2ZQSA

Crystal structure of a mutant pin1 peptidyl-prolyl cis-trans isomerase
Total Genus 42
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
42
sequence length
158
structure length
153
Chain Sequence
KLPPGWEKRMSRSSGRVYYFNHITNASQWERPSGGKNGQGEPARVRCSHLLVKHSQSRRPSSWRQEKITRTKEEALELINGYIQKIKSGEEDFESLASQFSDASSAKARGDLGAFSRGQMQKPFEDASFALRTGEMSGPVFTDSGIHIILRTE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Peptidyl-prolyl cis-trans isomerase NIMA-interacting 1
publication title Structural studies on PIN1 mutants
rcsb
source organism Homo sapiens
molecule tags Isomerase
total genus 42
structure length 153
sequence length 158
ec nomenclature ec 5.2.1.8: Peptidylprolyl isomerase.
pdb deposition date 2008-08-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00397 WW WW domain
A PF00639 Rotamase PPIC-type PPIASE domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.20.70.10 Mainly Beta Single Sheet Ubiquitin Ligase Nedd4; Chain: W; Ubiquitin Ligase Nedd4; Chain: W; 2zqsA01
3.10.50.40 Alpha Beta Roll Chitinase A; domain 3 Chitinase A; domain 3 2zqsA02
3JYJA 2MPHA 3O5LA 3RGCA 1NMVA 3ODKA 2DG9A 1FKKA 3PRBA 3KAIA 1B6CA 3NTPA 1K9RA 2LPVA 4J4NA 4LAVA 2MLXA 2L2SA 3NI6A 2RSEA 1FD9A 1FKHA 5HW6A 1N1AA 2XPAA 4DRHA 2ZR6A 3O5FA 3CGNA 1ROTA 3O5RA 4REXA 1O6WA 2LGOA 4JFKA 4FN2A 3RFWA 1TCOC 4LAXA 1FKIA 2ZQVA 4QT3A 4ODLA 4MGVA 1K9QA 3CGMA 4IQ2A 3O5JA 5D75A 2ZQTA 2ZR4A 2LJ4A 3O5PA 4TYOA 2VN1A 4ODQA 1QPFA 2RURA 3KAFA 1J4RA 5HTGA 1FKTA 1L1PA 1PBKA 5BXJA 2KR7A 1Q6HA 1FKGA 4ODOA 1F8AB 4FAPA 3PRDA 5HW7A 4U84A 2E45A 2EZ5W 4IPXA 1YW5A 5CQ2A 1T11A 5I98A 1WR7A 2LAJA 3M7NA 5HKGA 4ODMA 1D7HA 2JX8A 2OFNA 2LKNA 3LE4A 1FKFA 2RUDA 1JMQA 2YSBA 1EQ3A 1FKDA 2KXQA 4U86A 1Q6UA 3IKDA 1J4HA 2XP3A 3M85A 3UI5A 3WH0A 4DH0A 2FAPA 2AWGA 3JXVA 2MLZA 3L4HA 4ITZA 4N19A 2YSIA 1FKJA 2D9FA 2XP7A 2PBCA 3JYMA 4JFIA 3PA7A 2PV1A 2UZ5A 2M1IA 1ZCNA 4ODNA 3UQIA 1NMWA 2Y78A 1Y0OA 3UF8A 2RE3A 3CNGA 2DG4A 2F4EA 2DK1A 4GIVA 4TW6A 1F40A 1J6YA 3UQBA 1A7XA 1QPLA 2MF9A 2XP4A 4DRMA 1ROUA 5HWCA 5GPGA 4GGQA 2PV2A 4ODPA 3O5DA 1HXVA 2XP5A 2VCDA 2FKEA 3KACA 2DJYA 4DROA 2KE0A 4C02B 1JNSA 5DITA 4W9QA 4U85A 1FKRA 1KT1A 1JNTA 4O2TA 3O5GA 3H9RB 1FKSA 1Q1CA 3KADA 4TW7A 2K8IA 3MDYB 4ODKA 4QIBA 1FJDA 2RUQA 5HWBA 4DRNA 4DT4A 4G2PA 3KZ7A 4DRIA 1JVWA 4J4OA 1EG4A 2KFWA 2PPPA 2M08A 3O5MA 4IQCA 4W9PA 2M8IA 4DZ3A 3TCZA 2PPOA 2F2DA 5HW8A 1FKBA 4DRKA 2XP8A 3O5EA 2RQSA 2F21A 5DIUA 3I6CA 3B7XA 2DK7A 2M8JA 3TC5A 1EYMA 4E5RA 2RUCA 4JFJA 4TW8A 4G50A 1J4IA 2XPBA 4DIPA 2JV4A 1TK7A 4DRJA 1EG3A 2KO7A 4TNSA 3KAGA 2JMFA 1D7JA 4W9OA 2PV3A 2N87A 3UI4A 3FAPA 2YSGA 1P5QA 2DG3A 4MSPA 4JFLA 2DMVA 1C9HA 3IHZA 3O5IA 2MNTA 1W26A 4LAYA 3LUOA 2ZQSA 3KCEA 5DIVA 4R0XA 2ITKA 2PPNA 1FAPA 1D7IA 1KT0A 1I5HW 5AHTA 2XP6A 5HT1A 2YSHA 4ODRA 1BL4A 2M3OW 5J6EA 1D6OA 1ZK6A 2DWVA 2L4JA 1QZ2A 2JXWA 1R9HA 3IKGA 4JFMA 2ZAJA 3IK8A 1PINA 1U79A 2JZVA 4NNRA 2IF4A 4TX0A 3UI6A 3UQAA 3OOBA 3TDBA 2MLYA 2KI3A 2XP9A 1FKLA 2ZQUA 1BKFA 3KABA 2BA1A 4BF8A 3KAHA 4DRQA 4JYSA 4QT2A 3O5KA 1Q6IA 2ZR5A 2YSFA 1NSGA 2Q5AA 2M2AA 3GPKA 1YATA 3O5OA 5B8IC 2KGJA 3EY6A 5HUAA 4DZ2A 1M5YA 4DRPA 4LAWA 1WMVA 3VAWA 3NRKA 3O5QA 2MDIA
chains in the Genus database with same CATH superfamily
3JYJA 2MPHA 1EIBA 3O5LA 1NMVA 3ODKA 2DG9A 2WLZA 1FKKA 3PRBA 2QF8A 3RGCA 3CZ8A 3KAIA 1B6CA 4R5EA 3NTPA 1W1VA 3CHDA 1K9RA 5GQBA 2LPVA 5E65A 2WK2A 4J4NA 4LAVA 1SYTA 4Z2GA 2MLXA 2L2SA 3NI6A 1WB0A 2RSEA 1FD9A 1FKHA 5HW6A 1N1AA 2B31A 2XPAA 4DRHA 2FDMA 2DT2A 3QOKA 3FY1A 2ZR6A 5DEZA 3O5FA 3CGNA 1NWRA 1ROTA 3O5RA 1JNDA 4XAKA 4REXA 1O6WA 2LGOA 4JFKA 1HKKA 1ZBKA 4FN2A 3RFWA 1TCOC 2A3EA 2DPEA 4LAXA 3AQUA 4P8UA 1FKIA 2ZQVA 4QT3A 2QRVA 4ODLA 4MGVA 1K9QA 3WD4A 1HJWA 4DWSC 1LL6A 3CGMA 4IQ2A 3O5JA 5D75A 5E5WA 3B9AA 1GPFA 2ZQTA 2ZR4A 2LJ4A 3O5PA 4TYOA 2VN1A 4ODQA 1OGGA 3EIPA 4WKAA 1E6ZA 1QPFA 2RURA 3KAFA 1J4RA 3ARPA 5HTGA 4KQZA 1FKTA 1L1PA 3ARZA 3AROA 3MCBB 1PBKA 4KR0B 5BXJA 2KR7A 1Q6HA 3BMBA 4W5UA 1FKGA 1HKIA 3CHFA 1F8AB 4ODOA 4FAPA 3PRDA 5HW7A 4U84A 2E45A 2EZ5W 3CHCA 1W9VA 4IPXA 1YW5A 4MNJA 5CQ2A 1T11A 5I98A 3GU0A 1WR7A 1ITXA 2LAJA 3M7NA 5HKGA 4ODMA 3LKXA 1D7HA 1GUVA 4ZPWR 4Z2JA 2JX8A 3WD3A 2OFNA 2LKNA 3LE4A 1FKFA 4Q22A 2RUDA 1JMQA 3ARUA 3ARXA 2YSBA 4P8XA 4S3KA 4MNKA 3WL1A 4MPKA 2WAEA 1EQ3A 1WNOA 1RP5A 2KXQA 4U86A 1FKDA 2YBTA 4HBEA 3CH9A 1Q6UA 3IKDA 1EHNA 1J4HA 3AS3A 4NSBA 2WLYA 1HKJA 2XP3A 3M85A 2YBUA 5U47A 3UI5A 1ZU8A 3RM9A 3WH0A 1LL4A 1ZBCA 4DH0A 2FAPA 3RMEA 2AWGA 3JXVA 2MLZA 3L4HA 1K9TA 4ITZA 4N19A 2YSIA 1FKJA 2D9FA 2XP7A 1LG1A 2PBCA 1LJYA 4WJXA 3JYMA 3WIJA 3ARRA 4ZPVR 3ARSA 4JFIA 3PA7A 4LGXA 1H0IA 2PV1A 3AS0A 2UZ5A 2M1IA 1ZCNA 4ODNA 3UQIA 1E6RA 3WD0A 1W9PA 1IX5A 1NMWA 2Y78A 1Y0OA 3UF8A 3WQVA 2RE3A 3CNGA 2DG4A 2F4EA 2OLHA 4MAVA 2DK1A 4GIVA 2PN0A 4TW6A 1F40A 1J6YA 3UQBA 1NWUA 1A7XA 1QPLA 2MF9A 2XP4A 4DRMA 1ROUA 5HBFA 5HWCA 5GPGA 4GGQA 2PV2A 4ODPA 3ARVA 3MQHA 3O5DA 2DT1A 3WD1A 1HXVA 2XP5A 2VCDA 4Z2IA 1OWQA 2FKEA 3KACA 5E66A 2DJYA 4DROA 2AOSA 2KE0A 5E64A 4C02B 1JNSA 5DITA 4W9QA 3AS1A 4U85A 1NH6A 2F23A 1FKRA 1SR0A 1KT1A 3PQHA 4IT6A 1JNTA 1H0GA 4O2TA 3O5GA 2G8ZA 3H9RB 1FKSA 2DSVA 4UDMA 1LG2A 1Q1CA 3KADA 3G6MA 4TW7A 2K8IA 1E9LA 2ETNA 3ARQA 3MDYB 3G6LA 4ODKA 5DO2A 2DSWA 4QIBA 2ESCA 3LKXB 1FJDA 4GLXA 4Z2HA 2RUQA 4Q7NA 5HWBA 4DRNA 4DT4A 1X6LA 4G2PA 4DWSA 1W1PA 4P8VA 3KZ7A 4DRIA 1NWSA 1JVWA 4J4OA 1EG4A 2KFWA 2PPPA 2M08A 3O5MA 4MTVA 2A3AA 3ARWA 2M8IA 4IQCA 4W9PA 3W4RA 3B8SA 4DZ3A 3TCZA 3RM4A 2PPOA 2F2DA 5HW8A 1FKBA 3FSBA 4DRKA 1ZBWA 3FS8A 2XP8A 4AY1A 3O5EA 2RQSA 2P4VA 2F21A 1KFWA 5DIUA 3I6CA 3B7XA 1FFRA 1WAWA 2DK7A 1HJXA 5DF0A 1W1TA 1VF8A 2M8JA 3AS2A 4L72B 3TC5A 1EYMA 4PTMA 4Z2LA 2OWOA 4E5RA 2RUCA 4JFJA 3WL0A 4TW8A 4G50A 1J4IA 2XPBA 4ZPTR 1HJVA 1X6NA 2YAJB 4DIPA 2JV4A 1TK7A 4DRJA 1UR9A 1EG3A 2KO7A 4WKFA 2DSUA 4TNSA 2B5UB 2EULA 3KAGA 4NZCA 2JMFA 1JNEA 2DT0A 1D7JA 4W9OA 1O6IA 4ZS6A 2PV3A 2N87A 1XRVA 1OGBA 3UI4A 3FAPA 2YSGA 1P5QA 2DG3A 4MSPA 3ALFA 4JFLA 5JH8A 1ZB5A 1ZL1A 3ARYA 2DMVA 4QZVB 3PRAA 1GOIA 1C9HA 3IHZA 3O5IA 4HBOA 2MNTA 3ALGA 5GPRA 3PR9A 1W26A 1JCHB 4LAYA 3LUOA 2ZQSA 3KCEA 1HKMA 2PI6A 4R0XA 5DIVA 2ITKA 1D2KA 1W1YA 2PPNA 1TR8A 1E6PA 4S3JA 1FAPA 3GTYX 1D7IA 1KT0A 4WK9A 4HARA 1LQ0A 4L3NA 2WM0A 2Y8NB 1I5HW 1CTNA 5AHTA 2XP6A 4IT4A 2O9OA 5HT1A 2YSHA 1E44A 3WQWA 4ODRA 1FLCA 5E62A 3FSCA 1BL4A 2WADA 2A3CA 2M3OW 2DSZA 4Z2KA 5J6EA 1D6OA 1ZK6A 2DWVA 1FFQA 2L4JA 1QZ2A 2JXWA 1R9HA 3IKGA 4JFMA 2ZAJA 3B9EA 3IK8A 4DWSB 1PINA 1E15A 1U79A 2G41A 2JZVA 2O92A 4NNRA 2IF4A 3B9DA 3FXYA 4TX0A 2IUZA 4URIA 3UI6A 3UQAA 3MCBA 1GRJA 3OOBA 3BXWA 3TDBA 2MLYA 2KI3A 2XP9A 1FKLA 4MNLA 1LL7A 3CHEA 4WKHA 3OA5A 1RD6A 1NWTA 2ZQUA 4ML4A 1BKFA 3KABA 1E6NA 4WIWA 2BA1A 1UR8A 3MQGA 4A0TA 4BF8A 3KAHA 4DRQA 4JYSA 4QT2A 3O5KA 2DT3A 3WD2A 4MNMA 1Q6IA 2ZR5A 2YSFA 1NSGA 2Q5AA 3RM8A 2M2AA 3GPKA 1YATA 3O5OA 1TFVA 3WKZA 4P8WA 1XHGA 4DWSD 5B8IC 2KGJA 3EY6A 5HUAA 4DZ2A 1M5YA 4DRPA 4LAWA 1WMVA 3VAWA 4A0UA 1EDQA 3NRKA 3O5QA 2A3BA 1ZBVA 2MDIA 3ARTA 1W9UA
chains in the Genus database with same CATH topology
3JYJA 2MPHA 1EIBA 3O5LA 1NMVA 3ODKA 2DG9A 2WLZA 1FKKA 3PRBA 2QF8A 3RGCA 3CZ8A 3KAIA 1B6CA 4R5EA 3NTPA 1W1VA 3CHDA 1K9RA 5GQBA 2LPVA 5E65A 2WK2A 4J4NA 4LAVA 1SYTA 4Z2GA 2MLXA 2L2SA 3NI6A 1WB0A 2RSEA 1FD9A 1FKHA 5HW6A 1N1AA 2B31A 2XPAA 4DRHA 2FDMA 2DT2A 3QOKA 3FY1A 2ZR6A 5DEZA 3O5FA 3CGNA 1NWRA 1ROTA 3O5RA 1JNDA 4XAKA 4REXA 1O6WA 2LGOA 4JFKA 1HKKA 1ZBKA 4FN2A 3RFWA 1TCOC 2A3EA 2DPEA 4LAXA 3AQUA 4P8UA 1FKIA 2ZQVA 4QT3A 2QRVA 4ODLA 4MGVA 1K9QA 3WD4A 1HJWA 4DWSC 1LL6A 3CGMA 4IQ2A 3O5JA 5D75A 5E5WA 3B9AA 1GPFA 2ZQTA 2ZR4A 2LJ4A 3O5PA 4TYOA 2VN1A 4ODQA 1OGGA 4WKAA 1E6ZA 1QPFA 2RURA 3KAFA 1J4RA 3ARPA 5HTGA 4KQZA 1FKTA 1L1PA 3ARZA 3AROA 3MCBB 1PBKA 4KR0B 5BXJA 2KR7A 1Q6HA 4W5UA 1FKGA 1HKIA 3CHFA 1F8AB 4ODOA 4FAPA 3PRDA 5HW7A 4U84A 2E45A 2EZ5W 3CHCA 1W9VA 4IPXA 1YW5A 4MNJA 5CQ2A 1T11A 5I98A 1WR7A 1ITXA 2LAJA 3M7NA 5HKGA 4ODMA 3LKXA 1D7HA 1GUVA 4ZPWR 4Z2JA 2JX8A 3WD3A 2OFNA 2LKNA 3LE4A 1FKFA 4Q22A 2RUDA 1JMQA 3ARUA 3ARXA 2YSBA 4P8XA 4S3KA 4MNKA 3WL1A 4MPKA 2WAEA 1EQ3A 1WNOA 1RP5A 2KXQA 4U86A 1FKDA 2YBTA 4HBEA 3CH9A 1Q6UA 3IKDA 1EHNA 1J4HA 3AS3A 4NSBA 2WLYA 1HKJA 2XP3A 3M85A 2YBUA 5U47A 3UI5A 1ZU8A 3RM9A 3WH0A 1LL4A 1ZBCA 4DH0A 2FAPA 3RMEA 2AWGA 3JXVA 2MLZA 3L4HA 1K9TA 4ITZA 4N19A 2YSIA 1FKJA 2D9FA 2XP7A 1LG1A 2PBCA 1LJYA 4WJXA 3JYMA 3WIJA 3ARRA 4ZPVR 3ARSA 4JFIA 3PA7A 4LGXA 1H0IA 2PV1A 3AS0A 2UZ5A 2M1IA 1ZCNA 4ODNA 3UQIA 1E6RA 3WD0A 1W9PA 1IX5A 1NMWA 2Y78A 1Y0OA 3UF8A 3WQVA 2RE3A 3CNGA 2DG4A 2F4EA 2OLHA 4MAVA 2DK1A 4GIVA 4TW6A 1F40A 1J6YA 3UQBA 1NWUA 1A7XA 1QPLA 2MF9A 2XP4A 4DRMA 1ROUA 5HBFA 5HWCA 5GPGA 4GGQA 2PV2A 4ODPA 3ARVA 3MQHA 3O5DA 2DT1A 3WD1A 1HXVA 2XP5A 2VCDA 4Z2IA 1OWQA 2FKEA 3KACA 5E66A 2DJYA 4DROA 2AOSA 2KE0A 5E64A 4C02B 1JNSA 5DITA 4W9QA 3AS1A 4U85A 1NH6A 1FKRA 1SR0A 1KT1A 3PQHA 4IT6A 1JNTA 1H0GA 4O2TA 3O5GA 2G8ZA 3H9RB 1FKSA 2DSVA 1LG2A 1Q1CA 3KADA 3G6MA 4TW7A 2K8IA 1E9LA 3MDYB 3ARQA 4ODKA 3G6LA 5DO2A 2DSWA 4QIBA 2ESCA 3LKXB 1FJDA 4GLXA 4Z2HA 2RUQA 4Q7NA 5HWBA 4DRNA 4DT4A 1X6LA 4G2PA 4DWSA 1W1PA 4P8VA 3KZ7A 4DRIA 1NWSA 1JVWA 4J4OA 1EG4A 2KFWA 2PPPA 2M08A 3O5MA 4MTVA 2A3AA 3ARWA 2M8IA 4IQCA 4W9PA 3W4RA 3B8SA 4DZ3A 3TCZA 3RM4A 2PPOA 2F2DA 5HW8A 1FKBA 3FSBA 4DRKA 1ZBWA 3FS8A 2XP8A 4AY1A 3O5EA 2RQSA 2F21A 1KFWA 5DIUA 3I6CA 3B7XA 1FFRA 1WAWA 2DK7A 1HJXA 5DF0A 1W1TA 1VF8A 2M8JA 3AS2A 4L72B 3TC5A 1EYMA 4PTMA 4Z2LA 2OWOA 4E5RA 2RUCA 4JFJA 3WL0A 4TW8A 4G50A 1J4IA 2XPBA 4ZPTR 1HJVA 1X6NA 2YAJB 4DIPA 2JV4A 1TK7A 4DRJA 1UR9A 1EG3A 2KO7A 4WKFA 2DSUA 4TNSA 3KAGA 4NZCA 2JMFA 1JNEA 2DT0A 1D7JA 4W9OA 1O6IA 4ZS6A 2PV3A 2N87A 1XRVA 1OGBA 3UI4A 3FAPA 2YSGA 1P5QA 2DG3A 4MSPA 3ALFA 4JFLA 5JH8A 1ZB5A 1ZL1A 3ARYA 2DMVA 4QZVB 3PRAA 1GOIA 1C9HA 3IHZA 3O5IA 4HBOA 2MNTA 3ALGA 5GPRA 3PR9A 1W26A 4LAYA 3LUOA 2ZQSA 3KCEA 1HKMA 2PI6A 4R0XA 5DIVA 2ITKA 1D2KA 1W1YA 2PPNA 1TR8A 1E6PA 4S3JA 1FAPA 1D7IA 1KT0A 4WK9A 4HARA 1LQ0A 4L3NA 2WM0A 2Y8NB 1I5HW 1CTNA 5AHTA 2XP6A 4IT4A 2O9OA 5HT1A 2YSHA 3WQWA 4ODRA 1FLCA 5E62A 3FSCA 1BL4A 2WADA 2A3CA 2M3OW 2DSZA 4Z2KA 5J6EA 1D6OA 1ZK6A 2DWVA 1FFQA 2L4JA 1QZ2A 2JXWA 1R9HA 3IKGA 4JFMA 2ZAJA 3B9EA 3IK8A 4DWSB 1PINA 1E15A 1U79A 2G41A 2JZVA 2O92A 4NNRA 2IF4A 3B9DA 3FXYA 4TX0A 2IUZA 4URIA 3UI6A 3UQAA 3MCBA 3OOBA 3BXWA 3TDBA 2MLYA 2KI3A 2XP9A 1FKLA 4MNLA 1LL7A 3CHEA 4WKHA 3OA5A 1RD6A 1NWTA 2ZQUA 4ML4A 1BKFA 3KABA 1E6NA 4WIWA 2BA1A 1UR8A 3MQGA 4A0TA 4BF8A 3KAHA 4DRQA 4JYSA 4QT2A 3O5KA 2DT3A 3WD2A 4MNMA 1Q6IA 2ZR5A 2YSFA 1NSGA 2Q5AA 3RM8A 2M2AA 3GPKA 1YATA 3O5OA 1TFVA 3WKZA 4P8WA 1XHGA 4DWSD 5B8IC 2KGJA 3EY6A 5HUAA 4DZ2A 1M5YA 4DRPA 4LAWA 1WMVA 3VAWA 4A0UA 1EDQA 3NRKA 3O5QA 2A3BA 1ZBVA 2MDIA 3ARTA 1W9UA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3JYJ A;  2MPH A;  3O5L A;  3RGC A;  1NMV A;  3ODK A;  2DG9 A;  1FKK A;  3PRB A;  3KAI A;  1B6C A;  3NTP A;  1K9R A;  2LPV A;  4J4N A;  4LAV A;  2MLX A;  2L2S A;  3NI6 A;  2RSE A;  1FD9 A;  1FKH A;  5HW6 A;  1N1A A;  2XPA A;  4DRH A;  2ZR6 A;  3O5F A;  3CGN A;  1ROT A;  3O5R A;  4REX A;  1O6W A;  2LGO A;  4JFK A;  4FN2 A;  3RFW A;  1TCO C;  4LAX A;  1FKI A;  2ZQV A;  4QT3 A;  4ODL A;  4MGV A;  1K9Q A;  3CGM A;  4IQ2 A;  3O5J A;  5D75 A;  2ZQT A;  2ZR4 A;  2LJ4 A;  3O5P A;  4TYO A;  2VN1 A;  4ODQ A;  1QPF A;  2RUR A;  3KAF A;  1J4R A;  5HTG A;  1FKT A;  1L1P A;  1PBK A;  5BXJ A;  2KR7 A;  1Q6H A;  1FKG A;  4ODO A;  1F8A B;  4FAP A;  3PRD A;  5HW7 A;  4U84 A;  2E45 A;  2EZ5 W;  4IPX A;  1YW5 A;  5CQ2 A;  1T11 A;  5I98 A;  1WR7 A;  2LAJ A;  3M7N A;  5HKG A;  4ODM A;  1D7H A;  2JX8 A;  2OFN A;  2LKN A;  3LE4 A;  1FKF A;  2RUD A;  1JMQ A;  2YSB A;  1EQ3 A;  1FKD A;  2KXQ A;  4U86 A;  1Q6U A;  3IKD A;  1J4H A;  2XP3 A;  3M85 A;  3UI5 A;  3WH0 A;  4DH0 A;  2FAP A;  2AWG A;  3JXV A;  2MLZ A;  3L4H A;  4ITZ A;  4N19 A;  2YSI A;  1FKJ A;  2D9F A;  2XP7 A;  2PBC A;  3JYM A;  4JFI A;  3PA7 A;  2PV1 A;  2UZ5 A;  2M1I A;  1ZCN A;  4ODN A;  3UQI A;  1NMW A;  2Y78 A;  1Y0O A;  3UF8 A;  2RE3 A;  3CNG A;  2DG4 A;  2F4E A;  2DK1 A;  4GIV A;  4TW6 A;  1F40 A;  1J6Y A;  3UQB A;  1A7X A;  1QPL A;  2MF9 A;  2XP4 A;  4DRM A;  1ROU A;  5HWC A;  5GPG A;  4GGQ A;  2PV2 A;  4ODP A;  3O5D A;  1HXV A;  2XP5 A;  2VCD A;  2FKE A;  3KAC A;  2DJY A;  4DRO A;  2KE0 A;  4C02 B;  1JNS A;  5DIT A;  4W9Q A;  4U85 A;  1FKR A;  1KT1 A;  1JNT A;  4O2T A;  3O5G A;  3H9R B;  1FKS A;  1Q1C A;  3KAD A;  4TW7 A;  2K8I A;  3MDY B;  4ODK A;  4QIB A;  1FJD A;  2RUQ A;  5HWB A;  4DRN A;  4DT4 A;  4G2P A;  3KZ7 A;  4DRI A;  1JVW A;  4J4O A;  1EG4 A;  2KFW A;  2PPP A;  2M08 A;  3O5M A;  4IQC A;  4W9P A;  2M8I A;  4DZ3 A;  3TCZ A;  2PPO A;  2F2D A;  5HW8 A;  1FKB A;  4DRK A;  2XP8 A;  3O5E A;  2RQS A;  2F21 A;  5DIU A;  3I6C A;  3B7X A;  2DK7 A;  2M8J A;  3TC5 A;  1EYM A;  4E5R A;  2RUC A;  4JFJ A;  4TW8 A;  4G50 A;  1J4I A;  2XPB A;  4DIP A;  2JV4 A;  1TK7 A;  4DRJ A;  1EG3 A;  2KO7 A;  4TNS A;  3KAG A;  2JMF A;  1D7J A;  4W9O A;  2PV3 A;  2N87 A;  3UI4 A;  3FAP A;  2YSG A;  1P5Q A;  2DG3 A;  4MSP A;  4JFL A;  2DMV A;  1C9H A;  3IHZ A;  3O5I A;  2MNT A;  1W26 A;  4LAY A;  3LUO A;  2ZQS A;  3KCE A;  5DIV A;  4R0X A;  2ITK A;  2PPN A;  1FAP A;  1D7I A;  1KT0 A;  1I5H W;  5AHT A;  2XP6 A;  5HT1 A;  2YSH A;  4ODR A;  1BL4 A;  2M3O W;  5J6E A;  1D6O A;  1ZK6 A;  2DWV A;  2L4J A;  1QZ2 A;  2JXW A;  1R9H A;  3IKG A;  4JFM A;  2ZAJ A;  3IK8 A;  1PIN A;  1U79 A;  2JZV A;  4NNR A;  2IF4 A;  4TX0 A;  3UI6 A;  3UQA A;  3OOB A;  3TDB A;  2MLY A;  2KI3 A;  2XP9 A;  1FKL A;  2ZQU A;  1BKF A;  3KAB A;  2BA1 A;  4BF8 A;  3KAH A;  4DRQ A;  4JYS A;  4QT2 A;  3O5K A;  1Q6I A;  2ZR5 A;  2YSF A;  1NSG A;  2Q5A A;  2M2A A;  3GPK A;  1YAT A;  3O5O A;  5B8I C;  2KGJ A;  3EY6 A;  5HUA A;  4DZ2 A;  1M5Y A;  4DRP A;  4LAW A;  1WMV A;  3VAW A;  3NRK A;  3O5Q A;  2MDI A; 
#chains in the Genus database with same CATH topology
 3JYJ A;  2MPH A;  1EIB A;  3O5L A;  1NMV A;  3ODK A;  2DG9 A;  2WLZ A;  1FKK A;  3PRB A;  2QF8 A;  3RGC A;  3CZ8 A;  3KAI A;  1B6C A;  4R5E A;  3NTP A;  1W1V A;  3CHD A;  1K9R A;  5GQB A;  2LPV A;  5E65 A;  2WK2 A;  4J4N A;  4LAV A;  1SYT A;  4Z2G A;  2MLX A;  2L2S A;  3NI6 A;  1WB0 A;  2RSE A;  1FD9 A;  1FKH A;  5HW6 A;  1N1A A;  2B31 A;  2XPA A;  4DRH A;  2FDM A;  2DT2 A;  3QOK A;  3FY1 A;  2ZR6 A;  5DEZ A;  3O5F A;  3CGN A;  1NWR A;  1ROT A;  3O5R A;  1JND A;  4XAK A;  4REX A;  1O6W A;  2LGO A;  4JFK A;  1HKK A;  1ZBK A;  4FN2 A;  3RFW A;  1TCO C;  2A3E A;  2DPE A;  4LAX A;  3AQU A;  4P8U A;  1FKI A;  2ZQV A;  4QT3 A;  2QRV A;  4ODL A;  4MGV A;  1K9Q A;  3WD4 A;  1HJW A;  4DWS C;  1LL6 A;  3CGM A;  4IQ2 A;  3O5J A;  5D75 A;  5E5W A;  3B9A A;  1GPF A;  2ZQT A;  2ZR4 A;  2LJ4 A;  3O5P A;  4TYO A;  2VN1 A;  4ODQ A;  1OGG A;  3EIP A;  4WKA A;  1E6Z A;  1QPF A;  2RUR A;  3KAF A;  1J4R A;  3ARP A;  5HTG A;  4KQZ A;  1FKT A;  1L1P A;  3ARZ A;  3ARO A;  3MCB B;  1PBK A;  4KR0 B;  5BXJ A;  2KR7 A;  1Q6H A;  3BMB A;  4W5U A;  1FKG A;  1HKI A;  3CHF A;  1F8A B;  4ODO A;  4FAP A;  3PRD A;  5HW7 A;  4U84 A;  2E45 A;  2EZ5 W;  3CHC A;  1W9V A;  4IPX A;  1YW5 A;  4MNJ A;  5CQ2 A;  1T11 A;  5I98 A;  3GU0 A;  1WR7 A;  1ITX A;  2LAJ A;  3M7N A;  5HKG A;  4ODM A;  3LKX A;  1D7H A;  1GUV A;  4ZPW R;  4Z2J A;  2JX8 A;  3WD3 A;  2OFN A;  2LKN A;  3LE4 A;  1FKF A;  4Q22 A;  2RUD A;  1JMQ A;  3ARU A;  3ARX A;  2YSB A;  4P8X A;  4S3K A;  4MNK A;  3WL1 A;  4MPK A;  2WAE A;  1EQ3 A;  1WNO A;  1RP5 A;  2KXQ A;  4U86 A;  1FKD A;  2YBT A;  4HBE A;  3CH9 A;  1Q6U A;  3IKD A;  1EHN A;  1J4H A;  3AS3 A;  4NSB A;  2WLY A;  1HKJ A;  2XP3 A;  3M85 A;  2YBU A;  5U47 A;  3UI5 A;  1ZU8 A;  3RM9 A;  3WH0 A;  1LL4 A;  1ZBC A;  4DH0 A;  2FAP A;  3RME A;  2AWG A;  3JXV A;  2MLZ A;  3L4H A;  1K9T A;  4ITZ A;  4N19 A;  2YSI A;  1FKJ A;  2D9F A;  2XP7 A;  1LG1 A;  2PBC A;  1LJY A;  4WJX A;  3JYM A;  3WIJ A;  3ARR A;  4ZPV R;  3ARS A;  4JFI A;  3PA7 A;  4LGX A;  1H0I A;  2PV1 A;  3AS0 A;  2UZ5 A;  2M1I A;  1ZCN A;  4ODN A;  3UQI A;  1E6R A;  3WD0 A;  1W9P A;  1IX5 A;  1NMW A;  2Y78 A;  1Y0O A;  3UF8 A;  3WQV A;  2RE3 A;  3CNG A;  2DG4 A;  2F4E A;  2OLH A;  4MAV A;  2DK1 A;  4GIV A;  2PN0 A;  4TW6 A;  1F40 A;  1J6Y A;  3UQB A;  1NWU A;  1A7X A;  1QPL A;  2MF9 A;  2XP4 A;  4DRM A;  1ROU A;  5HBF A;  5HWC A;  5GPG A;  4GGQ A;  2PV2 A;  4ODP A;  3ARV A;  3MQH A;  3O5D A;  2DT1 A;  3WD1 A;  1HXV A;  2XP5 A;  2VCD A;  4Z2I A;  1OWQ A;  2FKE A;  3KAC A;  5E66 A;  2DJY A;  4DRO A;  2AOS A;  2KE0 A;  5E64 A;  4C02 B;  1JNS A;  5DIT A;  4W9Q A;  3AS1 A;  4U85 A;  1NH6 A;  2F23 A;  1FKR A;  1SR0 A;  1KT1 A;  3PQH A;  4IT6 A;  1JNT A;  1H0G A;  4O2T A;  3O5G A;  2G8Z A;  3H9R B;  1FKS A;  2DSV A;  4UDM A;  1LG2 A;  1Q1C A;  3KAD A;  3G6M A;  4TW7 A;  2K8I A;  1E9L A;  2ETN A;  3ARQ A;  3MDY B;  3G6L A;  4ODK A;  5DO2 A;  2DSW A;  4QIB A;  2ESC A;  3LKX B;  1FJD A;  4GLX A;  4Z2H A;  2RUQ A;  4Q7N A;  5HWB A;  4DRN A;  4DT4 A;  1X6L A;  4G2P A;  4DWS A;  1W1P A;  4P8V A;  3KZ7 A;  4DRI A;  1NWS A;  1JVW A;  4J4O A;  1EG4 A;  2KFW A;  2PPP A;  2M08 A;  3O5M A;  4MTV A;  2A3A A;  3ARW A;  2M8I A;  4IQC A;  4W9P A;  3W4R A;  3B8S A;  4DZ3 A;  3TCZ A;  3RM4 A;  2PPO A;  2F2D A;  5HW8 A;  1FKB A;  3FSB A;  4DRK A;  1ZBW A;  3FS8 A;  2XP8 A;  4AY1 A;  3O5E A;  2RQS A;  2P4V A;  2F21 A;  1KFW A;  5DIU A;  3I6C A;  3B7X A;  1FFR A;  1WAW A;  2DK7 A;  1HJX A;  5DF0 A;  1W1T A;  1VF8 A;  2M8J A;  3AS2 A;  4L72 B;  3TC5 A;  1EYM A;  4PTM A;  4Z2L A;  2OWO A;  4E5R A;  2RUC A;  4JFJ A;  3WL0 A;  4TW8 A;  4G50 A;  1J4I A;  2XPB A;  4ZPT R;  1HJV A;  1X6N A;  2YAJ B;  4DIP A;  2JV4 A;  1TK7 A;  4DRJ A;  1UR9 A;  1EG3 A;  2KO7 A;  4WKF A;  2DSU A;  4TNS A;  2B5U B;  2EUL A;  3KAG A;  4NZC A;  2JMF A;  1JNE A;  2DT0 A;  1D7J A;  4W9O A;  1O6I A;  4ZS6 A;  2PV3 A;  2N87 A;  1XRV A;  1OGB A;  3UI4 A;  3FAP A;  2YSG A;  1P5Q A;  2DG3 A;  4MSP A;  3ALF A;  4JFL A;  5JH8 A;  1ZB5 A;  1ZL1 A;  3ARY A;  2DMV A;  4QZV B;  3PRA A;  1GOI A;  1C9H A;  3IHZ A;  3O5I A;  4HBO A;  2MNT A;  3ALG A;  5GPR A;  3PR9 A;  1W26 A;  1JCH B;  4LAY A;  3LUO A;  2ZQS A;  3KCE A;  1HKM A;  2PI6 A;  4R0X A;  5DIV A;  2ITK A;  1D2K A;  1W1Y A;  2PPN A;  1TR8 A;  1E6P A;  4S3J A;  1FAP A;  3GTY X;  1D7I A;  1KT0 A;  4WK9 A;  4HAR A;  1LQ0 A;  4L3N A;  2WM0 A;  2Y8N B;  1I5H W;  1CTN A;  5AHT A;  2XP6 A;  4IT4 A;  2O9O A;  5HT1 A;  2YSH A;  1E44 A;  3WQW A;  4ODR A;  1FLC A;  5E62 A;  3FSC A;  1BL4 A;  2WAD A;  2A3C A;  2M3O W;  2DSZ A;  4Z2K A;  5J6E A;  1D6O A;  1ZK6 A;  2DWV A;  1FFQ A;  2L4J A;  1QZ2 A;  2JXW A;  1R9H A;  3IKG A;  4JFM A;  2ZAJ A;  3B9E A;  3IK8 A;  4DWS B;  1PIN A;  1E15 A;  1U79 A;  2G41 A;  2JZV A;  2O92 A;  4NNR A;  2IF4 A;  3B9D A;  3FXY A;  4TX0 A;  2IUZ A;  4URI A;  3UI6 A;  3UQA A;  3MCB A;  1GRJ A;  3OOB A;  3BXW A;  3TDB A;  2MLY A;  2KI3 A;  2XP9 A;  1FKL A;  4MNL A;  1LL7 A;  3CHE A;  4WKH A;  3OA5 A;  1RD6 A;  1NWT A;  2ZQU A;  4ML4 A;  1BKF A;  3KAB A;  1E6N A;  4WIW A;  2BA1 A;  1UR8 A;  3MQG A;  4A0T A;  4BF8 A;  3KAH A;  4DRQ A;  4JYS A;  4QT2 A;  3O5K A;  2DT3 A;  3WD2 A;  4MNM A;  1Q6I A;  2ZR5 A;  2YSF A;  1NSG A;  2Q5A A;  3RM8 A;  2M2A A;  3GPK A;  1YAT A;  3O5O A;  1TFV A;  3WKZ A;  4P8W A;  1XHG A;  4DWS D;  5B8I C;  2KGJ A;  3EY6 A;  5HUA A;  4DZ2 A;  1M5Y A;  4DRP A;  4LAW A;  1WMV A;  3VAW A;  4A0U A;  1EDQ A;  3NRK A;  3O5Q A;  2A3B A;  1ZBV A;  2MDI A;  3ART A;  1W9U A; 
#chains in the Genus database with same CATH homology
 3JYJ A;  2MPH A;  1EIB A;  3O5L A;  1NMV A;  3ODK A;  2DG9 A;  2WLZ A;  1FKK A;  3PRB A;  2QF8 A;  3RGC A;  3CZ8 A;  3KAI A;  1B6C A;  4R5E A;  3NTP A;  1W1V A;  3CHD A;  1K9R A;  5GQB A;  2LPV A;  5E65 A;  2WK2 A;  4J4N A;  4LAV A;  1SYT A;  4Z2G A;  2MLX A;  2L2S A;  3NI6 A;  1WB0 A;  2RSE A;  1FD9 A;  1FKH A;  5HW6 A;  1N1A A;  2B31 A;  2XPA A;  4DRH A;  2FDM A;  2DT2 A;  3QOK A;  3FY1 A;  2ZR6 A;  5DEZ A;  3O5F A;  3CGN A;  1NWR A;  1ROT A;  3O5R A;  1JND A;  4XAK A;  4REX A;  1O6W A;  2LGO A;  4JFK A;  1HKK A;  1ZBK A;  4FN2 A;  3RFW A;  1TCO C;  2A3E A;  2DPE A;  4LAX A;  3AQU A;  4P8U A;  1FKI A;  2ZQV A;  4QT3 A;  2QRV A;  4ODL A;  4MGV A;  1K9Q A;  3WD4 A;  1HJW A;  4DWS C;  1LL6 A;  3CGM A;  4IQ2 A;  3O5J A;  5D75 A;  5E5W A;  3B9A A;  1GPF A;  2ZQT A;  2ZR4 A;  2LJ4 A;  3O5P A;  4TYO A;  2VN1 A;  4ODQ A;  1OGG A;  4WKA A;  1E6Z A;  1QPF A;  2RUR A;  3KAF A;  1J4R A;  3ARP A;  5HTG A;  4KQZ A;  1FKT A;  1L1P A;  3ARZ A;  3ARO A;  3MCB B;  1PBK A;  4KR0 B;  5BXJ A;  2KR7 A;  1Q6H A;  4W5U A;  1FKG A;  1HKI A;  3CHF A;  1F8A B;  4ODO A;  4FAP A;  3PRD A;  5HW7 A;  4U84 A;  2E45 A;  2EZ5 W;  3CHC A;  1W9V A;  4IPX A;  1YW5 A;  4MNJ A;  5CQ2 A;  1T11 A;  5I98 A;  1WR7 A;  1ITX A;  2LAJ A;  3M7N A;  5HKG A;  4ODM A;  3LKX A;  1D7H A;  1GUV A;  4ZPW R;  4Z2J A;  2JX8 A;  3WD3 A;  2OFN A;  2LKN A;  3LE4 A;  1FKF A;  4Q22 A;  2RUD A;  1JMQ A;  3ARU A;  3ARX A;  2YSB A;  4P8X A;  4S3K A;  4MNK A;  3WL1 A;  4MPK A;  2WAE A;  1EQ3 A;  1WNO A;  1RP5 A;  2KXQ A;  4U86 A;  1FKD A;  2YBT A;  4HBE A;  3CH9 A;  1Q6U A;  3IKD A;  1EHN A;  1J4H A;  3AS3 A;  4NSB A;  2WLY A;  1HKJ A;  2XP3 A;  3M85 A;  2YBU A;  5U47 A;  3UI5 A;  1ZU8 A;  3RM9 A;  3WH0 A;  1LL4 A;  1ZBC A;  4DH0 A;  2FAP A;  3RME A;  2AWG A;  3JXV A;  2MLZ A;  3L4H A;  1K9T A;  4ITZ A;  4N19 A;  2YSI A;  1FKJ A;  2D9F A;  2XP7 A;  1LG1 A;  2PBC A;  1LJY A;  4WJX A;  3JYM A;  3WIJ A;  3ARR A;  4ZPV R;  3ARS A;  4JFI A;  3PA7 A;  4LGX A;  1H0I A;  2PV1 A;  3AS0 A;  2UZ5 A;  2M1I A;  1ZCN A;  4ODN A;  3UQI A;  1E6R A;  3WD0 A;  1W9P A;  1IX5 A;  1NMW A;  2Y78 A;  1Y0O A;  3UF8 A;  3WQV A;  2RE3 A;  3CNG A;  2DG4 A;  2F4E A;  2OLH A;  4MAV A;  2DK1 A;  4GIV A;  4TW6 A;  1F40 A;  1J6Y A;  3UQB A;  1NWU A;  1A7X A;  1QPL A;  2MF9 A;  2XP4 A;  4DRM A;  1ROU A;  5HBF A;  5HWC A;  5GPG A;  4GGQ A;  2PV2 A;  4ODP A;  3ARV A;  3MQH A;  3O5D A;  2DT1 A;  3WD1 A;  1HXV A;  2XP5 A;  2VCD A;  4Z2I A;  1OWQ A;  2FKE A;  3KAC A;  5E66 A;  2DJY A;  4DRO A;  2AOS A;  2KE0 A;  5E64 A;  4C02 B;  1JNS A;  5DIT A;  4W9Q A;  3AS1 A;  4U85 A;  1NH6 A;  1FKR A;  1SR0 A;  1KT1 A;  3PQH A;  4IT6 A;  1JNT A;  1H0G A;  4O2T A;  3O5G A;  2G8Z A;  3H9R B;  1FKS A;  2DSV A;  1LG2 A;  1Q1C A;  3KAD A;  3G6M A;  4TW7 A;  2K8I A;  1E9L A;  3MDY B;  3ARQ A;  4ODK A;  3G6L A;  5DO2 A;  2DSW A;  4QIB A;  2ESC A;  3LKX B;  1FJD A;  4GLX A;  4Z2H A;  2RUQ A;  4Q7N A;  5HWB A;  4DRN A;  4DT4 A;  1X6L A;  4G2P A;  4DWS A;  1W1P A;  4P8V A;  3KZ7 A;  4DRI A;  1NWS A;  1JVW A;  4J4O A;  1EG4 A;  2KFW A;  2PPP A;  2M08 A;  3O5M A;  4MTV A;  2A3A A;  3ARW A;  2M8I A;  4IQC A;  4W9P A;  3W4R A;  3B8S A;  4DZ3 A;  3TCZ A;  3RM4 A;  2PPO A;  2F2D A;  5HW8 A;  1FKB A;  3FSB A;  4DRK A;  1ZBW A;  3FS8 A;  2XP8 A;  4AY1 A;  3O5E A;  2RQS A;  2F21 A;  1KFW A;  5DIU A;  3I6C A;  3B7X A;  1FFR A;  1WAW A;  2DK7 A;  1HJX A;  5DF0 A;  1W1T A;  1VF8 A;  2M8J A;  3AS2 A;  4L72 B;  3TC5 A;  1EYM A;  4PTM A;  4Z2L A;  2OWO A;  4E5R A;  2RUC A;  4JFJ A;  3WL0 A;  4TW8 A;  4G50 A;  1J4I A;  2XPB A;  4ZPT R;  1HJV A;  1X6N A;  2YAJ B;  4DIP A;  2JV4 A;  1TK7 A;  4DRJ A;  1UR9 A;  1EG3 A;  2KO7 A;  4WKF A;  2DSU A;  4TNS A;  3KAG A;  4NZC A;  2JMF A;  1JNE A;  2DT0 A;  1D7J A;  4W9O A;  1O6I A;  4ZS6 A;  2PV3 A;  2N87 A;  1XRV A;  1OGB A;  3UI4 A;  3FAP A;  2YSG A;  1P5Q A;  2DG3 A;  4MSP A;  3ALF A;  4JFL A;  5JH8 A;  1ZB5 A;  1ZL1 A;  3ARY A;  2DMV A;  4QZV B;  3PRA A;  1GOI A;  1C9H A;  3IHZ A;  3O5I A;  4HBO A;  2MNT A;  3ALG A;  5GPR A;  3PR9 A;  1W26 A;  4LAY A;  3LUO A;  2ZQS A;  3KCE A;  1HKM A;  2PI6 A;  4R0X A;  5DIV A;  2ITK A;  1D2K A;  1W1Y A;  2PPN A;  1TR8 A;  1E6P A;  4S3J A;  1FAP A;  1D7I A;  1KT0 A;  4WK9 A;  4HAR A;  1LQ0 A;  4L3N A;  2WM0 A;  2Y8N B;  1I5H W;  1CTN A;  5AHT A;  2XP6 A;  4IT4 A;  2O9O A;  5HT1 A;  2YSH A;  3WQW A;  4ODR A;  1FLC A;  5E62 A;  3FSC A;  1BL4 A;  2WAD A;  2A3C A;  2M3O W;  2DSZ A;  4Z2K A;  5J6E A;  1D6O A;  1ZK6 A;  2DWV A;  1FFQ A;  2L4J A;  1QZ2 A;  2JXW A;  1R9H A;  3IKG A;  4JFM A;  2ZAJ A;  3B9E A;  3IK8 A;  4DWS B;  1PIN A;  1E15 A;  1U79 A;  2G41 A;  2JZV A;  2O92 A;  4NNR A;  2IF4 A;  3B9D A;  3FXY A;  4TX0 A;  2IUZ A;  4URI A;  3UI6 A;  3UQA A;  3MCB A;  3OOB A;  3BXW A;  3TDB A;  2MLY A;  2KI3 A;  2XP9 A;  1FKL A;  4MNL A;  1LL7 A;  3CHE A;  4WKH A;  3OA5 A;  1RD6 A;  1NWT A;  2ZQU A;  4ML4 A;  1BKF A;  3KAB A;  1E6N A;  4WIW A;  2BA1 A;  1UR8 A;  3MQG A;  4A0T A;  4BF8 A;  3KAH A;  4DRQ A;  4JYS A;  4QT2 A;  3O5K A;  2DT3 A;  3WD2 A;  4MNM A;  1Q6I A;  2ZR5 A;  2YSF A;  1NSG A;  2Q5A A;  3RM8 A;  2M2A A;  3GPK A;  1YAT A;  3O5O A;  1TFV A;  3WKZ A;  4P8W A;  1XHG A;  4DWS D;  5B8I C;  2KGJ A;  3EY6 A;  5HUA A;  4DZ2 A;  1M5Y A;  4DRP A;  4LAW A;  1WMV A;  3VAW A;  4A0U A;  1EDQ A;  3NRK A;  3O5Q A;  2A3B A;  1ZBV A;  2MDI A;  3ART A;  1W9U A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...