2ZQSA

Crystal structure of a mutant pin1 peptidyl-prolyl cis-trans isomerase
Total Genus 42
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
42
sequence length
158
structure length
153
Chain Sequence
KLPPGWEKRMSRSSGRVYYFNHITNASQWERPSGGKNGQGEPARVRCSHLLVKHSQSRRPSSWRQEKITRTKEEALELINGYIQKIKSGEEDFESLASQFSDASSAKARGDLGAFSRGQMQKPFEDASFALRTGEMSGPVFTDSGIHIILRTE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural studies on PIN1 mutants
rcsb
source organism Homo sapiens
molecule tags Isomerase
molecule keywords Peptidyl-prolyl cis-trans isomerase NIMA-interacting 1
total genus 42
structure length 153
sequence length 158
ec nomenclature ec 5.2.1.8: Peptidylprolyl isomerase.
pdb deposition date 2008-08-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00397 WW WW domain
A PF00639 Rotamase PPIC-type PPIASE domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.20.70.10 Mainly Beta Single Sheet Ubiquitin Ligase Nedd4; Chain: W; Ubiquitin Ligase Nedd4; Chain: W; 2zqsA01
3.10.50.40 Alpha Beta Roll Chitinase A; domain 3 Chitinase A; domain 3 2zqsA02
1BL4A 3UQBA 2RQSA 5CQ2A 2KE0A 1PBKA 1KT1A 3UI6A 1I5HW 4IPXA 3NI6A 3KABA 2RSEA 2LGOA 4ODRA 1FKDA 4U85A 3LUOA 1FJDA 2ITKA 2DK1A 1TK7A 2LAJA 2L2SA 4JFKA 4DH0A 4JFMA 1C9HA 4BF8A 2Y78A 1J4RA 2PBCA 1EG4A 1J4HA 2PPOA 2M8JA 4ITZA 2MNTA 1QPFA 4LAXA 2RE3A 4DRPA 1NSGA 2L4JA 2XP8A 3TC5A 1ZK6A 5HTGA 1EG3A 1FKSA 2RURA 4JYSA 3O5JA 1J4IA 2XP7A 3O5PA 1YW5A 3IHZA 2ZR4A 1QPLA 1FKIA 1NMWA 3O5EA 2XPAA 1A7XA 3JYJA 2XP4A 4G50A 4IQ2A 3UQAA 3IK8A 1M5YA 3RGCA 3M85A 2DG3A 4FAPA 1O6WA 2LJ4A 4DRNA 2YSHA 2Q5AA 3LE4A 3O5RA 1JNSA 3KZ7A 2M8IA 2ZQUA 2XP5A 2M1IA 5HWBA 2PV3A 4ODLA 4ODNA 3UI5A 4DRMA 1ZCNA 2F21A 2IF4A 4TW6A 1BKFA 2M08A 3EY6A 4TX0A 1HXVA 2JV4A 4DIPA 1WMVA 2YSBA 2F2DA 3KAFA 2LPVA 2MLXA 5HW6A 4DROA 2MLZA 2DMVA 3KACA 1K9RA 4QIBA 1TCOC 3CGNA 1Q6IA 1FKHA 1Q1CA 2PPPA 3O5IA 4FN2A 5DIUA 3RFWA 3O5DA 1L1PA 2YSFA 3KCEA 4TNSA 4MGVA 5HKGA 3O5QA 4G2PA 4ODOA 2MPHA 1KT0A 4N19A 2XP3A 1FKLA 2M2AA 4LAWA 1F40A 3L4HA 4REXA 2AWGA 1FAPA 2DJYA 4TW7A 5B8IC 1JMQA 3OOBA 1D7JA 3IKDA 4W9QA 4W9PA 2MLYA 4NNRA 2JZVA 4MSPA 2ZAJA 3KADA 4TYOA 5D75A 3WH0A 2ZQVA 2MF9A 1D7IA 4DRKA 1FKRA 3I6CA 2PV1A 2VCDA 4DRIA 5J6EA 2VN1A 3TCZA 2DK7A 1K9QA 4TW8A 2KXQA 3KAHA 5DIVA 2XP9A 2ZQTA 5AHTA 4E5RA 2ZR5A 3O5OA 4LAVA 1FD9A 4DZ3A 1R9HA 3B7XA 1U79A 3FAPA 3VAWA 3CGMA 4GIVA 4ODKA 5GPGA 3O5LA 1FKTA 2K8IA 4O2TA 4DRJA 4IQCA 2MDIA 1Q6HA 2FAPA 2KGJA 2UZ5A 1D6OA 4W9OA 3KAIA 5HW8A 2M3OW 2ZQSA 1FKKA 1YATA 2KI3A 2LKNA 1FKGA 3GPKA 3PA7A 4ODQA 3UF8A 4DRQA 3UI4A 2EZ5W 2JX8A 3H9RB 2KR7A 4DZ2A 1P5QA 1T11A 3IKGA 5I98A 2YSIA 3PRDA 2ZR6A 3UQIA 1B6CA 4U86A 1JNTA 1EQ3A 1PINA 1ROUA 2KFWA 3JXVA 3O5MA 2OFNA 4U84A 2RUDA 4GGQA 4LAYA 2DG9A 2DWVA 2YSGA 4QT2A 4DRHA 1W26A 1Y0OA 2D9FA 2RUCA 5HT1A 3NRKA 2E45A 1F8AB 5DITA 5HW7A 3O5GA 4J4NA 2XPBA 2RUQA 1FKJA 4JFLA 4R0XA 5HWCA 2FKEA 1QZ2A 2JMFA 4JFIA 1D7HA 3CNGA 5BXJA 4ODMA 4DT4A 2BA1A 2PPNA 1FKBA 3JYMA 1NMVA 2JXWA 5HUAA 1JVWA 2N87A 3MDYB 3O5FA 4QT3A 1Q6UA 4J4OA 1ROTA 4C02B 2XP6A 3ODKA 3O5KA 1N1AA 1EYMA 2KO7A 1J6YA 1FKFA 3M7NA 1WR7A 3KAGA 3TDBA 2PV2A 3PRBA 2F4EA 4JFJA 2DG4A 3NTPA 4ODPA
chains in the Genus database with same CATH superfamily
4HBEA 1KT1A 1I5HW 3AS1A 4IPXA 2RSEA 4ODRA 4U85A 1JNDA 1TK7A 3G6MA 4BF8A 2WADA 2A3CA 2XP8A 1O6IA 2PN0A 1WAWA 3IHZA 1FKIA 1NMWA 4G50A 3FSCA 3B9DA 1HKKA 1M5YA 2A3AA 3LE4A 3KZ7A 2XP5A 4MNJA 2M08A 4TX0A 2JV4A 3WD0A 2O92A 4DROA 5E65A 2DT3A 2PPPA 3O5IA 3ARPA 4FN2A 5DIUA 3KCEA 4URIA 4MGVA 4P8XA 4ODOA 1KT0A 4NZCA 1CTNA 5E62A 1FKLA 3L4HA 1LL7A 3IKDA 4W9PA 2Y8NB 5D75A 3KADA 4DRKA 3WH0A 2PV1A 2VCDA 4TW8A 2KXQA 3PR9A 1ZBKA 3AQUA 2A3EA 3FSBA 3CH9A 4LAVA 4DZ3A 1R9HA 2EULA 1NWRA 1U79A 3FS8A 5GPGA 1ZB5A 4O2TA 4DRJA 5DF0A 4W9OA 4MAVA 1FKKA 4ODQA 3WL0A 3RM4A 2DSUA 1T11A 1NWTA 3FXYA 1D2KA 3PRDA 2ZR6A 3CHFA 1B6CA 4U86A 1JNTA 1EQ3A 3O5MA 2DWVA 2YSGA 2WK2A 3AS0A 2D9FA 1NWSA 3NRKA 4P8UA 4KR0B 3O5GA 5HWCA 2RUQA 2WLZA 4R0XA 1QZ2A 4JFIA 4WIWA 2YBTA 4DWSA 2BA1A 1W1PA 4GLXA 4LGXA 4PTMA 2JXWA 5HUAA 3MDYB 1W9PA 1OGBA 2A3BA 5DO2A 1N1AA 1J6YA 1FKFA 2PV2A 4JFJA 2F4EA 5HWBA 1E6NA 4R5EA 3UQBA 1W1VA 1ITXA 1W9VA 3UI6A 3NI6A 1FKRA 2LGOA 1LL4A 1OGGA 2WLYA 4JFKA 4ZPTR 1SYTA 2Y78A 4ITZA 3ARZA 4LAXA 5HTGA 1X6LA 1FKSA 1LJYA 2DSZA 4JYSA 2XP7A 4XAKA 2YAJB 2ZR4A 1LG2A 1FFQA 1QPLA 1F40A 2XP4A 2IUZA 4Z2JA 3IK8A 2DPEA 2DG3A 1O6WA 2YSHA 2ETNA 2M8IA 3ARRA 4DRMA 2IF4A 4WKAA 1BKFA 4NSBA 2QF8A 4DIPA 1WMVA 3MCBB 2F2DA 2LPVA 2MLXA 3ARTA 5HW6A 3CHDA 2DT2A 3QOKA 1SR0A 4QIBA 3RFWA 1K9TA 2YSFA 1HKMA 4TNSA 4G2PA 2MPHA 3AS2A 1X6NA 5GQBA 1W9UA 1H0IA 4W9QA 4NNRA 2JZVA 2ZAJA 2MF9A 1NH6A 5J6EA 3WIJA 3KAHA 5DIVA 2XP9A 2OLHA 2ZQTA 2AOSA 3CHCA 3PRAA 1FD9A 3CGMA 3O5LA 2K8IA 1E44A 1Q6HA 2UZ5A 2KGJA 1D6OA 4DWSC 3EIPA 3WD2A 2M3OW 1E6ZA 3PA7A 2P4VA 3ALGA 4QZVB 2EZ5W 3UI4A 4DZ2A 1P5QA 3IKGA 3UQIA 3RM8A 3JXVA 4LAYA 4Z2KA 2RUDA 2DG9A 1Y0OA 5HT1A 1IX5A 1LL6A 2XPBA 4WJXA 3WKZA 4Z2GA 2O9OA 1GUVA 2PPNA 3ARVA 1FKBA 1NMVA 3ARXA 4J4OA 1NWUA 2XP6A 3GU0A 1EYMA 1GRJA 3M7NA 3KAGA 3TDBA 4ODPA 3PRBA 1K9QA 1ZU8A 4HARA 2RQSA 5CQ2A 1WNOA 3KABA 3LUOA 4W5UA 3LKXA 2ITKA 1JNSA 4JFMA 1J4RA 2DSWA 1EG4A 1J4HA 2PPOA 2M8JA 1H0GA 4DRPA 1QPFA 2RE3A 3MQHA 4WKHA 2L4JA 2OWOA 1EG3A 2RURA 1E6PA 1ZBWA 3O5PA 3O5EA 4ML4A 3JYJA 3UQAA 5E64A 2G8ZA 1EDQA 3RGCA 4DWSB 4L3NA 4MPKA 2Q5AA 3O5RA 2ZQUA 4Z2IA 2PV3A 4ODLA 2F21A 4TW6A 4IT4A 1HXVA 3B8SA 3WD1A 1UR9A 3KAFA 1E6RA 1GOIA 2MLZA 3OA5A 3KACA 1ZL1A 1Q6IA 1FKHA 1Q1CA 1LQ0A 1EIBA 3O5DA 3CHEA 5HBFA 5E5WA 1L1PA 4Z2HA 3O5QA 4ZPWR 4N19A 2XP3A 3BMBA 3CZ8A 4LAWA 4REXA 2AWGA 1FAPA 2DJYA 4TW7A 1JMQA 3OOBA 3ARUA 1D7JA 2MLYA 1HJVA 3RMEA 1TR8A 2DT0A 1OWQA 1D7IA 4KQZA 3TCZA 2DK7A 4Z2LA 5AHTA 4A0TA 4E5RA 3FY1A 2G41A 3ARYA 3FAPA 3MCBA 4GIVA 4MNKA 4ODKA 1FKTA 4A0UA 2MDIA 4S3KA 2FAPA 3KAIA 5HW8A 2QRVA 1JCHB 2KI3A 4DRQA 2JX8A 5I98A 4L72B 2YSIA 4ZS6A 1ROUA 4GGQA 3LKXB 2DSVA 4QT2A 1W26A 2RUCA 2E45A 5HW7A 1FFRA 4J4NA 1ZBVA 1FKJA 2FDMA 2DT1A 1D7HA 4ODMA 4DT4A 3ALFA 3WD3A 3PQHA 2N87A 4QT3A 4UDMA 5DEZA 1ROTA 4C02B 4P8VA 3O5KA 1HJWA 1KFWA 3WQWA 3NTPA 3B9EA 1BL4A 2KE0A 1PBKA 4AY1A 4WKFA 1FKDA 1FJDA 2DK1A 2LAJA 2L2SA 4HBOA 4DH0A 1FLCA 1C9HA 1HJXA 2PBCA 2YBUA 2MNTA 4WK9A 4DWSD 1NSGA 5GPRA 3TC5A 1ZK6A 3B9AA 1HKJA 3RM9A 3O5JA 1J4IA 1YW5A 4IQ2A 2XPAA 1A7XA 1HKIA 3M85A 3ARSA 4FAPA 2LJ4A 4DRNA 1XHGA 2ESCA 3ARWA 5E66A 2M1IA 1RP5A 3ARQA 4ODNA 2B5UB 3UI5A 1ZCNA 4MNLA 3EY6A 1RD6A 1WB0A 2YSBA 4Q7NA 4Q22A 1VF8A 2DMVA 4IT6A 1JNEA 1K9RA 1TCOC 3CGNA 5HKGA 1W1YA 4P8WA 2M2AA 3WQVA 5B8IC 5JH8A 4MSPA 4TYOA 3W4RA 1EHNA 2ZQVA 3I6CA 4DRIA 2WM0A 2VN1A 1TFVA 2ZR5A 3O5OA 1W1TA 3B7XA 3VAWA 3GTYX 3WD4A 4IQCA 1UR8A 2ZQSA 1YATA 2LKNA 2F23A 1FKGA 3GPKA 3UF8A 3H9RB 2KR7A 1E9LA 2PI6A 3BXWA 1PINA 5U47A 2KFWA 4MNMA 2WAEA 2OFNA 4U84A 4MTVA 4ZPVR 4DRHA 1F8AB 5DITA 4JFLA 3MQGA 3G6LA 3WL1A 2FKEA 5BXJA 2JMFA 3CNGA 1LG1A 4S3JA 1GPFA 3JYMA 1JVWA 3O5FA 1Q6UA 3AROA 1ZBCA 3ODKA 1E15A 2KO7A 3AS3A 1WR7A 1XRVA 2B31A 2DG4A
chains in the Genus database with same CATH topology
4HBEA 1KT1A 1I5HW 3AS1A 4IPXA 2RSEA 4ODRA 4U85A 1JNDA 1TK7A 3G6MA 4BF8A 2WADA 2A3CA 2XP8A 1O6IA 1WAWA 3IHZA 1FKIA 1NMWA 4G50A 3FSCA 3B9DA 1HKKA 1M5YA 2A3AA 3LE4A 3KZ7A 2XP5A 4MNJA 2M08A 4TX0A 2JV4A 3WD0A 2O92A 4DROA 5E65A 2DT3A 2PPPA 3O5IA 3ARPA 4FN2A 5DIUA 3KCEA 4URIA 4MGVA 4P8XA 4ODOA 1KT0A 4NZCA 1CTNA 5E62A 1FKLA 3L4HA 1LL7A 3IKDA 4W9PA 2Y8NB 5D75A 3KADA 4DRKA 3WH0A 2PV1A 2VCDA 4TW8A 2KXQA 3PR9A 1ZBKA 3AQUA 2A3EA 3FSBA 3CH9A 4LAVA 4DZ3A 1R9HA 1NWRA 1U79A 3FS8A 5GPGA 1ZB5A 4O2TA 4DRJA 5DF0A 4W9OA 4MAVA 1FKKA 4ODQA 3WL0A 3RM4A 2DSUA 1T11A 1NWTA 3FXYA 1D2KA 3PRDA 2ZR6A 3CHFA 1B6CA 4U86A 1JNTA 1EQ3A 3O5MA 2DWVA 2YSGA 2WK2A 3AS0A 2D9FA 1NWSA 3NRKA 4P8UA 4KR0B 3O5GA 5HWCA 2RUQA 2WLZA 4R0XA 1QZ2A 4JFIA 4WIWA 2YBTA 4DWSA 2BA1A 1W1PA 4GLXA 4LGXA 4PTMA 2JXWA 5HUAA 3MDYB 1W9PA 1OGBA 2A3BA 5DO2A 1N1AA 1J6YA 1FKFA 2PV2A 4JFJA 2F4EA 5HWBA 1E6NA 4R5EA 3UQBA 1W1VA 1ITXA 1W9VA 3UI6A 3NI6A 1FKRA 2LGOA 1LL4A 1OGGA 2WLYA 4JFKA 4ZPTR 1SYTA 2Y78A 4ITZA 3ARZA 4LAXA 5HTGA 1X6LA 1FKSA 1LJYA 2DSZA 4JYSA 2XP7A 4XAKA 2YAJB 2ZR4A 1LG2A 1FFQA 1QPLA 1F40A 2XP4A 2IUZA 4Z2JA 3IK8A 2DPEA 2DG3A 1O6WA 2YSHA 2M8IA 3ARRA 4DRMA 2IF4A 4WKAA 1BKFA 4NSBA 2QF8A 4DIPA 1WMVA 3MCBB 2F2DA 2LPVA 2MLXA 3ARTA 5HW6A 3CHDA 2DT2A 3QOKA 1SR0A 4QIBA 3RFWA 1K9TA 2YSFA 1HKMA 4TNSA 4G2PA 2MPHA 3AS2A 1X6NA 5GQBA 1W9UA 1H0IA 4W9QA 4NNRA 2JZVA 2ZAJA 2MF9A 1NH6A 5J6EA 3WIJA 3KAHA 5DIVA 2XP9A 2OLHA 2ZQTA 2AOSA 3CHCA 3PRAA 1FD9A 3CGMA 3O5LA 2K8IA 2UZ5A 1Q6HA 2KGJA 1D6OA 4DWSC 3WD2A 2M3OW 1E6ZA 3PA7A 3ALGA 4QZVB 2EZ5W 3UI4A 4DZ2A 1P5QA 3IKGA 3UQIA 3RM8A 3JXVA 4LAYA 4Z2KA 2RUDA 2DG9A 1Y0OA 5HT1A 1IX5A 1LL6A 2XPBA 4WJXA 3WKZA 4Z2GA 2O9OA 1GUVA 2PPNA 3ARVA 1FKBA 1NMVA 3ARXA 4J4OA 1NWUA 2XP6A 1EYMA 3M7NA 3KAGA 3TDBA 4ODPA 3PRBA 1K9QA 1ZU8A 4HARA 2RQSA 5CQ2A 1WNOA 3KABA 3LUOA 4W5UA 3LKXA 2ITKA 1JNSA 4JFMA 1J4RA 2DSWA 1EG4A 1J4HA 2PPOA 2M8JA 1H0GA 4DRPA 1QPFA 2RE3A 3MQHA 4WKHA 2L4JA 2OWOA 1EG3A 2RURA 1E6PA 1ZBWA 3O5PA 3O5EA 4ML4A 3JYJA 3UQAA 5E64A 2G8ZA 1EDQA 3RGCA 4DWSB 4L3NA 4MPKA 2Q5AA 3O5RA 2ZQUA 4Z2IA 2PV3A 4ODLA 2F21A 4TW6A 4IT4A 1HXVA 3B8SA 3WD1A 1UR9A 3KAFA 1E6RA 1GOIA 2MLZA 3OA5A 3KACA 1ZL1A 1Q6IA 1FKHA 1Q1CA 1LQ0A 1EIBA 3O5DA 3CHEA 5HBFA 5E5WA 1L1PA 4Z2HA 3O5QA 4ZPWR 4N19A 2XP3A 3CZ8A 4LAWA 4REXA 2AWGA 1FAPA 2DJYA 4TW7A 1JMQA 3OOBA 3ARUA 1D7JA 2MLYA 1HJVA 3RMEA 1TR8A 2DT0A 1OWQA 1D7IA 4KQZA 3TCZA 2DK7A 4Z2LA 5AHTA 4A0TA 4E5RA 3FY1A 2G41A 3ARYA 3FAPA 3MCBA 4GIVA 4MNKA 4ODKA 1FKTA 4A0UA 2MDIA 4S3KA 2FAPA 3KAIA 5HW8A 2QRVA 2KI3A 4DRQA 2JX8A 5I98A 4L72B 2YSIA 4ZS6A 1ROUA 4GGQA 3LKXB 2DSVA 4QT2A 1W26A 2RUCA 2E45A 5HW7A 1FFRA 4J4NA 1ZBVA 1FKJA 2FDMA 2DT1A 1D7HA 4ODMA 4DT4A 3ALFA 3WD3A 3PQHA 2N87A 4QT3A 5DEZA 1ROTA 4C02B 4P8VA 3O5KA 1HJWA 1KFWA 3WQWA 3NTPA 3B9EA 1BL4A 2KE0A 1PBKA 4AY1A 4WKFA 1FKDA 1FJDA 2DK1A 2LAJA 2L2SA 4HBOA 4DH0A 1FLCA 1C9HA 1HJXA 2PBCA 2YBUA 2MNTA 4WK9A 4DWSD 1NSGA 5GPRA 3TC5A 1ZK6A 3B9AA 1HKJA 3RM9A 3O5JA 1J4IA 1YW5A 4IQ2A 2XPAA 1A7XA 1HKIA 3M85A 3ARSA 4FAPA 2LJ4A 4DRNA 1XHGA 2ESCA 3ARWA 5E66A 2M1IA 1RP5A 3ARQA 4ODNA 3UI5A 1ZCNA 4MNLA 3EY6A 1RD6A 1WB0A 2YSBA 4Q7NA 4Q22A 1VF8A 2DMVA 4IT6A 1JNEA 1K9RA 1TCOC 3CGNA 5HKGA 1W1YA 4P8WA 2M2AA 3WQVA 5B8IC 5JH8A 4MSPA 4TYOA 3W4RA 1EHNA 2ZQVA 3I6CA 4DRIA 2WM0A 2VN1A 1TFVA 2ZR5A 3O5OA 1W1TA 3B7XA 3VAWA 3WD4A 4IQCA 1UR8A 2ZQSA 1YATA 2LKNA 3GPKA 1FKGA 3UF8A 3H9RB 2KR7A 1E9LA 2PI6A 3BXWA 1PINA 5U47A 2KFWA 4MNMA 2WAEA 2OFNA 4U84A 4MTVA 4ZPVR 4DRHA 1F8AB 5DITA 4JFLA 3MQGA 3G6LA 3WL1A 2FKEA 5BXJA 2JMFA 3CNGA 1LG1A 4S3JA 1GPFA 3JYMA 1JVWA 3O5FA 1Q6UA 3AROA 1ZBCA 3ODKA 1E15A 2KO7A 3AS3A 1WR7A 1XRVA 2B31A 2DG4A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1BL4 A;  3UQB A;  2RQS A;  5CQ2 A;  2KE0 A;  1PBK A;  1KT1 A;  3UI6 A;  1I5H W;  4IPX A;  3NI6 A;  3KAB A;  2RSE A;  2LGO A;  4ODR A;  1FKD A;  4U85 A;  3LUO A;  1FJD A;  2ITK A;  2DK1 A;  1TK7 A;  2LAJ A;  2L2S A;  4JFK A;  4DH0 A;  4JFM A;  1C9H A;  4BF8 A;  2Y78 A;  1J4R A;  2PBC A;  1EG4 A;  1J4H A;  2PPO A;  2M8J A;  4ITZ A;  2MNT A;  1QPF A;  4LAX A;  2RE3 A;  4DRP A;  1NSG A;  2L4J A;  2XP8 A;  3TC5 A;  1ZK6 A;  5HTG A;  1EG3 A;  1FKS A;  2RUR A;  4JYS A;  3O5J A;  1J4I A;  2XP7 A;  3O5P A;  1YW5 A;  3IHZ A;  2ZR4 A;  1QPL A;  1FKI A;  1NMW A;  3O5E A;  2XPA A;  1A7X A;  3JYJ A;  2XP4 A;  4G50 A;  4IQ2 A;  3UQA A;  3IK8 A;  1M5Y A;  3RGC A;  3M85 A;  2DG3 A;  4FAP A;  1O6W A;  2LJ4 A;  4DRN A;  2YSH A;  2Q5A A;  3LE4 A;  3O5R A;  1JNS A;  3KZ7 A;  2M8I A;  2ZQU A;  2XP5 A;  2M1I A;  5HWB A;  2PV3 A;  4ODL A;  4ODN A;  3UI5 A;  4DRM A;  1ZCN A;  2F21 A;  2IF4 A;  4TW6 A;  1BKF A;  2M08 A;  3EY6 A;  4TX0 A;  1HXV A;  2JV4 A;  4DIP A;  1WMV A;  2YSB A;  2F2D A;  3KAF A;  2LPV A;  2MLX A;  5HW6 A;  4DRO A;  2MLZ A;  2DMV A;  3KAC A;  1K9R A;  4QIB A;  1TCO C;  3CGN A;  1Q6I A;  1FKH A;  1Q1C A;  2PPP A;  3O5I A;  4FN2 A;  5DIU A;  3RFW A;  3O5D A;  1L1P A;  2YSF A;  3KCE A;  4TNS A;  4MGV A;  5HKG A;  3O5Q A;  4G2P A;  4ODO A;  2MPH A;  1KT0 A;  4N19 A;  2XP3 A;  1FKL A;  2M2A A;  4LAW A;  1F40 A;  3L4H A;  4REX A;  2AWG A;  1FAP A;  2DJY A;  4TW7 A;  5B8I C;  1JMQ A;  3OOB A;  1D7J A;  3IKD A;  4W9Q A;  4W9P A;  2MLY A;  4NNR A;  2JZV A;  4MSP A;  2ZAJ A;  3KAD A;  4TYO A;  5D75 A;  3WH0 A;  2ZQV A;  2MF9 A;  1D7I A;  4DRK A;  1FKR A;  3I6C A;  2PV1 A;  2VCD A;  4DRI A;  5J6E A;  2VN1 A;  3TCZ A;  2DK7 A;  1K9Q A;  4TW8 A;  2KXQ A;  3KAH A;  5DIV A;  2XP9 A;  2ZQT A;  5AHT A;  4E5R A;  2ZR5 A;  3O5O A;  4LAV A;  1FD9 A;  4DZ3 A;  1R9H A;  3B7X A;  1U79 A;  3FAP A;  3VAW A;  3CGM A;  4GIV A;  4ODK A;  5GPG A;  3O5L A;  1FKT A;  2K8I A;  4O2T A;  4DRJ A;  4IQC A;  2MDI A;  1Q6H A;  2FAP A;  2KGJ A;  2UZ5 A;  1D6O A;  4W9O A;  3KAI A;  5HW8 A;  2M3O W;  2ZQS A;  1FKK A;  1YAT A;  2KI3 A;  2LKN A;  1FKG A;  3GPK A;  3PA7 A;  4ODQ A;  3UF8 A;  4DRQ A;  3UI4 A;  2EZ5 W;  2JX8 A;  3H9R B;  2KR7 A;  4DZ2 A;  1P5Q A;  1T11 A;  3IKG A;  5I98 A;  2YSI A;  3PRD A;  2ZR6 A;  3UQI A;  1B6C A;  4U86 A;  1JNT A;  1EQ3 A;  1PIN A;  1ROU A;  2KFW A;  3JXV A;  3O5M A;  2OFN A;  4U84 A;  2RUD A;  4GGQ A;  4LAY A;  2DG9 A;  2DWV A;  2YSG A;  4QT2 A;  4DRH A;  1W26 A;  1Y0O A;  2D9F A;  2RUC A;  5HT1 A;  3NRK A;  2E45 A;  1F8A B;  5DIT A;  5HW7 A;  3O5G A;  4J4N A;  2XPB A;  2RUQ A;  1FKJ A;  4JFL A;  4R0X A;  5HWC A;  2FKE A;  1QZ2 A;  2JMF A;  4JFI A;  1D7H A;  3CNG A;  5BXJ A;  4ODM A;  4DT4 A;  2BA1 A;  2PPN A;  1FKB A;  3JYM A;  1NMV A;  2JXW A;  5HUA A;  1JVW A;  2N87 A;  3MDY B;  3O5F A;  4QT3 A;  1Q6U A;  4J4O A;  1ROT A;  4C02 B;  2XP6 A;  3ODK A;  3O5K A;  1N1A A;  1EYM A;  2KO7 A;  1J6Y A;  1FKF A;  3M7N A;  1WR7 A;  3KAG A;  3TDB A;  2PV2 A;  3PRB A;  2F4E A;  4JFJ A;  2DG4 A;  3NTP A;  4ODP A; 
#chains in the Genus database with same CATH topology
 4HBE A;  1KT1 A;  1I5H W;  3AS1 A;  4IPX A;  2RSE A;  4ODR A;  4U85 A;  1JND A;  1TK7 A;  3G6M A;  4BF8 A;  2WAD A;  2A3C A;  2XP8 A;  1O6I A;  2PN0 A;  1WAW A;  3IHZ A;  1FKI A;  1NMW A;  4G50 A;  3FSC A;  3B9D A;  1HKK A;  1M5Y A;  2A3A A;  3LE4 A;  3KZ7 A;  2XP5 A;  4MNJ A;  2M08 A;  4TX0 A;  2JV4 A;  3WD0 A;  2O92 A;  4DRO A;  5E65 A;  2DT3 A;  2PPP A;  3O5I A;  3ARP A;  4FN2 A;  5DIU A;  3KCE A;  4URI A;  4MGV A;  4P8X A;  4ODO A;  1KT0 A;  4NZC A;  1CTN A;  5E62 A;  1FKL A;  3L4H A;  1LL7 A;  3IKD A;  4W9P A;  2Y8N B;  5D75 A;  3KAD A;  4DRK A;  3WH0 A;  2PV1 A;  2VCD A;  4TW8 A;  2KXQ A;  3PR9 A;  1ZBK A;  3AQU A;  2A3E A;  3FSB A;  3CH9 A;  4LAV A;  4DZ3 A;  1R9H A;  2EUL A;  1NWR A;  1U79 A;  3FS8 A;  5GPG A;  1ZB5 A;  4O2T A;  4DRJ A;  5DF0 A;  4W9O A;  4MAV A;  1FKK A;  4ODQ A;  3WL0 A;  3RM4 A;  2DSU A;  1T11 A;  1NWT A;  3FXY A;  1D2K A;  3PRD A;  2ZR6 A;  3CHF A;  1B6C A;  4U86 A;  1JNT A;  1EQ3 A;  3O5M A;  2DWV A;  2YSG A;  2WK2 A;  3AS0 A;  2D9F A;  1NWS A;  3NRK A;  4P8U A;  4KR0 B;  3O5G A;  5HWC A;  2RUQ A;  2WLZ A;  4R0X A;  1QZ2 A;  4JFI A;  4WIW A;  2YBT A;  4DWS A;  2BA1 A;  1W1P A;  4GLX A;  4LGX A;  4PTM A;  2JXW A;  5HUA A;  3MDY B;  1W9P A;  1OGB A;  2A3B A;  5DO2 A;  1N1A A;  1J6Y A;  1FKF A;  2PV2 A;  4JFJ A;  2F4E A;  5HWB A;  1E6N A;  4R5E A;  3UQB A;  1W1V A;  1ITX A;  1W9V A;  3UI6 A;  3NI6 A;  1FKR A;  2LGO A;  1LL4 A;  1OGG A;  2WLY A;  4JFK A;  4ZPT R;  1SYT A;  2Y78 A;  4ITZ A;  3ARZ A;  4LAX A;  5HTG A;  1X6L A;  1FKS A;  1LJY A;  2DSZ A;  4JYS A;  2XP7 A;  4XAK A;  2YAJ B;  2ZR4 A;  1LG2 A;  1FFQ A;  1QPL A;  1F40 A;  2XP4 A;  2IUZ A;  4Z2J A;  3IK8 A;  2DPE A;  2DG3 A;  1O6W A;  2YSH A;  2ETN A;  2M8I A;  3ARR A;  4DRM A;  2IF4 A;  4WKA A;  1BKF A;  4NSB A;  2QF8 A;  4DIP A;  1WMV A;  3MCB B;  2F2D A;  2LPV A;  2MLX A;  3ART A;  5HW6 A;  3CHD A;  2DT2 A;  3QOK A;  1SR0 A;  4QIB A;  3RFW A;  1K9T A;  2YSF A;  1HKM A;  4TNS A;  4G2P A;  2MPH A;  3AS2 A;  1X6N A;  5GQB A;  1W9U A;  1H0I A;  4W9Q A;  4NNR A;  2JZV A;  2ZAJ A;  2MF9 A;  1NH6 A;  5J6E A;  3WIJ A;  3KAH A;  5DIV A;  2XP9 A;  2OLH A;  2ZQT A;  2AOS A;  3CHC A;  3PRA A;  1FD9 A;  3CGM A;  3O5L A;  2K8I A;  1E44 A;  1Q6H A;  2UZ5 A;  2KGJ A;  1D6O A;  4DWS C;  3EIP A;  3WD2 A;  2M3O W;  1E6Z A;  3PA7 A;  2P4V A;  3ALG A;  4QZV B;  2EZ5 W;  3UI4 A;  4DZ2 A;  1P5Q A;  3IKG A;  3UQI A;  3RM8 A;  3JXV A;  4LAY A;  4Z2K A;  2RUD A;  2DG9 A;  1Y0O A;  5HT1 A;  1IX5 A;  1LL6 A;  2XPB A;  4WJX A;  3WKZ A;  4Z2G A;  2O9O A;  1GUV A;  2PPN A;  3ARV A;  1FKB A;  1NMV A;  3ARX A;  4J4O A;  1NWU A;  2XP6 A;  3GU0 A;  1EYM A;  1GRJ A;  3M7N A;  3KAG A;  3TDB A;  4ODP A;  3PRB A;  1K9Q A;  1ZU8 A;  4HAR A;  2RQS A;  5CQ2 A;  1WNO A;  3KAB A;  3LUO A;  4W5U A;  3LKX A;  2ITK A;  1JNS A;  4JFM A;  1J4R A;  2DSW A;  1EG4 A;  1J4H A;  2PPO A;  2M8J A;  1H0G A;  4DRP A;  1QPF A;  2RE3 A;  3MQH A;  4WKH A;  2L4J A;  2OWO A;  1EG3 A;  2RUR A;  1E6P A;  1ZBW A;  3O5P A;  3O5E A;  4ML4 A;  3JYJ A;  3UQA A;  5E64 A;  2G8Z A;  1EDQ A;  3RGC A;  4DWS B;  4L3N A;  4MPK A;  2Q5A A;  3O5R A;  2ZQU A;  4Z2I A;  2PV3 A;  4ODL A;  2F21 A;  4TW6 A;  4IT4 A;  1HXV A;  3B8S A;  3WD1 A;  1UR9 A;  3KAF A;  1E6R A;  1GOI A;  2MLZ A;  3OA5 A;  3KAC A;  1ZL1 A;  1Q6I A;  1FKH A;  1Q1C A;  1LQ0 A;  1EIB A;  3O5D A;  3CHE A;  5HBF A;  5E5W A;  1L1P A;  4Z2H A;  3O5Q A;  4ZPW R;  4N19 A;  2XP3 A;  3BMB A;  3CZ8 A;  4LAW A;  4REX A;  2AWG A;  1FAP A;  2DJY A;  4TW7 A;  1JMQ A;  3OOB A;  3ARU A;  1D7J A;  2MLY A;  1HJV A;  3RME A;  1TR8 A;  2DT0 A;  1OWQ A;  1D7I A;  4KQZ A;  3TCZ A;  2DK7 A;  4Z2L A;  5AHT A;  4A0T A;  4E5R A;  3FY1 A;  2G41 A;  3ARY A;  3FAP A;  3MCB A;  4GIV A;  4MNK A;  4ODK A;  1FKT A;  4A0U A;  2MDI A;  4S3K A;  2FAP A;  3KAI A;  5HW8 A;  2QRV A;  1JCH B;  2KI3 A;  4DRQ A;  2JX8 A;  5I98 A;  4L72 B;  2YSI A;  4ZS6 A;  1ROU A;  4GGQ A;  3LKX B;  2DSV A;  4QT2 A;  1W26 A;  2RUC A;  2E45 A;  5HW7 A;  1FFR A;  4J4N A;  1ZBV A;  1FKJ A;  2FDM A;  2DT1 A;  1D7H A;  4ODM A;  4DT4 A;  3ALF A;  3WD3 A;  3PQH A;  2N87 A;  4QT3 A;  4UDM A;  5DEZ A;  1ROT A;  4C02 B;  4P8V A;  3O5K A;  1HJW A;  1KFW A;  3WQW A;  3NTP A;  3B9E A;  1BL4 A;  2KE0 A;  1PBK A;  4AY1 A;  4WKF A;  1FKD A;  1FJD A;  2DK1 A;  2LAJ A;  2L2S A;  4HBO A;  4DH0 A;  1FLC A;  1C9H A;  1HJX A;  2PBC A;  2YBU A;  2MNT A;  4WK9 A;  4DWS D;  1NSG A;  5GPR A;  3TC5 A;  1ZK6 A;  3B9A A;  1HKJ A;  3RM9 A;  3O5J A;  1J4I A;  1YW5 A;  4IQ2 A;  2XPA A;  1A7X A;  1HKI A;  3M85 A;  3ARS A;  4FAP A;  2LJ4 A;  4DRN A;  1XHG A;  2ESC A;  3ARW A;  5E66 A;  2M1I A;  1RP5 A;  3ARQ A;  4ODN A;  2B5U B;  3UI5 A;  1ZCN A;  4MNL A;  3EY6 A;  1RD6 A;  1WB0 A;  2YSB A;  4Q7N A;  4Q22 A;  1VF8 A;  2DMV A;  4IT6 A;  1JNE A;  1K9R A;  1TCO C;  3CGN A;  5HKG A;  1W1Y A;  4P8W A;  2M2A A;  3WQV A;  5B8I C;  5JH8 A;  4MSP A;  4TYO A;  3W4R A;  1EHN A;  2ZQV A;  3I6C A;  4DRI A;  2WM0 A;  2VN1 A;  1TFV A;  2ZR5 A;  3O5O A;  1W1T A;  3B7X A;  3VAW A;  3GTY X;  3WD4 A;  4IQC A;  1UR8 A;  2ZQS A;  1YAT A;  2LKN A;  2F23 A;  1FKG A;  3GPK A;  3UF8 A;  3H9R B;  2KR7 A;  1E9L A;  2PI6 A;  3BXW A;  1PIN A;  5U47 A;  2KFW A;  4MNM A;  2WAE A;  2OFN A;  4U84 A;  4MTV A;  4ZPV R;  4DRH A;  1F8A B;  5DIT A;  4JFL A;  3MQG A;  3G6L A;  3WL1 A;  2FKE A;  5BXJ A;  2JMF A;  3CNG A;  1LG1 A;  4S3J A;  1GPF A;  3JYM A;  1JVW A;  3O5F A;  1Q6U A;  3ARO A;  1ZBC A;  3ODK A;  1E15 A;  2KO7 A;  3AS3 A;  1WR7 A;  1XRV A;  2B31 A;  2DG4 A; 
#chains in the Genus database with same CATH homology
 4HBE A;  1KT1 A;  1I5H W;  3AS1 A;  4IPX A;  2RSE A;  4ODR A;  4U85 A;  1JND A;  1TK7 A;  3G6M A;  4BF8 A;  2WAD A;  2A3C A;  2XP8 A;  1O6I A;  1WAW A;  3IHZ A;  1FKI A;  1NMW A;  4G50 A;  3FSC A;  3B9D A;  1HKK A;  1M5Y A;  2A3A A;  3LE4 A;  3KZ7 A;  2XP5 A;  4MNJ A;  2M08 A;  4TX0 A;  2JV4 A;  3WD0 A;  2O92 A;  4DRO A;  5E65 A;  2DT3 A;  2PPP A;  3O5I A;  3ARP A;  4FN2 A;  5DIU A;  3KCE A;  4URI A;  4MGV A;  4P8X A;  4ODO A;  1KT0 A;  4NZC A;  1CTN A;  5E62 A;  1FKL A;  3L4H A;  1LL7 A;  3IKD A;  4W9P A;  2Y8N B;  5D75 A;  3KAD A;  4DRK A;  3WH0 A;  2PV1 A;  2VCD A;  4TW8 A;  2KXQ A;  3PR9 A;  1ZBK A;  3AQU A;  2A3E A;  3FSB A;  3CH9 A;  4LAV A;  4DZ3 A;  1R9H A;  1NWR A;  1U79 A;  3FS8 A;  5GPG A;  1ZB5 A;  4O2T A;  4DRJ A;  5DF0 A;  4W9O A;  4MAV A;  1FKK A;  4ODQ A;  3WL0 A;  3RM4 A;  2DSU A;  1T11 A;  1NWT A;  3FXY A;  1D2K A;  3PRD A;  2ZR6 A;  3CHF A;  1B6C A;  4U86 A;  1JNT A;  1EQ3 A;  3O5M A;  2DWV A;  2YSG A;  2WK2 A;  3AS0 A;  2D9F A;  1NWS A;  3NRK A;  4P8U A;  4KR0 B;  3O5G A;  5HWC A;  2RUQ A;  2WLZ A;  4R0X A;  1QZ2 A;  4JFI A;  4WIW A;  2YBT A;  4DWS A;  2BA1 A;  1W1P A;  4GLX A;  4LGX A;  4PTM A;  2JXW A;  5HUA A;  3MDY B;  1W9P A;  1OGB A;  2A3B A;  5DO2 A;  1N1A A;  1J6Y A;  1FKF A;  2PV2 A;  4JFJ A;  2F4E A;  5HWB A;  1E6N A;  4R5E A;  3UQB A;  1W1V A;  1ITX A;  1W9V A;  3UI6 A;  3NI6 A;  1FKR A;  2LGO A;  1LL4 A;  1OGG A;  2WLY A;  4JFK A;  4ZPT R;  1SYT A;  2Y78 A;  4ITZ A;  3ARZ A;  4LAX A;  5HTG A;  1X6L A;  1FKS A;  1LJY A;  2DSZ A;  4JYS A;  2XP7 A;  4XAK A;  2YAJ B;  2ZR4 A;  1LG2 A;  1FFQ A;  1QPL A;  1F40 A;  2XP4 A;  2IUZ A;  4Z2J A;  3IK8 A;  2DPE A;  2DG3 A;  1O6W A;  2YSH A;  2M8I A;  3ARR A;  4DRM A;  2IF4 A;  4WKA A;  1BKF A;  4NSB A;  2QF8 A;  4DIP A;  1WMV A;  3MCB B;  2F2D A;  2LPV A;  2MLX A;  3ART A;  5HW6 A;  3CHD A;  2DT2 A;  3QOK A;  1SR0 A;  4QIB A;  3RFW A;  1K9T A;  2YSF A;  1HKM A;  4TNS A;  4G2P A;  2MPH A;  3AS2 A;  1X6N A;  5GQB A;  1W9U A;  1H0I A;  4W9Q A;  4NNR A;  2JZV A;  2ZAJ A;  2MF9 A;  1NH6 A;  5J6E A;  3WIJ A;  3KAH A;  5DIV A;  2XP9 A;  2OLH A;  2ZQT A;  2AOS A;  3CHC A;  3PRA A;  1FD9 A;  3CGM A;  3O5L A;  2K8I A;  2UZ5 A;  1Q6H A;  2KGJ A;  1D6O A;  4DWS C;  3WD2 A;  2M3O W;  1E6Z A;  3PA7 A;  3ALG A;  4QZV B;  2EZ5 W;  3UI4 A;  4DZ2 A;  1P5Q A;  3IKG A;  3UQI A;  3RM8 A;  3JXV A;  4LAY A;  4Z2K A;  2RUD A;  2DG9 A;  1Y0O A;  5HT1 A;  1IX5 A;  1LL6 A;  2XPB A;  4WJX A;  3WKZ A;  4Z2G A;  2O9O A;  1GUV A;  2PPN A;  3ARV A;  1FKB A;  1NMV A;  3ARX A;  4J4O A;  1NWU A;  2XP6 A;  1EYM A;  3M7N A;  3KAG A;  3TDB A;  4ODP A;  3PRB A;  1K9Q A;  1ZU8 A;  4HAR A;  2RQS A;  5CQ2 A;  1WNO A;  3KAB A;  3LUO A;  4W5U A;  3LKX A;  2ITK A;  1JNS A;  4JFM A;  1J4R A;  2DSW A;  1EG4 A;  1J4H A;  2PPO A;  2M8J A;  1H0G A;  4DRP A;  1QPF A;  2RE3 A;  3MQH A;  4WKH A;  2L4J A;  2OWO A;  1EG3 A;  2RUR A;  1E6P A;  1ZBW A;  3O5P A;  3O5E A;  4ML4 A;  3JYJ A;  3UQA A;  5E64 A;  2G8Z A;  1EDQ A;  3RGC A;  4DWS B;  4L3N A;  4MPK A;  2Q5A A;  3O5R A;  2ZQU A;  4Z2I A;  2PV3 A;  4ODL A;  2F21 A;  4TW6 A;  4IT4 A;  1HXV A;  3B8S A;  3WD1 A;  1UR9 A;  3KAF A;  1E6R A;  1GOI A;  2MLZ A;  3OA5 A;  3KAC A;  1ZL1 A;  1Q6I A;  1FKH A;  1Q1C A;  1LQ0 A;  1EIB A;  3O5D A;  3CHE A;  5HBF A;  5E5W A;  1L1P A;  4Z2H A;  3O5Q A;  4ZPW R;  4N19 A;  2XP3 A;  3CZ8 A;  4LAW A;  4REX A;  2AWG A;  1FAP A;  2DJY A;  4TW7 A;  1JMQ A;  3OOB A;  3ARU A;  1D7J A;  2MLY A;  1HJV A;  3RME A;  1TR8 A;  2DT0 A;  1OWQ A;  1D7I A;  4KQZ A;  3TCZ A;  2DK7 A;  4Z2L A;  5AHT A;  4A0T A;  4E5R A;  3FY1 A;  2G41 A;  3ARY A;  3FAP A;  3MCB A;  4GIV A;  4MNK A;  4ODK A;  1FKT A;  4A0U A;  2MDI A;  4S3K A;  2FAP A;  3KAI A;  5HW8 A;  2QRV A;  2KI3 A;  4DRQ A;  2JX8 A;  5I98 A;  4L72 B;  2YSI A;  4ZS6 A;  1ROU A;  4GGQ A;  3LKX B;  2DSV A;  4QT2 A;  1W26 A;  2RUC A;  2E45 A;  5HW7 A;  1FFR A;  4J4N A;  1ZBV A;  1FKJ A;  2FDM A;  2DT1 A;  1D7H A;  4ODM A;  4DT4 A;  3ALF A;  3WD3 A;  3PQH A;  2N87 A;  4QT3 A;  5DEZ A;  1ROT A;  4C02 B;  4P8V A;  3O5K A;  1HJW A;  1KFW A;  3WQW A;  3NTP A;  3B9E A;  1BL4 A;  2KE0 A;  1PBK A;  4AY1 A;  4WKF A;  1FKD A;  1FJD A;  2DK1 A;  2LAJ A;  2L2S A;  4HBO A;  4DH0 A;  1FLC A;  1C9H A;  1HJX A;  2PBC A;  2YBU A;  2MNT A;  4WK9 A;  4DWS D;  1NSG A;  5GPR A;  3TC5 A;  1ZK6 A;  3B9A A;  1HKJ A;  3RM9 A;  3O5J A;  1J4I A;  1YW5 A;  4IQ2 A;  2XPA A;  1A7X A;  1HKI A;  3M85 A;  3ARS A;  4FAP A;  2LJ4 A;  4DRN A;  1XHG A;  2ESC A;  3ARW A;  5E66 A;  2M1I A;  1RP5 A;  3ARQ A;  4ODN A;  3UI5 A;  1ZCN A;  4MNL A;  3EY6 A;  1RD6 A;  1WB0 A;  2YSB A;  4Q7N A;  4Q22 A;  1VF8 A;  2DMV A;  4IT6 A;  1JNE A;  1K9R A;  1TCO C;  3CGN A;  5HKG A;  1W1Y A;  4P8W A;  2M2A A;  3WQV A;  5B8I C;  5JH8 A;  4MSP A;  4TYO A;  3W4R A;  1EHN A;  2ZQV A;  3I6C A;  4DRI A;  2WM0 A;  2VN1 A;  1TFV A;  2ZR5 A;  3O5O A;  1W1T A;  3B7X A;  3VAW A;  3WD4 A;  4IQC A;  1UR8 A;  2ZQS A;  1YAT A;  2LKN A;  3GPK A;  1FKG A;  3UF8 A;  3H9R B;  2KR7 A;  1E9L A;  2PI6 A;  3BXW A;  1PIN A;  5U47 A;  2KFW A;  4MNM A;  2WAE A;  2OFN A;  4U84 A;  4MTV A;  4ZPV R;  4DRH A;  1F8A B;  5DIT A;  4JFL A;  3MQG A;  3G6L A;  3WL1 A;  2FKE A;  5BXJ A;  2JMF A;  3CNG A;  1LG1 A;  4S3J A;  1GPF A;  3JYM A;  1JVW A;  3O5F A;  1Q6U A;  3ARO A;  1ZBC A;  3ODK A;  1E15 A;  2KO7 A;  3AS3 A;  1WR7 A;  1XRV A;  2B31 A;  2DG4 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...