F21A 3TCZA 1FKDA 1F40A 1ROUA 1EQ3A 2KR7A 4ODKA 2AWGA 5HWCA 3O5IA 3CGNA 3JYJA 3IKDA 1QPLA 2MLXA 2RUQA 2DG4A 5HW8A 5HW6A 1JNSA 2PV1A 4TX0A 1TK7A 1FD9A 4DT4A 2RQSA 4U86A 4W9OA 5HKGA 5BXJA 1NMVA 2FKEA 1FJDA 4TYOA 3OOBA 4FAPA 1YW5A 3O5QA 2ZQSA 2N87A 3KZ7A 5GPGA 1FKFA 1ROTA 4QT3A 2XPBA 4DRQA 5CQ2A 2PPPA 5DITA 4N19A 4DRNA 1PINA 3O5LA 5HTGA 4R0XA 2ZR5A 3CGMA 1BKFA 1Q6UA 1J6YA 1O6WA 5HW7A 1J4HA 3O5JA 3VAWA 1YATA 1Q6HA 2XP4A 1D7IA 4GGQA 1FKJA 2LAJA 4J4OA 1ZCNA 2ZQUA 2DJYA 2RURA 3KAFA 1N1AA 2KXQA 4U84A 4IQ2A 4IQCA 1T11A 3NRKA 2XP6A 4DRIA 2KI3A 3PRDA 4ODNA 4LAYA 1TCOC 3RGCA 2K8IA 4O2TA 3O5GA 2ZR6A 2ZQVA 4DIPA 3PRBA 2PBCA 3IKGA 2F4EA 2YSIA 1FKTA 2BA1A 1KT0A 1Y0OA 3H9RB 5D75A 2KGJA 1A7XA 1Q1CA 4LAXA 2JX8A 4DRMA 3NTPA 3O5FA 1QZ2A 4GIVA 1D6OA 2UZ5A 3KAIA 1FKRA 1WR7A 3O5EA 3RFWA 2Y78A 3UQBA 1D7HA 4ODPA 1I5HW 3O5MA 2XP9A 4ODLA 1FKHA 1FKLA 3B7XA 2XPAA 1W26A 4REXA 4ODRA 3UI6A 4FN2A 1NSGA 1KT1A 1JMQA 5B8IC 4JFIA 2RUDA 3IHZA 1R9HA 3KAGA 2F2DA 2L2SA 4DRJA 3WH0A 1QPFA 1B6CA 4ODQA 2KE0A 2L4JA 2DWVA 3GPKA 3M7NA 2PPOA 1WMVA 3ODKA 4DH0A 4E5RA 3EY6A 2DMVA 4G2PA 1J4IA 2PV2A 3UQIA 4TW7A 2LKNA 2JMFA 4JFLA 4G50A 2DK1A 3KADA 2XP7A 2KO7A 4ITZA 3KABA
chains in the Genus database with same CATH superfamily
1PBKA 4Q22A 3PQHA 4ODMA 1U79A 1LL4A 1P5QA 5HBFA 2ETNA 4MNKA 3AS2A 3JXVA 1C9HA 1K9TA 2DSVA 3AROA 4MTVA 1JNDA 2LJ4A 3ARVA 4JFKA 4GLXA 2A3AA 3CHEA 5E62A 2RSEA 2VN1A 3ARTA 1ZL1A 4Z2GA 1FKKA 2ITKA 3PA7A 3WD0A 1HKKA 1H0GA 3ALFA 4JYSA 1HXVA 3ARUA 3KACA 4MGVA 3FXYA 5HT1A 3MCBB 3M85A 3WKZA 1IX5A 4DRPA 1WNOA 3GU0A 4URIA 1M5YA 3IK8A 1JNTA 1ZK6A 4W9QA 1X6LA 1FFQA 4ZPTR 1JCHB 1EYMA 2M8IA 4BF8A 3WIJA 1SYTA 4JFMA 4DRHA 2DT1A 4QZVB 2DT0A 2OLHA 4IPXA 2FAPA 5J6EA 2YSBA 1XHGA 1HJXA 1ZBWA 3O5OA 4DWSB 1ZBCA 1EG4A 1RD6A 3AQUA 2JZVA 3EIPA 4TW6A 3NI6A 4QT2A 1FKIA 1FKBA 4KR0B 4P8WA 1J4RA 3TC5A 1K9RA 4DZ3A 1CTNA 2M8JA 1EG3A 3KAHA 3MQGA 3BMBA 3O5RA 4QIBA 3TDBA 4KQZA 2MLYA 2M1IA 5JH8A 4LAWA 3LE4A 2MF9A 2LPVA 1FAPA 2DSWA 1W9UA 2OFNA 3MDYB 1L1PA 4ZS6A 2YSHA 1FKGA 2JV4A 5DIVA 4Q7NA 4XAKA 2PV3A 1D7JA 2LGOA 3FAPA 1FFRA 1FLCA 3CNGA 1W1YA 1OGGA 1K9QA 3ARYA 1E6PA 2YSFA 2YSGA 2VCDA 4MSPA 5AHTA 1GRJA 3WD2A 4P8UA 4ZPVR 1F8AB 3O5KA 2MDIA 3LUOA 4JFJA 2B5UB 4P8XA 1XRVA 5HWBA 2A3BA 3ARZA 4W9PA 3JYMA 2MNTA 2XP5A 3UF8A 2WLYA 3ARWA 4HARA 3I6CA 1JVWA 3AS3A 2M08A 3CHCA 3O5DA 2WADA 4MNLA 2ZR4A 4MNMA 3WL0A 2WAEA 2JXWA 2KFWA 5HUAA 1FKSA 3L4HA 1RP5A 3UI5A 2M3OW 3UI4A 1D2KA 4LAVA 3O5PA 1VF8A 2DG3A 4TW8A 3ARSA 3G6MA 3MQHA 4J4NA 2DK7A 3B9EA 4ODOA 2Q5AA 2DSUA 4DZ2A 2AOSA 1ZBVA 2XP8A 5DIUA 2QF8A 2ZAJA 2ZQTA 2DG9A 2EZ5W 3FSBA 4U85A 1H0IA 1Q6IA 3UQAA 3CHFA 4NNRA 2M2AA 4TNSA 2PPNA 1E15A 2FDMA 2MPHA 3QOKA 4DRKA 4C02B 1NWRA 2D9FA 4Z2KA 4WIWA 4WKHA 4DROA 3LKXA 1BL4A 3KCEA 2RE3A 2IF4A 2XP3A 2RUCA 2EULA 2F23A 4L72B 4R5EA 5E64A 2IUZA 5I98A 2E45A 2YAJB 3B9DA 2Y8NB 4UDMA 4NZCA 1NMWA 3OA5A 2MLZA 3ARQA 2F21A 3TCZA 1HJVA 1FKDA 1F40A 1ZBKA 1ROUA 4DWSD 1EQ3A 2KR7A 4ODKA 3WD3A 2YBTA 3BXWA 2AWGA 2O9OA 5HWCA 3O5IA 3RM9A 3CGNA 4A0TA 3WD4A 3JYJA 5E65A 3IKDA 4NSBA 1QPLA 4HBOA 4Z2JA 2MLXA 2RUQA 2DG4A 5HW8A 5HW6A 2WM0A 3MCBA 1JNSA 2P4VA 2PV1A 3G6LA 1TK7A 4TX0A 1HKJA 1UR9A 1FD9A 4DT4A 1WAWA 2RQSA 1HKIA 1GUVA 4W5UA 3RM4A 4U86A 3CHDA 4W9OA 5HKGA 5BXJA 2G41A 1TR8A 1NMVA 2FKEA 2A3CA 4WJXA 1FJDA 4ML4A 4TYOA 4DWSA 3OOBA 4FAPA 1HKMA 1WB0A 1YW5A 3PR9A 3O5QA 2ZQSA 2N87A 3KZ7A 5GPGA 1FKFA 1ROTA 4QT3A 2XPBA 4DRQA 5CQ2A 2PPPA 5DITA 1LL7A 4N19A 4DRNA 1PINA 3O5LA 4WKFA 5HTGA 4MAVA 4R0XA 2ZR5A 1EDQA 3CGMA 1BKFA 1Q6UA 1J6YA 1O6WA 5HW7A 1W1VA 4MNJA 1J4HA 3O5JA 1TFVA 2G8ZA 3PRAA 3VAWA 1YATA 1Q6HA 2XP4A 1D7IA 4GGQA 1W9PA 1GPFA 5DEZA 1W1PA 1W9VA 1FKJA 2LAJA 5DF0A 4J4OA 3CZ8A 1E6RA 1ZCNA 2ZQUA 2DJYA 2RURA 3KAFA 2ESCA 1LG1A 2YBUA 1N1AA 2KXQA 4U84A 3ALGA 4IQ2A 4IQCA 1T11A 3WL1A 3NRKA 2XP6A 4DRIA 1HJWA 2KI3A 5U47A 3PRDA 1LG2A 4DWSC 4ODNA 1ZU8A 3FS8A 4LAYA 5E5WA 1TCOC 3RGCA 2K8IA 4O2TA 3O5GA 3ARRA 3WQWA 1ITXA 2ZR6A 4A0UA 5GPRA 4MPKA 4L3NA 2ZQVA 3RMEA 1NH6A 4DIPA 3PRBA 3GTYX 2PBCA 3IKGA 1ZB5A 2F4EA 5GQBA 2YSIA 1FKTA 2BA1A 3WQVA 1KT0A 1Y0OA 1E6NA 1E9LA 2PN0A 3H9RB 4S3KA 5D75A 2KGJA 1A7XA 4IT6A 1SR0A 1Q1CA 4LAXA 2JX8A 4DRMA 4HBEA 3B9AA 3NTPA 3AS1A 1GOIA 1OWQA 2B31A 3O5FA 1QZ2A 1NWSA 4GIVA 3W4RA 1D6OA 1W1TA 2UZ5A 3B8SA 3KAIA 1EIBA 1FKRA 2DPEA 1WR7A 3O5EA 4S3JA 3RFWA 2Y78A 2DT2A 3ARPA 3FY1A 2QRVA 3UQBA 3CH9A 1D7HA 4ODPA 1I5HW 3O5MA 1JNEA 2XP9A 4ODLA 1FKHA 2PI6A 4Z2IA 1FKLA 4LGXA 3B7XA 2WK2A 2XPAA 1W26A 4REXA 1NWTA 2O92A 4IT4A 1EHNA 4ODRA 3UI6A 4FN2A 1NSGA 1KT1A 1JMQA 5B8IC 4JFIA 2RUDA 4Z2LA 3IHZA 1R9HA 1OGBA 3KAGA 4ZPWR 2F2DA 2L2SA 4WKAA 4DRJA 3WH0A 1NWUA 2OWOA 1QPFA 1X6NA 2DSZA 5DO2A 1B6CA 4ODQA 4P8VA 2KE0A 3WD1A 2L4JA 2DWVA 3GPKA 3M7NA 3FSCA 2PPOA 1WMVA 3ODKA 5E66A 1UR8A 4DH0A 4E5RA 1E6ZA 3ARXA 3EY6A 3AS0A 1E44A 2DMVA 1LQ0A 4G2PA 1J4IA 4WK9A 2WLZA 2PV2A 1O6IA 1KFWA 1LL6A 3UQIA 4TW7A 2LKNA 2JMFA 1LJYA 4JFLA 4G50A 2DK1A 4Z2HA 2DT3A 2A3EA 3LKXB 3KADA 2XP7A 4PTMA 2KO7A 3RM8A 4ITZA 3KABA 4AY1A
chains in the Genus database with same CATH topology
1PBKA 4Q22A 3PQHA 4ODMA 1U79A 1LL4A 1P5QA 5HBFA 4MNKA 3AS2A 3JXVA 1C9HA 1K9TA 2DSVA 3AROA 4MTVA 1JNDA 2LJ4A 3ARVA 4JFKA 4GLXA 2A3AA 3CHEA 5E62A 2RSEA 2VN1A 3ARTA 1ZL1A 4Z2GA 1FKKA 2ITKA 3PA7A 3WD0A 1HKKA 1H0GA 3ALFA 4JYSA 1HXVA 3ARUA 3KACA 4MGVA 3FXYA 5HT1A 3MCBB 3M85A 3WKZA 1IX5A 4DRPA 1WNOA 4URIA 1M5YA 3IK8A 1JNTA 1ZK6A 4W9QA 1X6LA 1FFQA 4ZPTR 1EYMA 2M8IA 4BF8A 3WIJA 1SYTA 4JFMA 4DRHA 2DT1A 4QZVB 2DT0A 2OLHA 4IPXA 2FAPA 5J6EA 2YSBA 1XHGA 1HJXA 1ZBWA 3O5OA 4DWSB 1ZBCA 1EG4A 1RD6A 3AQUA 2JZVA 4TW6A 3NI6A 4QT2A 1FKIA 1FKBA 4KR0B 4P8WA 1J4RA 3TC5A 1K9RA 4DZ3A 1CTNA 2M8JA 1EG3A 3KAHA 3MQGA 3O5RA 4QIBA 3TDBA 4KQZA 2MLYA 2M1IA 5JH8A 4LAWA 3LE4A 2MF9A 2LPVA 1FAPA 2DSWA 1W9UA 2OFNA 3MDYB 1L1PA 4ZS6A 2YSHA 1FKGA 2JV4A 5DIVA 4Q7NA 4XAKA 2PV3A 1D7JA 2LGOA 3FAPA 1FFRA 1FLCA 3CNGA 1W1YA 1OGGA 1K9QA 3ARYA 1E6PA 2YSFA 2YSGA 2VCDA 4MSPA 5AHTA 3WD2A 4P8UA 4ZPVR 1F8AB 3O5KA 2MDIA 3LUOA 4JFJA 4P8XA 1XRVA 5HWBA 2A3BA 3ARZA 4W9PA 3JYMA 2MNTA 2XP5A 3UF8A 2WLYA 3ARWA 4HARA 3I6CA 1JVWA 3AS3A 2M08A 3CHCA 3O5DA 2WADA 4MNLA 2ZR4A 4MNMA 3WL0A 2WAEA 2JXWA 2KFWA 5HUAA 1FKSA 3L4HA 1RP5A 3UI5A 2M3OW 3UI4A 1D2KA 4LAVA 3O5PA 1VF8A 2DG3A 4TW8A 3ARSA 3G6MA 3MQHA 4J4NA 2DK7A 3B9EA 4ODOA 2Q5AA 2DSUA 4DZ2A 2AOSA 1ZBVA 2XP8A 5DIUA 2QF8A 2ZAJA 2ZQTA 2DG9A 2EZ5W 3FSBA 4U85A 1H0IA 1Q6IA 3UQAA 3CHFA 4NNRA 2M2AA 4TNSA 2PPNA 1E15A 2FDMA 2MPHA 3QOKA 4DRKA 4C02B 1NWRA 2D9FA 4Z2KA 4WIWA 4WKHA 4DROA 3LKXA 1BL4A 3KCEA 2RE3A 2IF4A 2XP3A 2RUCA 4L72B 4R5EA 5E64A 2IUZA 5I98A 2E45A 2YAJB 3B9DA 2Y8NB 4NZCA 1NMWA 3OA5A 2MLZA 3ARQA 2F21A 3TCZA 1HJVA 1FKDA 1F40A 1ZBKA 1ROUA 4DWSD 1EQ3A 2KR7A 4ODKA 3WD3A 2YBTA 3BXWA 2AWGA 2O9OA 5HWCA 3O5IA 3RM9A 3CGNA 4A0TA 3WD4A 3JYJA 5E65A 3IKDA 4NSBA 1QPLA 4HBOA 4Z2JA 2MLXA 2RUQA 2DG4A 5HW8A 5HW6A 2WM0A 3MCBA 1JNSA 2PV1A 3G6LA 1TK7A 4TX0A 1HKJA 1UR9A 1FD9A 4DT4A 1WAWA 2RQSA 1HKIA 1GUVA 4W5UA 3RM4A 4U86A 3CHDA 4W9OA 5HKGA 5BXJA 2G41A 1TR8A 1NMVA 2FKEA 2A3CA 4WJXA 1FJDA 4ML4A 4TYOA 4DWSA 3OOBA 4FAPA 1HKMA 1WB0A 1YW5A 3PR9A 3O5QA 2ZQSA 2N87A 3KZ7A 5GPGA 1FKFA 1ROTA 4QT3A 2XPBA 4DRQA 5CQ2A 2PPPA 5DITA 1LL7A 4N19A 4DRNA 1PINA 3O5LA 4WKFA 5HTGA 4MAVA 4R0XA 2ZR5A 1EDQA 3CGMA 1BKFA 1Q6UA 1J6YA 1O6WA 5HW7A 1W1VA 4MNJA 1J4HA 3O5JA 1TFVA 2G8ZA 3PRAA 3VAWA 1YATA 1Q6HA 2XP4A 1D7IA 4GGQA 1W9PA 1GPFA 5DEZA 1W1PA 1W9VA 1FKJA 2LAJA 5DF0A 4J4OA 3CZ8A 1E6RA 1ZCNA 2ZQUA 2DJYA 2RURA 3KAFA 2ESCA 1LG1A 2YBUA 1N1AA 2KXQA 4U84A 3ALGA 4IQ2A 4IQCA 1T11A 3WL1A 3NRKA 2XP6A 4DRIA 1HJWA 2KI3A 5U47A 3PRDA 1LG2A 4DWSC 4ODNA 1ZU8A 3FS8A 4LAYA 5E5WA 1TCOC 3RGCA 2K8IA 4O2TA 3O5GA 3ARRA 3WQWA 1ITXA 2ZR6A 4A0UA 5GPRA 4MPKA 4L3NA 2ZQVA 3RMEA 1NH6A 4DIPA 3PRBA 2PBCA 3IKGA 1ZB5A 2F4EA 5GQBA 2YSIA 1FKTA 2BA1A 3WQVA 1KT0A 1Y0OA 1E6NA 1E9LA 3H9RB 4S3KA 5D75A 2KGJA 1A7XA 4IT6A 1SR0A 1Q1CA 4LAXA 2JX8A 4DRMA 4HBEA 3B9AA 3NTPA 3AS1A 1GOIA 1OWQA 2B31A 3O5FA 1QZ2A 1NWSA 4GIVA 3W4RA 1D6OA 1W1TA 2UZ5A 3B8SA 3KAIA 1EIBA 1FKRA 2DPEA 1WR7A 3O5EA 4S3JA 3RFWA 2Y78A 2DT2A 3ARPA 3FY1A 2QRVA 3UQBA 3CH9A 1D7HA 4ODPA 1I5HW 3O5MA 1JNEA 2XP9A 4ODLA 1FKHA 2PI6A 4Z2IA 1FKLA 4LGXA 3B7XA 2WK2A 2XPAA 1W26A 4REXA 1NWTA 2O92A 4IT4A 1EHNA 4ODRA 3UI6A 4FN2A 1NSGA 1KT1A 1JMQA 5B8IC 4JFIA 2RUDA 4Z2LA 3IHZA 1R9HA 1OGBA 3KAGA 4ZPWR 2F2DA 2L2SA 4WKAA 4DRJA 3WH0A 1NWUA 2OWOA 1QPFA 1X6NA 2DSZA 5DO2A 1B6CA 4ODQA 4P8VA 2KE0A 3WD1A 2L4JA 2DWVA 3GPKA 3M7NA 3FSCA 2PPOA 1WMVA 3ODKA 5E66A 1UR8A 4DH0A 4E5RA 1E6ZA 3ARXA 3EY6A 3AS0A 2DMVA 1LQ0A 4G2PA 1J4IA 4WK9A 2WLZA 2PV2A 1O6IA 1KFWA 1LL6A 3UQIA 4TW7A 2LKNA 2JMFA 1LJYA 4JFLA 4G50A 2DK1A 4Z2HA 2DT3A 2A3EA 3LKXB 3KADA 2XP7A 4PTMA 2KO7A 3RM8A 4ITZA 3KABA 4AY1A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1PBK A;  4ODM A;  1U79 A;  1P5Q A;  3JXV A;  1C9H A;  2LJ4 A;  4JFK A;  2RSE A;  2VN1 A;  1FKK A;  2ITK A;  3PA7 A;  4JYS A;  1HXV A;  3KAC A;  4MGV A;  5HT1 A;  3M85 A;  4DRP A;  1M5Y A;  3IK8 A;  1JNT A;  1ZK6 A;  4W9Q A;  1EYM A;  2M8I A;  4BF8 A;  4JFM A;  4DRH A;  4IPX A;  2FAP A;  5J6E A;  2YSB A;  3O5O A;  1EG4 A;  2JZV A;  4TW6 A;  3NI6 A;  4QT2 A;  1FKI A;  1FKB A;  1J4R A;  4DZ3 A;  3TC5 A;  1K9R A;  2M8J A;  1EG3 A;  3KAH A;  3O5R A;  4QIB A;  3TDB A;  2MLY A;  2M1I A;  4LAW A;  3LE4 A;  2MF9 A;  2LPV A;  1FAP A;  3MDY B;  2OFN A;  1L1P A;  2YSH A;  1FKG A;  2JV4 A;  5DIV A;  2PV3 A;  1D7J A;  2LGO A;  3FAP A;  3CNG A;  1K9Q A;  2VCD A;  2YSF A;  2YSG A;  4MSP A;  5AHT A;  1F8A B;  3O5K A;  2MDI A;  3LUO A;  4JFJ A;  5HWB A;  4W9P A;  3JYM A;  2MNT A;  2XP5 A;  3UF8 A;  3I6C A;  1JVW A;  2M08 A;  3O5D A;  2ZR4 A;  2JXW A;  2KFW A;  5HUA A;  1FKS A;  3L4H A;  3UI5 A;  2M3O W;  3UI4 A;  4LAV A;  3O5P A;  2DG3 A;  4TW8 A;  4J4N A;  2DK7 A;  4ODO A;  2Q5A A;  4DZ2 A;  2XP8 A;  5DIU A;  2ZAJ A;  2ZQT A;  2DG9 A;  2EZ5 W;  4U85 A;  1Q6I A;  3UQA A;  4NNR A;  2M2A A;  4TNS A;  2PPN A;  2MPH A;  4DRK A;  4C02 B;  2D9F A;  4DRO A;  1BL4 A;  3KCE A;  2RE3 A;  2IF4 A;  2XP3 A;  2RUC A;  5I98 A;  2E45 A;  1NMW A;  2MLZ A;  2F21 A;  3TCZ A;  1FKD A;  1F40 A;  1ROU A;  1EQ3 A;  2KR7 A;  4ODK A;  2AWG A;  5HWC A;  3O5I A;  3CGN A;  3JYJ A;  3IKD A;  1QPL A;  2MLX A;  2RUQ A;  2DG4 A;  5HW8 A;  5HW6 A;  1JNS A;  2PV1 A;  4TX0 A;  1TK7 A;  1FD9 A;  4DT4 A;  2RQS A;  4U86 A;  4W9O A;  5HKG A;  5BXJ A;  1NMV A;  2FKE A;  1FJD A;  4TYO A;  3OOB A;  4FAP A;  1YW5 A;  3O5Q A;  2ZQS A;  2N87 A;  3KZ7 A;  5GPG A;  1FKF A;  1ROT A;  4QT3 A;  2XPB A;  4DRQ A;  5CQ2 A;  2PPP A;  5DIT A;  4N19 A;  4DRN A;  1PIN A;  3O5L A;  5HTG A;  4R0X A;  2ZR5 A;  3CGM A;  1BKF A;  1Q6U A;  1J6Y A;  1O6W A;  5HW7 A;  1J4H A;  3O5J A;  3VAW A;  1YAT A;  1Q6H A;  2XP4 A;  1D7I A;  4GGQ A;  1FKJ A;  2LAJ A;  4J4O A;  1ZCN A;  2ZQU A;  2DJY A;  2RUR A;  3KAF A;  1N1A A;  2KXQ A;  4U84 A;  4IQ2 A;  4IQC A;  1T11 A;  3NRK A;  2XP6 A;  4DRI A;  2KI3 A;  3PRD A;  4ODN A;  4LAY A;  1TCO C;  3RGC A;  2K8I A;  4O2T A;  3O5G A;  2ZR6 A;  2ZQV A;  4DIP A;  3PRB A;  2PBC A;  3IKG A;  2F4E A;  2YSI A;  1FKT A;  2BA1 A;  1KT0 A;  1Y0O A;  3H9R B;  5D75 A;  2KGJ A;  1A7X A;  1Q1C A;  4LAX A;  2JX8 A;  4DRM A;  3NTP A;  3O5F A;  1QZ2 A;  4GIV A;  1D6O A;  2UZ5 A;  3KAI A;  1FKR A;  1WR7 A;  3O5E A;  3RFW A;  2Y78 A;  3UQB A;  1D7H A;  4ODP A;  1I5H W;  3O5M A;  2XP9 A;  4ODL A;  1FKH A;  1FKL A;  3B7X A;  2XPA A;  1W26 A;  4REX A;  4ODR A;  3UI6 A;  4FN2 A;  1NSG A;  1KT1 A;  1JMQ A;  5B8I C;  4JFI A;  2RUD A;  3IHZ A;  1R9H A;  3KAG A;  2F2D A;  2L2S A;  4DRJ A;  3WH0 A;  1QPF A;  1B6C A;  4ODQ A;  2KE0 A;  2L4J A;  2DWV A;  3GPK A;  3M7N A;  2PPO A;  1WMV A;  3ODK A;  4DH0 A;  4E5R A;  3EY6 A;  2DMV A;  4G2P A;  1J4I A;  2PV2 A;  3UQI A;  4TW7 A;  2LKN A;  2JMF A;  4JFL A;  4G50 A;  2DK1 A;  3KAD A;  2XP7 A;  2KO7 A;  4ITZ A;  3KAB A; 
#chains in the Genus database with same CATH topology
 1PBK A;  4Q22 A;  3PQH A;  4ODM A;  1U79 A;  1LL4 A;  1P5Q A;  5HBF A;  2ETN A;  4MNK A;  3AS2 A;  3JXV A;  1C9H A;  1K9T A;  2DSV A;  3ARO A;  4MTV A;  1JND A;  2LJ4 A;  3ARV A;  4JFK A;  4GLX A;  2A3A A;  3CHE A;  5E62 A;  2RSE A;  2VN1 A;  3ART A;  1ZL1 A;  4Z2G A;  1FKK A;  2ITK A;  3PA7 A;  3WD0 A;  1HKK A;  1H0G A;  3ALF A;  4JYS A;  1HXV A;  3ARU A;  3KAC A;  4MGV A;  3FXY A;  5HT1 A;  3MCB B;  3M85 A;  3WKZ A;  1IX5 A;  4DRP A;  1WNO A;  3GU0 A;  4URI A;  1M5Y A;  3IK8 A;  1JNT A;  1ZK6 A;  4W9Q A;  1X6L A;  1FFQ A;  4ZPT R;  1JCH B;  1EYM A;  2M8I A;  4BF8 A;  3WIJ A;  1SYT A;  4JFM A;  4DRH A;  2DT1 A;  4QZV B;  2DT0 A;  2OLH A;  4IPX A;  2FAP A;  5J6E A;  2YSB A;  1XHG A;  1HJX A;  1ZBW A;  3O5O A;  4DWS B;  1ZBC A;  1EG4 A;  1RD6 A;  3AQU A;  2JZV A;  3EIP A;  4TW6 A;  3NI6 A;  4QT2 A;  1FKI A;  1FKB A;  4KR0 B;  4P8W A;  1J4R A;  3TC5 A;  1K9R A;  4DZ3 A;  1CTN A;  2M8J A;  1EG3 A;  3KAH A;  3MQG A;  3BMB A;  3O5R A;  4QIB A;  3TDB A;  4KQZ A;  2MLY A;  2M1I A;  5JH8 A;  4LAW A;  3LE4 A;  2MF9 A;  2LPV A;  1FAP A;  2DSW A;  1W9U A;  2OFN A;  3MDY B;  1L1P A;  4ZS6 A;  2YSH A;  1FKG A;  2JV4 A;  5DIV A;  4Q7N A;  4XAK A;  2PV3 A;  1D7J A;  2LGO A;  3FAP A;  1FFR A;  1FLC A;  3CNG A;  1W1Y A;  1OGG A;  1K9Q A;  3ARY A;  1E6P A;  2YSF A;  2YSG A;  2VCD A;  4MSP A;  5AHT A;  1GRJ A;  3WD2 A;  4P8U A;  4ZPV R;  1F8A B;  3O5K A;  2MDI A;  3LUO A;  4JFJ A;  2B5U B;  4P8X A;  1XRV A;  5HWB A;  2A3B A;  3ARZ A;  4W9P A;  3JYM A;  2MNT A;  2XP5 A;  3UF8 A;  2WLY A;  3ARW A;  4HAR A;  3I6C A;  1JVW A;  3AS3 A;  2M08 A;  3CHC A;  3O5D A;  2WAD A;  4MNL A;  2ZR4 A;  4MNM A;  3WL0 A;  2WAE A;  2JXW A;  2KFW A;  5HUA A;  1FKS A;  3L4H A;  1RP5 A;  3UI5 A;  2M3O W;  3UI4 A;  1D2K A;  4LAV A;  3O5P A;  1VF8 A;  2DG3 A;  4TW8 A;  3ARS A;  3G6M A;  3MQH A;  4J4N A;  2DK7 A;  3B9E A;  4ODO A;  2Q5A A;  2DSU A;  4DZ2 A;  2AOS A;  1ZBV A;  2XP8 A;  5DIU A;  2QF8 A;  2ZAJ A;  2ZQT A;  2DG9 A;  2EZ5 W;  3FSB A;  4U85 A;  1H0I A;  1Q6I A;  3UQA A;  3CHF A;  4NNR A;  2M2A A;  4TNS A;  2PPN A;  1E15 A;  2FDM A;  2MPH A;  3QOK A;  4DRK A;  4C02 B;  1NWR A;  2D9F A;  4Z2K A;  4WIW A;  4WKH A;  4DRO A;  3LKX A;  1BL4 A;  3KCE A;  2RE3 A;  2IF4 A;  2XP3 A;  2RUC A;  2EUL A;  2F23 A;  4L72 B;  4R5E A;  5E64 A;  2IUZ A;  5I98 A;  2E45 A;  2YAJ B;  3B9D A;  2Y8N B;  4UDM A;  4NZC A;  1NMW A;  3OA5 A;  2MLZ A;  3ARQ A;  2F21 A;  3TCZ A;  1HJV A;  1FKD A;  1F40 A;  1ZBK A;  1ROU A;  4DWS D;  1EQ3 A;  2KR7 A;  4ODK A;  3WD3 A;  2YBT A;  3BXW A;  2AWG A;  2O9O A;  5HWC A;  3O5I A;  3RM9 A;  3CGN A;  4A0T A;  3WD4 A;  3JYJ A;  5E65 A;  3IKD A;  4NSB A;  1QPL A;  4HBO A;  4Z2J A;  2MLX A;  2RUQ A;  2DG4 A;  5HW8 A;  5HW6 A;  2WM0 A;  3MCB A;  1JNS A;  2P4V A;  2PV1 A;  3G6L A;  1TK7 A;  4TX0 A;  1HKJ A;  1UR9 A;  1FD9 A;  4DT4 A;  1WAW A;  2RQS A;  1HKI A;  1GUV A;  4W5U A;  3RM4 A;  4U86 A;  3CHD A;  4W9O A;  5HKG A;  5BXJ A;  2G41 A;  1TR8 A;  1NMV A;  2FKE A;  2A3C A;  4WJX A;  1FJD A;  4ML4 A;  4TYO A;  4DWS A;  3OOB A;  4FAP A;  1HKM A;  1WB0 A;  1YW5 A;  3PR9 A;  3O5Q A;  2ZQS A;  2N87 A;  3KZ7 A;  5GPG A;  1FKF A;  1ROT A;  4QT3 A;  2XPB A;  4DRQ A;  5CQ2 A;  2PPP A;  5DIT A;  1LL7 A;  4N19 A;  4DRN A;  1PIN A;  3O5L A;  4WKF A;  5HTG A;  4MAV A;  4R0X A;  2ZR5 A;  1EDQ A;  3CGM A;  1BKF A;  1Q6U A;  1J6Y A;  1O6W A;  5HW7 A;  1W1V A;  4MNJ A;  1J4H A;  3O5J A;  1TFV A;  2G8Z A;  3PRA A;  3VAW A;  1YAT A;  1Q6H A;  2XP4 A;  1D7I A;  4GGQ A;  1W9P A;  1GPF A;  5DEZ A;  1W1P A;  1W9V A;  1FKJ A;  2LAJ A;  5DF0 A;  4J4O A;  3CZ8 A;  1E6R A;  1ZCN A;  2ZQU A;  2DJY A;  2RUR A;  3KAF A;  2ESC A;  1LG1 A;  2YBU A;  1N1A A;  2KXQ A;  4U84 A;  3ALG A;  4IQ2 A;  4IQC A;  1T11 A;  3WL1 A;  3NRK A;  2XP6 A;  4DRI A;  1HJW A;  2KI3 A;  5U47 A;  3PRD A;  1LG2 A;  4DWS C;  4ODN A;  1ZU8 A;  3FS8 A;  4LAY A;  5E5W A;  1TCO C;  3RGC A;  2K8I A;  4O2T A;  3O5G A;  3ARR A;  3WQW A;  1ITX A;  2ZR6 A;  4A0U A;  5GPR A;  4MPK A;  4L3N A;  2ZQV A;  3RME A;  1NH6 A;  4DIP A;  3PRB A;  3GTY X;  2PBC A;  3IKG A;  1ZB5 A;  2F4E A;  5GQB A;  2YSI A;  1FKT A;  2BA1 A;  3WQV A;  1KT0 A;  1Y0O A;  1E6N A;  1E9L A;  2PN0 A;  3H9R B;  4S3K A;  5D75 A;  2KGJ A;  1A7X A;  4IT6 A;  1SR0 A;  1Q1C A;  4LAX A;  2JX8 A;  4DRM A;  4HBE A;  3B9A A;  3NTP A;  3AS1 A;  1GOI A;  1OWQ A;  2B31 A;  3O5F A;  1QZ2 A;  1NWS A;  4GIV A;  3W4R A;  1D6O A;  1W1T A;  2UZ5 A;  3B8S A;  3KAI A;  1EIB A;  1FKR A;  2DPE A;  1WR7 A;  3O5E A;  4S3J A;  3RFW A;  2Y78 A;  2DT2 A;  3ARP A;  3FY1 A;  2QRV A;  3UQB A;  3CH9 A;  1D7H A;  4ODP A;  1I5H W;  3O5M A;  1JNE A;  2XP9 A;  4ODL A;  1FKH A;  2PI6 A;  4Z2I A;  1FKL A;  4LGX A;  3B7X A;  2WK2 A;  2XPA A;  1W26 A;  4REX A;  1NWT A;  2O92 A;  4IT4 A;  1EHN A;  4ODR A;  3UI6 A;  4FN2 A;  1NSG A;  1KT1 A;  1JMQ A;  5B8I C;  4JFI A;  2RUD A;  4Z2L A;  3IHZ A;  1R9H A;  1OGB A;  3KAG A;  4ZPW R;  2F2D A;  2L2S A;  4WKA A;  4DRJ A;  3WH0 A;  1NWU A;  2OWO A;  1QPF A;  1X6N A;  2DSZ A;  5DO2 A;  1B6C A;  4ODQ A;  4P8V A;  2KE0 A;  3WD1 A;  2L4J A;  2DWV A;  3GPK A;  3M7N A;  3FSC A;  2PPO A;  1WMV A;  3ODK A;  5E66 A;  1UR8 A;  4DH0 A;  4E5R A;  1E6Z A;  3ARX A;  3EY6 A;  3AS0 A;  1E44 A;  2DMV A;  1LQ0 A;  4G2P A;  1J4I A;  4WK9 A;  2WLZ A;  2PV2 A;  1O6I A;  1KFW A;  1LL6 A;  3UQI A;  4TW7 A;  2LKN A;  2JMF A;  1LJY A;  4JFL A;  4G50 A;  2DK1 A;  4Z2H A;  2DT3 A;  2A3E A;  3LKX B;  3KAD A;  2XP7 A;  4PTM A;  2KO7 A;  3RM8 A;  4ITZ A;  3KAB A;  4AY1 A; 
#chains in the Genus database with same CATH homology
 1PBK A;  4Q22 A;  3PQH A;  4ODM A;  1U79 A;  1LL4 A;  1P5Q A;  5HBF A;  4MNK A;  3AS2 A;  3JXV A;  1C9H A;  1K9T A;  2DSV A;  3ARO A;  4MTV A;  1JND A;  2LJ4 A;  3ARV A;  4JFK A;  4GLX A;  2A3A A;  3CHE A;  5E62 A;  2RSE A;  2VN1 A;  3ART A;  1ZL1 A;  4Z2G A;  1FKK A;  2ITK A;  3PA7 A;  3WD0 A;  1HKK A;  1H0G A;  3ALF A;  4JYS A;  1HXV A;  3ARU A;  3KAC A;  4MGV A;  3FXY A;  5HT1 A;  3MCB B;  3M85 A;  3WKZ A;  1IX5 A;  4DRP A;  1WNO A;  4URI A;  1M5Y A;  3IK8 A;  1JNT A;  1ZK6 A;  4W9Q A;  1X6L A;  1FFQ A;  4ZPT R;  1EYM A;  2M8I A;  4BF8 A;  3WIJ A;  1SYT A;  4JFM A;  4DRH A;  2DT1 A;  4QZV B;  2DT0 A;  2OLH A;  4IPX A;  2FAP A;  5J6E A;  2YSB A;  1XHG A;  1HJX A;  1ZBW A;  3O5O A;  4DWS B;  1ZBC A;  1EG4 A;  1RD6 A;  3AQU A;  2JZV A;  4TW6 A;  3NI6 A;  4QT2 A;  1FKI A;  1FKB A;  4KR0 B;  4P8W A;  1J4R A;  3TC5 A;  1K9R A;  4DZ3 A;  1CTN A;  2M8J A;  1EG3 A;  3KAH A;  3MQG A;  3O5R A;  4QIB A;  3TDB A;  4KQZ A;  2MLY A;  2M1I A;  5JH8 A;  4LAW A;  3LE4 A;  2MF9 A;  2LPV A;  1FAP A;  2DSW A;  1W9U A;  2OFN A;  3MDY B;  1L1P A;  4ZS6 A;  2YSH A;  1FKG A;  2JV4 A;  5DIV A;  4Q7N A;  4XAK A;  2PV3 A;  1D7J A;  2LGO A;  3FAP A;  1FFR A;  1FLC A;  3CNG A;  1W1Y A;  1OGG A;  1K9Q A;  3ARY A;  1E6P A;  2YSF A;  2YSG A;  2VCD A;  4MSP A;  5AHT A;  3WD2 A;  4P8U A;  4ZPV R;  1F8A B;  3O5K A;  2MDI A;  3LUO A;  4JFJ A;  4P8X A;  1XRV A;  5HWB A;  2A3B A;  3ARZ A;  4W9P A;  3JYM A;  2MNT A;  2XP5 A;  3UF8 A;  2WLY A;  3ARW A;  4HAR A;  3I6C A;  1JVW A;  3AS3 A;  2M08 A;  3CHC A;  3O5D A;  2WAD A;  4MNL A;  2ZR4 A;  4MNM A;  3WL0 A;  2WAE A;  2JXW A;  2KFW A;  5HUA A;  1FKS A;  3L4H A;  1RP5 A;  3UI5 A;  2M3O W;  3UI4 A;  1D2K A;  4LAV A;  3O5P A;  1VF8 A;  2DG3 A;  4TW8 A;  3ARS A;  3G6M A;  3MQH A;  4J4N A;  2DK7 A;  3B9E A;  4ODO A;  2Q5A A;  2DSU A;  4DZ2 A;  2AOS A;  1ZBV A;  2XP8 A;  5DIU A;  2QF8 A;  2ZAJ A;  2ZQT A;  2DG9 A;  2EZ5 W;  3FSB A;  4U85 A;  1H0I A;  1Q6I A;  3UQA A;  3CHF A;  4NNR A;  2M2A A;  4TNS A;  2PPN A;  1E15 A;  2FDM A;  2MPH A;  3QOK A;  4DRK A;  4C02 B;  1NWR A;  2D9F A;  4Z2K A;  4WIW A;  4WKH A;  4DRO A;  3LKX A;  1BL4 A;  3KCE A;  2RE3 A;  2IF4 A;  2XP3 A;  2RUC A;  4L72 B;  4R5E A;  5E64 A;  2IUZ A;  5I98 A;  2E45 A;  2YAJ B;  3B9D A;  2Y8N B;  4NZC A;  1NMW A;  3OA5 A;  2MLZ A;  3ARQ A;  2F21 A;  3TCZ A;  1HJV A;  1FKD A;  1F40 A;  1ZBK A;  1ROU A;  4DWS D;  1EQ3 A;  2KR7 A;  4ODK A;  3WD3 A;  2YBT A;  3BXW A;  2AWG A;  2O9O A;  5HWC A;  3O5I A;  3RM9 A;  3CGN A;  4A0T A;  3WD4 A;  3JYJ A;  5E65 A;  3IKD A;  4NSB A;  1QPL A;  4HBO A;  4Z2J A;  2MLX A;  2RUQ A;  2DG4 A;  5HW8 A;  5HW6 A;  2WM0 A;  3MCB A;  1JNS A;  2PV1 A;  3G6L A;  1TK7 A;  4TX0 A;  1HKJ A;  1UR9 A;  1FD9 A;  4DT4 A;  1WAW A;  2RQS A;  1HKI A;  1GUV A;  4W5U A;  3RM4 A;  4U86 A;  3CHD A;  4W9O A;  5HKG A;  5BXJ A;  2G41 A;  1TR8 A;  1NMV A;  2FKE A;  2A3C A;  4WJX A;  1FJD A;  4ML4 A;  4TYO A;  4DWS A;  3OOB A;  4FAP A;  1HKM A;  1WB0 A;  1YW5 A;  3PR9 A;  3O5Q A;  2ZQS A;  2N87 A;  3KZ7 A;  5GPG A;  1FKF A;  1ROT A;  4QT3 A;  2XPB A;  4DRQ A;  5CQ2 A;  2PPP A;  5DIT A;  1LL7 A;  4N19 A;  4DRN A;  1PIN A;  3O5L A;  4WKF A;  5HTG A;  4MAV A;  4R0X A;  2ZR5 A;  1EDQ A;  3CGM A;  1BKF A;  1Q6U A;  1J6Y A;  1O6W A;  5HW7 A;  1W1V A;  4MNJ A;  1J4H A;  3O5J A;  1TFV A;  2G8Z A;  3PRA A;  3VAW A;  1YAT A;  1Q6H A;  2XP4 A;  1D7I A;  4GGQ A;  1W9P A;  1GPF A;  5DEZ A;  1W1P A;  1W9V A;  1FKJ A;  2LAJ A;  5DF0 A;  4J4O A;  3CZ8 A;  1E6R A;  1ZCN A;  2ZQU A;  2DJY A;  2RUR A;  3KAF A;  2ESC A;  1LG1 A;  2YBU A;  1N1A A;  2KXQ A;  4U84 A;  3ALG A;  4IQ2 A;  4IQC A;  1T11 A;  3WL1 A;  3NRK A;  2XP6 A;  4DRI A;  1HJW A;  2KI3 A;  5U47 A;  3PRD A;  1LG2 A;  4DWS C;  4ODN A;  1ZU8 A;  3FS8 A;  4LAY A;  5E5W A;  1TCO C;  3RGC A;  2K8I A;  4O2T A;  3O5G A;  3ARR A;  3WQW A;  1ITX A;  2ZR6 A;  4A0U A;  5GPR A;  4MPK A;  4L3N A;  2ZQV A;  3RME A;  1NH6 A;  4DIP A;  3PRB A;  2PBC A;  3IKG A;  1ZB5 A;  2F4E A;  5GQB A;  2YSI A;  1FKT A;  2BA1 A;  3WQV A;  1KT0 A;  1Y0O A;  1E6N A;  1E9L A;  3H9R B;  4S3K A;  5D75 A;  2KGJ A;  1A7X A;  4IT6 A;  1SR0 A;  1Q1C A;  4LAX A;  2JX8 A;  4DRM A;  4HBE A;  3B9A A;  3NTP A;  3AS1 A;  1GOI A;  1OWQ A;  2B31 A;  3O5F A;  1QZ2 A;  1NWS A;  4GIV A;  3W4R A;  1D6O A;  1W1T A;  2UZ5 A;  3B8S A;  3KAI A;  1EIB A;  1FKR A;  2DPE A;  1WR7 A;  3O5E A;  4S3J A;  3RFW A;  2Y78 A;  2DT2 A;  3ARP A;  3FY1 A;  2QRV A;  3UQB A;  3CH9 A;  1D7H A;  4ODP A;  1I5H W;  3O5M A;  1JNE A;  2XP9 A;  4ODL A;  1FKH A;  2PI6 A;  4Z2I A;  1FKL A;  4LGX A;  3B7X A;  2WK2 A;  2XPA A;  1W26 A;  4REX A;  1NWT A;  2O92 A;  4IT4 A;  1EHN A;  4ODR A;  3UI6 A;  4FN2 A;  1NSG A;  1KT1 A;  1JMQ A;  5B8I C;  4JFI A;  2RUD A;  4Z2L A;  3IHZ A;  1R9H A;  1OGB A;  3KAG A;  4ZPW R;  2F2D A;  2L2S A;  4WKA A;  4DRJ A;  3WH0 A;  1NWU A;  2OWO A;  1QPF A;  1X6N A;  2DSZ A;  5DO2 A;  1B6C A;  4ODQ A;  4P8V A;  2KE0 A;  3WD1 A;  2L4J A;  2DWV A;  3GPK A;  3M7N A;  3FSC A;  2PPO A;  1WMV A;  3ODK A;  5E66 A;  1UR8 A;  4DH0 A;  4E5R A;  1E6Z A;  3ARX A;  3EY6 A;  3AS0 A;  2DMV A;  1LQ0 A;  4G2P A;  1J4I A;  4WK9 A;  2WLZ A;  2PV2 A;  1O6I A;  1KFW A;  1LL6 A;  3UQI A;  4TW7 A;  2LKN A;  2JMF A;  1LJY A;  4JFL A;  4G50 A;  2DK1 A;  4Z2H A;  2DT3 A;  2A3E A;  3LKX B;  3KAD A;  2XP7 A;  4PTM A;  2KO7 A;  3RM8 A;  4ITZ A;  3KAB A;  4AY1 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...