2ZQSA

Crystal structure of a mutant pin1 peptidyl-prolyl cis-trans isomerase
Total Genus 42
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
42
sequence length
158
structure length
153
Chain Sequence
KLPPGWEKRMSRSSGRVYYFNHITNASQWERPSGGKNGQGEPARVRCSHLLVKHSQSRRPSSWRQEKITRTKEEALELINGYIQKIKSGEEDFESLASQFSDASSAKARGDLGAFSRGQMQKPFEDASFALRTGEMSGPVFTDSGIHIILRTE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Isomerase
molecule keywords Peptidyl-prolyl cis-trans isomerase NIMA-interacting 1
publication title Structural studies on PIN1 mutants
rcsb
source organism Homo sapiens
total genus 42
structure length 153
sequence length 158
ec nomenclature ec 5.2.1.8: Peptidylprolyl isomerase.
pdb deposition date 2008-08-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00397 WW WW domain
A PF00639 Rotamase PPIC-type PPIASE domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.20.70.10 Mainly Beta Single Sheet Ubiquitin Ligase Nedd4; Chain: W; Ubiquitin Ligase Nedd4; Chain: W; 2zqsA01
3.10.50.40 Alpha Beta Roll Chitinase A; domain 3 Chitinase A; domain 3 2zqsA02
3O5MA 3TC5A 4DRPA 3PRDA 4IPXA 2IF4A 1B6CA 2N87A 4DRMA 1J6YA 2DWVA 5HW7A 2MLXA 2K8IA 2ZQUA 5GPGA 3VAWA 2XP9A 2LAJA 5HWCA 3UQBA 1QPLA 4G2PA 1EQ3A 2RUCA 2LJ4A 5CQ2A 1ZK6A 2VCDA 1JNSA 2L4JA 4LAXA 4ITZA 1D6OA 1U79A 1I5HW 4JYSA 5D75A 4R0XA 1TCOC 4TX0A 2JV4A 4TNSA 4LAWA 4U86A 1FD9A 4QT3A 4C02B 1FKTA 3O5KA 4TW6A 2RSEA 5HW6A 4ODPA 1FJDA 3M85A 2EZ5W 2JXWA 4JFMA 1C9HA 2DMVA 2DK1A 2DG3A 2KR7A 2VN1A 2YSHA 2ZR5A 1ROUA 4QT2A 1WR7A 2MDIA 3PRBA 3GPKA 3I6CA 1Y0OA 5HT1A 3UF8A 4MSPA 2RQSA 1FKJA 1J4RA 2DG9A 4ODNA 3FAPA 3O5LA 2F4EA 3NRKA 4DRKA 5DITA 4G50A 3KAGA 1Q6UA 1K9QA 1ROTA 3NTPA 4NNRA 4DRQA 3CGNA 1L1PA 1EG4A 4J4NA 2JMFA 4J4OA 1YATA 3NI6A 3O5DA 3LUOA 2KFWA 1FAPA 3KCEA 2YSIA 2M1IA 3UQAA 3KACA 2ZAJA 2Y78A 4W9QA 2D9FA 1PBKA 4ODOA 2M2AA 3UI5A 1KT1A 4JFIA 4W9OA 1QPFA 3O5JA 5AHTA 4E5RA 3RFWA 4DT4A 1BKFA 4DIPA 5DIVA 4DZ3A 2OFNA 2FAPA 2AWGA 3O5GA 3KAFA 3IKDA 5B8IC 3JYJA 2MNTA 5DIUA 1PINA 4DRIA 1FKSA 4JFJA 5HWBA 1T11A 2Q5AA 2YSGA 2F2DA 2KI3A 2ZQSA 3UI4A 2RE3A 3O5OA 2UZ5A 3JXVA 3L4HA 3CGMA 4TW8A 4FAPA 4FN2A 4N19A 4JFLA 2KO7A 1J4HA 3OOBA 2XP5A 1D7HA 2XP6A 3O5PA 3O5IA 3PA7A 1HXVA 2F21A 2XP4A 2MLYA 1N1AA 3KZ7A 1FKHA 3TCZA 5HTGA 3JYMA 4IQ2A 5HW8A 4ODQA 5J6EA 4REXA 3IKGA 2XP7A 2PV1A 1M5YA 1Q1CA 3M7NA 3O5EA 5I98A 1EG3A 2M08A 1FKBA 2PPOA 3IHZA 2YSFA 1P5QA 2MLZA 2XP8A 3EY6A 5BXJA 2LGOA 4DRJA 1YW5A 1Q6IA 2PBCA 2RUDA 4BF8A 4ODKA 1BL4A 4TYOA 2JX8A 1F40A 3KABA 1FKGA 3IK8A 1D7JA 2LKNA 2M8IA 2XP3A 2XPAA 1FKLA 4TW7A 4DRNA 3LE4A 2RURA 2LPVA 1FKIA 3O5RA 3ODKA 4O2TA 1TK7A 3H9RB 2JZVA 2MPHA 1QZ2A 2ZQTA 2PV2A 2M3OW 3KADA 3UI6A 3B7XA 1FKDA 1A7XA 4DROA 5HUAA 4ODRA 4JFKA 3MDYB 5HKGA 2YSBA 4W9PA 4LAVA 1JNTA 4U85A 4ODMA 1J4IA 1FKKA 4DZ2A 1K9RA 1O6WA 1FKRA 3KAHA 2DJYA 2L2SA 2RUQA 1ZCNA 2FKEA 1JMQA 3TDBA 1Q6HA 1FKFA 4GIVA 3UQIA 4LAYA 2E45A 2ITKA 1R9HA 2M8JA 2PPPA 3O5FA 2DK7A 3RGCA 3CNGA 4ODLA 4IQCA 2ZR4A 2PV3A 2ZR6A 1KT0A 4GGQA 3WH0A 4DRHA 4DH0A 4U84A 1EYMA 2PPNA 2ZQVA 3KAIA 2KXQA 1WMVA 1W26A 4QIBA 2BA1A 2XPBA 3O5QA 1F8AB 2KGJA 4MGVA 1NSGA 2MF9A 1NMWA 1JVWA 2DG4A 2KE0A 1D7IA 1NMVA
chains in the Genus database with same CATH superfamily
3AS1A 3O5MA 2FDMA 3TC5A 4DRPA 3PRDA 4IPXA 1O6IA 2IF4A 4Z2IA 1B6CA 2N87A 4DRMA 4P8UA 1J6YA 3ALFA 2DWVA 5E64A 5HW7A 1HKIA 2MLXA 5GQBA 2K8IA 2ZQUA 5GPGA 3VAWA 2XP9A 3ARRA 2LAJA 2DSZA 3WQVA 4DWSC 1HKKA 5HWCA 1X6NA 1W1VA 3GTYX 1D2KA 4PTMA 5E65A 2EULA 3UQBA 1QPLA 1LQ0A 4G2PA 1EQ3A 2RUCA 1XHGA 1LL4A 2WLZA 1ZU8A 3ARYA 3RM4A 2LJ4A 5CQ2A 1OGGA 1ZK6A 2VCDA 2A3CA 1JNSA 2L4JA 4LAXA 2G41A 4ITZA 1D6OA 4HBOA 4P8VA 4Z2LA 1U79A 1NWUA 1I5HW 3ARSA 4JYSA 1HKMA 5D75A 2ESCA 4R0XA 3MCBB 1TCOC 4TX0A 2JV4A 3AS2A 3WD2A 4TNSA 4LAWA 4U86A 1FD9A 4QT3A 4C02B 4A0UA 5E5WA 1FKTA 1W9VA 3O5KA 1IX5A 4TW6A 1SR0A 2RSEA 5HW6A 4ODPA 1FJDA 3M85A 2EZ5W 2JXWA 4JFMA 3EIPA 1C9HA 2DMVA 4P8XA 2DK1A 2P4VA 4HBEA 2DG3A 2KR7A 2VN1A 2YSHA 1XRVA 3AS3A 2ZR5A 1ROUA 4QT2A 5DO2A 1WR7A 3ARQA 2O9OA 2MDIA 1E44A 4AY1A 3PRBA 2ETNA 3GPKA 3I6CA 3OA5A 1EHNA 4Z2KA 1Y0OA 3ARTA 5HT1A 3UF8A 4QZVB 4MSPA 1NWRA 2RQSA 1FKJA 1J4RA 1FFQA 1GPFA 2DG9A 2IUZA 4ODNA 3RM8A 3FAPA 1HJVA 2F4EA 3O5LA 3NRKA 4DRKA 1WAWA 5DITA 3PQHA 1E6NA 4G50A 5DEZA 3KAGA 1Q6UA 1K9QA 1ROTA 3NTPA 4NNRA 4W5UA 4S3JA 1ZL1A 4DRQA 1UR9A 4DWSA 3CGNA 4DWSB 1L1PA 1VF8A 1EG4A 4J4NA 2JMFA 4J4OA 1YATA 3FY1A 3NI6A 3O5DA 3LUOA 2KFWA 1FAPA 4WIWA 3KCEA 2YSIA 4MNJA 2M1IA 4URIA 3KACA 3UQAA 2ZAJA 2Y78A 5E62A 4W9QA 4A0TA 2D9FA 1PBKA 4ODOA 1EDQA 1W9UA 2M2AA 3UI5A 1KT1A 4JFIA 1ZB5A 3ARPA 3ARWA 4W9OA 1QPFA 3O5JA 2A3AA 5AHTA 4Z2GA 4E5RA 3RFWA 3WQWA 2OLHA 4DT4A 1KFWA 3G6LA 2DSWA 1BKFA 1RD6A 3WD3A 4DIPA 5DIVA 4DZ3A 2OFNA 2FAPA 3WL0A 2AWGA 5JH8A 2WK2A 2AOSA 3O5GA 4UDMA 3KAFA 2DT3A 3IKDA 5B8IC 3RM9A 3B9AA 3JYJA 1ZBKA 2MNTA 4WKFA 5DIUA 1PINA 1LG2A 4DRIA 3MCBA 1LJYA 1FKSA 3WD1A 4JFJA 5HWBA 1T11A 2Q5AA 2YSGA 4HARA 3WD4A 2F2DA 2KI3A 1E9LA 2ZQSA 3UI4A 3CHFA 5GPRA 1WB0A 2RE3A 3O5OA 4ZS6A 4Z2JA 2UZ5A 4NSBA 2DSVA 2DPEA 2OWOA 3JXVA 3QOKA 2QRVA 3L4HA 3PR9A 3CGMA 4TW8A 4FAPA 3FXYA 4L3NA 1NWTA 4MTVA 2DT1A 1FFRA 2WM0A 4FN2A 4JFLA 4KR0B 4N19A 2F23A 2KO7A 1GUVA 1J4HA 3OOBA 2XP5A 1D7HA 2XP6A 3O5PA 3O5IA 3PA7A 3W4RA 1HXVA 2F21A 2XP4A 2MLYA 5DF0A 1N1AA 3KZ7A 1HJXA 1FKHA 1LL7A 3TCZA 3B9DA 4XAKA 5HTGA 1H0IA 3JYMA 4IQ2A 5HW8A 4ODQA 5J6EA 4REXA 3IKGA 2A3BA 4R5EA 3ALGA 2XP7A 4P8WA 3CZ8A 3CHEA 1JNDA 2PV1A 1M5YA 1Q1CA 4MPKA 3M7NA 3O5EA 5I98A 1EG3A 5E66A 1HJWA 1ITXA 2M08A 1FKBA 4MNKA 1ZBVA 2PPOA 3IHZA 2YSFA 4DWSD 4WKHA 1P5QA 2MLZA 4MNMA 2XP8A 2O92A 3B8SA 1GOIA 3EY6A 5BXJA 2LGOA 4DRJA 1YW5A 1Q6IA 1SYTA 2PBCA 2RUDA 4BF8A 4S3KA 4ODKA 1BL4A 4TYOA 2JX8A 1E6PA 1F40A 2G8ZA 1E6ZA 3KABA 1FKGA 3IK8A 2WLYA 1D7JA 4NZCA 4MNLA 3MQHA 2LKNA 2M8IA 2XP3A 2XPAA 1FKLA 1TFVA 4TW7A 2B5UB 4DRNA 3LE4A 2RURA 4WKAA 2LPVA 4L72B 3CHDA 1TR8A 1NH6A 1FKIA 3AS0A 3ARUA 4Z2HA 1OGBA 3O5RA 3ODKA 3FSCA 2QF8A 4KQZA 4O2TA 1TK7A 3H9RB 2JZVA 4Q22A 2MPHA 1K9TA 3RMEA 5HBFA 1CTNA 1LL6A 1QZ2A 2ZQTA 2PV2A 4ZPTR 2M3OW 3KADA 3UI6A 3WKZA 5U47A 3B7XA 1FKDA 1GRJA 1W1PA 1A7XA 3WIJA 4LGXA 2DT0A 4DROA 3BXWA 4GLXA 4ODRA 5HUAA 4ZPVR 4JFKA 3MDYB 5HKGA 2YSBA 2PN0A 4ML4A 1H0GA 2DSUA 3LKXA 4W9PA 4LAVA 3LKXB 1ZBCA 3B9EA 3ARVA 3WL1A 1JNTA 4IT6A 4U85A 4ODMA 2B31A 1J4IA 4ZPWR 1FKKA 4DZ2A 2YAJB 1RP5A 1JCHB 3CH9A 1K9RA 1NWSA 1O6WA 1UR8A 3AQUA 1FKRA 3KAHA 3WD0A 2DJYA 4WJXA 1X6LA 1ZBWA 2L2SA 1ZCNA 2RUQA 2FKEA 3ARZA 3MQGA 1JMQA 3TDBA 1Q6HA 1FKFA 2DT2A 4GIVA 3UQIA 4LAYA 3PRAA 4MAVA 3BMBA 3AROA 2E45A 3CHCA 2ITKA 1R9HA 2Y8NB 1FLCA 3GU0A 3ARXA 1W9PA 2M8JA 2PPPA 3O5FA 2DK7A 1LG1A 3RGCA 2YBUA 3CNGA 4ODLA 2WADA 1W1TA 2WAEA 4IQCA 2ZR4A 2PV3A 2ZR6A 2YBTA 4IT4A 1KT0A 1W1YA 4GGQA 3WH0A 4DRHA 4DH0A 4U84A 1EIBA 1WNOA 1EYMA 3FSBA 2PPNA 2ZQVA 3KAIA 2KXQA 1WMVA 3FS8A 1W26A 4QIBA 1E6RA 2BA1A 1OWQA 1JNEA 2XPBA 3O5QA 1F8AB 2KGJA 1E15A 3G6MA 4MGVA 1HKJA 4WK9A 4Q7NA 1NSGA 2MF9A 1NMWA 2A3EA 1JVWA 2DG4A 2KE0A 1D7IA 1NMVA 2PI6A
chains in the Genus database with same CATH topology
3AS1A 3O5MA 2FDMA 3TC5A 4DRPA 3PRDA 4IPXA 1O6IA 2IF4A 4Z2IA 1B6CA 2N87A 4DRMA 4P8UA 1J6YA 3ALFA 2DWVA 5E64A 5HW7A 1HKIA 2MLXA 5GQBA 2K8IA 2ZQUA 5GPGA 3VAWA 2XP9A 3ARRA 2LAJA 2DSZA 3WQVA 4DWSC 1HKKA 5HWCA 1X6NA 1W1VA 1D2KA 4PTMA 5E65A 3UQBA 1QPLA 1LQ0A 4G2PA 1EQ3A 2RUCA 1XHGA 1LL4A 2WLZA 1ZU8A 3ARYA 3RM4A 2LJ4A 5CQ2A 1OGGA 1ZK6A 2VCDA 2A3CA 1JNSA 2L4JA 4LAXA 2G41A 4ITZA 1D6OA 4HBOA 4P8VA 4Z2LA 1U79A 1NWUA 1I5HW 3ARSA 4JYSA 1HKMA 5D75A 2ESCA 4R0XA 3MCBB 1TCOC 4TX0A 2JV4A 3AS2A 3WD2A 4TNSA 4LAWA 4U86A 1FD9A 4QT3A 4C02B 4A0UA 5E5WA 1FKTA 1W9VA 3O5KA 1IX5A 4TW6A 1SR0A 2RSEA 5HW6A 4ODPA 1FJDA 3M85A 2EZ5W 2JXWA 4JFMA 1C9HA 2DMVA 4P8XA 2DK1A 4HBEA 2DG3A 2KR7A 2VN1A 2YSHA 1XRVA 3AS3A 2ZR5A 1ROUA 4QT2A 5DO2A 1WR7A 3ARQA 2O9OA 2MDIA 4AY1A 3PRBA 3GPKA 3I6CA 3OA5A 1EHNA 4Z2KA 1Y0OA 3ARTA 5HT1A 3UF8A 4QZVB 4MSPA 1NWRA 2RQSA 1FKJA 1J4RA 1FFQA 1GPFA 2DG9A 2IUZA 4ODNA 3RM8A 3FAPA 1HJVA 2F4EA 3O5LA 3NRKA 4DRKA 1WAWA 5DITA 3PQHA 1E6NA 4G50A 5DEZA 3KAGA 1Q6UA 1K9QA 1ROTA 3NTPA 4NNRA 4W5UA 4S3JA 1ZL1A 4DRQA 1UR9A 4DWSA 3CGNA 4DWSB 1L1PA 1VF8A 1EG4A 4J4NA 2JMFA 4J4OA 1YATA 3FY1A 3NI6A 3O5DA 3LUOA 2KFWA 1FAPA 4WIWA 3KCEA 2YSIA 4MNJA 2M1IA 4URIA 3KACA 3UQAA 2ZAJA 2Y78A 5E62A 4W9QA 4A0TA 2D9FA 1PBKA 4ODOA 1EDQA 1W9UA 2M2AA 3UI5A 1KT1A 4JFIA 1ZB5A 3ARPA 3ARWA 4W9OA 1QPFA 3O5JA 2A3AA 5AHTA 4Z2GA 4E5RA 3RFWA 3WQWA 2OLHA 4DT4A 1KFWA 3G6LA 2DSWA 1BKFA 1RD6A 3WD3A 4DIPA 5DIVA 4DZ3A 2OFNA 2FAPA 3WL0A 2AWGA 5JH8A 2WK2A 2AOSA 3O5GA 3KAFA 2DT3A 3IKDA 5B8IC 3RM9A 3B9AA 3JYJA 1ZBKA 2MNTA 4WKFA 5DIUA 1PINA 1LG2A 4DRIA 3MCBA 1LJYA 1FKSA 3WD1A 4JFJA 5HWBA 1T11A 2Q5AA 2YSGA 4HARA 3WD4A 2F2DA 2KI3A 1E9LA 2ZQSA 3UI4A 3CHFA 5GPRA 1WB0A 2RE3A 3O5OA 4ZS6A 4Z2JA 2UZ5A 4NSBA 2DSVA 2DPEA 2OWOA 3JXVA 3QOKA 2QRVA 3L4HA 3PR9A 3CGMA 4TW8A 4FAPA 3FXYA 4L3NA 1NWTA 4MTVA 2DT1A 1FFRA 2WM0A 4FN2A 4JFLA 4KR0B 4N19A 2KO7A 1GUVA 1J4HA 3OOBA 2XP5A 1D7HA 2XP6A 3O5PA 3O5IA 3PA7A 3W4RA 1HXVA 2F21A 2XP4A 2MLYA 5DF0A 1N1AA 3KZ7A 1HJXA 1FKHA 1LL7A 3TCZA 3B9DA 4XAKA 5HTGA 1H0IA 3JYMA 4IQ2A 5HW8A 4ODQA 5J6EA 4REXA 3IKGA 2A3BA 4R5EA 3ALGA 2XP7A 4P8WA 3CZ8A 3CHEA 1JNDA 2PV1A 1M5YA 1Q1CA 4MPKA 3M7NA 3O5EA 5I98A 1EG3A 5E66A 1HJWA 1ITXA 2M08A 1FKBA 4MNKA 1ZBVA 2PPOA 3IHZA 2YSFA 4DWSD 4WKHA 1P5QA 2MLZA 4MNMA 2XP8A 2O92A 3B8SA 1GOIA 3EY6A 5BXJA 2LGOA 4DRJA 1YW5A 1Q6IA 1SYTA 2PBCA 2RUDA 4BF8A 4S3KA 4ODKA 1BL4A 4TYOA 2JX8A 1E6PA 1F40A 2G8ZA 1E6ZA 3KABA 1FKGA 3IK8A 2WLYA 1D7JA 4NZCA 4MNLA 3MQHA 2LKNA 2M8IA 2XP3A 2XPAA 1FKLA 1TFVA 4TW7A 4DRNA 3LE4A 2RURA 4WKAA 2LPVA 4L72B 3CHDA 1TR8A 1NH6A 1FKIA 3AS0A 3ARUA 4Z2HA 1OGBA 3O5RA 3ODKA 3FSCA 2QF8A 4KQZA 4O2TA 1TK7A 3H9RB 2JZVA 4Q22A 2MPHA 1K9TA 3RMEA 5HBFA 1CTNA 1LL6A 1QZ2A 2ZQTA 2PV2A 4ZPTR 2M3OW 3KADA 3UI6A 3WKZA 5U47A 3B7XA 1FKDA 1W1PA 1A7XA 3WIJA 4LGXA 2DT0A 4DROA 3BXWA 4GLXA 4ODRA 5HUAA 4ZPVR 4JFKA 3MDYB 5HKGA 2YSBA 4ML4A 1H0GA 2DSUA 3LKXA 4W9PA 4LAVA 3LKXB 1ZBCA 3B9EA 3ARVA 3WL1A 1JNTA 4IT6A 4U85A 4ODMA 2B31A 1J4IA 4ZPWR 1FKKA 4DZ2A 2YAJB 1RP5A 3CH9A 1K9RA 1NWSA 1O6WA 1UR8A 3AQUA 1FKRA 3KAHA 3WD0A 2DJYA 4WJXA 1X6LA 1ZBWA 2L2SA 1ZCNA 2RUQA 2FKEA 3ARZA 3MQGA 1JMQA 3TDBA 1Q6HA 1FKFA 2DT2A 4GIVA 3UQIA 4LAYA 3PRAA 4MAVA 3AROA 2E45A 3CHCA 2ITKA 1R9HA 2Y8NB 1FLCA 3ARXA 1W9PA 2M8JA 2PPPA 3O5FA 2DK7A 1LG1A 3RGCA 2YBUA 3CNGA 4ODLA 2WADA 1W1TA 2WAEA 4IQCA 2ZR4A 2PV3A 2ZR6A 2YBTA 4IT4A 1KT0A 1W1YA 4GGQA 3WH0A 4DRHA 4DH0A 4U84A 1EIBA 1WNOA 1EYMA 3FSBA 2PPNA 2ZQVA 3KAIA 2KXQA 1WMVA 3FS8A 1W26A 4QIBA 1E6RA 2BA1A 1OWQA 1JNEA 2XPBA 3O5QA 1F8AB 2KGJA 1E15A 3G6MA 4MGVA 1HKJA 4WK9A 4Q7NA 1NSGA 2MF9A 1NMWA 2A3EA 1JVWA 2DG4A 2KE0A 1D7IA 1NMVA 2PI6A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3O5M A;  3TC5 A;  4DRP A;  3PRD A;  4IPX A;  2IF4 A;  1B6C A;  2N87 A;  4DRM A;  1J6Y A;  2DWV A;  5HW7 A;  2MLX A;  2K8I A;  2ZQU A;  5GPG A;  3VAW A;  2XP9 A;  2LAJ A;  5HWC A;  3UQB A;  1QPL A;  4G2P A;  1EQ3 A;  2RUC A;  2LJ4 A;  5CQ2 A;  1ZK6 A;  2VCD A;  1JNS A;  2L4J A;  4LAX A;  4ITZ A;  1D6O A;  1U79 A;  1I5H W;  4JYS A;  5D75 A;  4R0X A;  1TCO C;  4TX0 A;  2JV4 A;  4TNS A;  4LAW A;  4U86 A;  1FD9 A;  4QT3 A;  4C02 B;  1FKT A;  3O5K A;  4TW6 A;  2RSE A;  5HW6 A;  4ODP A;  1FJD A;  3M85 A;  2EZ5 W;  2JXW A;  4JFM A;  1C9H A;  2DMV A;  2DK1 A;  2DG3 A;  2KR7 A;  2VN1 A;  2YSH A;  2ZR5 A;  1ROU A;  4QT2 A;  1WR7 A;  2MDI A;  3PRB A;  3GPK A;  3I6C A;  1Y0O A;  5HT1 A;  3UF8 A;  4MSP A;  2RQS A;  1FKJ A;  1J4R A;  2DG9 A;  4ODN A;  3FAP A;  3O5L A;  2F4E A;  3NRK A;  4DRK A;  5DIT A;  4G50 A;  3KAG A;  1Q6U A;  1K9Q A;  1ROT A;  3NTP A;  4NNR A;  4DRQ A;  3CGN A;  1L1P A;  1EG4 A;  4J4N A;  2JMF A;  4J4O A;  1YAT A;  3NI6 A;  3O5D A;  3LUO A;  2KFW A;  1FAP A;  3KCE A;  2YSI A;  2M1I A;  3UQA A;  3KAC A;  2ZAJ A;  2Y78 A;  4W9Q A;  2D9F A;  1PBK A;  4ODO A;  2M2A A;  3UI5 A;  1KT1 A;  4JFI A;  4W9O A;  1QPF A;  3O5J A;  5AHT A;  4E5R A;  3RFW A;  4DT4 A;  1BKF A;  4DIP A;  5DIV A;  4DZ3 A;  2OFN A;  2FAP A;  2AWG A;  3O5G A;  3KAF A;  3IKD A;  5B8I C;  3JYJ A;  2MNT A;  5DIU A;  1PIN A;  4DRI A;  1FKS A;  4JFJ A;  5HWB A;  1T11 A;  2Q5A A;  2YSG A;  2F2D A;  2KI3 A;  2ZQS A;  3UI4 A;  2RE3 A;  3O5O A;  2UZ5 A;  3JXV A;  3L4H A;  3CGM A;  4TW8 A;  4FAP A;  4FN2 A;  4N19 A;  4JFL A;  2KO7 A;  1J4H A;  3OOB A;  2XP5 A;  1D7H A;  2XP6 A;  3O5P A;  3O5I A;  3PA7 A;  1HXV A;  2F21 A;  2XP4 A;  2MLY A;  1N1A A;  3KZ7 A;  1FKH A;  3TCZ A;  5HTG A;  3JYM A;  4IQ2 A;  5HW8 A;  4ODQ A;  5J6E A;  4REX A;  3IKG A;  2XP7 A;  2PV1 A;  1M5Y A;  1Q1C A;  3M7N A;  3O5E A;  5I98 A;  1EG3 A;  2M08 A;  1FKB A;  2PPO A;  3IHZ A;  2YSF A;  1P5Q A;  2MLZ A;  2XP8 A;  3EY6 A;  5BXJ A;  2LGO A;  4DRJ A;  1YW5 A;  1Q6I A;  2PBC A;  2RUD A;  4BF8 A;  4ODK A;  1BL4 A;  4TYO A;  2JX8 A;  1F40 A;  3KAB A;  1FKG A;  3IK8 A;  1D7J A;  2LKN A;  2M8I A;  2XP3 A;  2XPA A;  1FKL A;  4TW7 A;  4DRN A;  3LE4 A;  2RUR A;  2LPV A;  1FKI A;  3O5R A;  3ODK A;  4O2T A;  1TK7 A;  3H9R B;  2JZV A;  2MPH A;  1QZ2 A;  2ZQT A;  2PV2 A;  2M3O W;  3KAD A;  3UI6 A;  3B7X A;  1FKD A;  1A7X A;  4DRO A;  5HUA A;  4ODR A;  4JFK A;  3MDY B;  5HKG A;  2YSB A;  4W9P A;  4LAV A;  1JNT A;  4U85 A;  4ODM A;  1J4I A;  1FKK A;  4DZ2 A;  1K9R A;  1O6W A;  1FKR A;  3KAH A;  2DJY A;  2L2S A;  2RUQ A;  1ZCN A;  2FKE A;  1JMQ A;  3TDB A;  1Q6H A;  1FKF A;  4GIV A;  3UQI A;  4LAY A;  2E45 A;  2ITK A;  1R9H A;  2M8J A;  2PPP A;  3O5F A;  2DK7 A;  3RGC A;  3CNG A;  4ODL A;  4IQC A;  2ZR4 A;  2PV3 A;  2ZR6 A;  1KT0 A;  4GGQ A;  3WH0 A;  4DRH A;  4DH0 A;  4U84 A;  1EYM A;  2PPN A;  2ZQV A;  3KAI A;  2KXQ A;  1WMV A;  1W26 A;  4QIB A;  2BA1 A;  2XPB A;  3O5Q A;  1F8A B;  2KGJ A;  4MGV A;  1NSG A;  2MF9 A;  1NMW A;  1JVW A;  2DG4 A;  2KE0 A;  1D7I A;  1NMV A; 
#chains in the Genus database with same CATH topology
 3AS1 A;  3O5M A;  2FDM A;  3TC5 A;  4DRP A;  3PRD A;  4IPX A;  1O6I A;  2IF4 A;  4Z2I A;  1B6C A;  2N87 A;  4DRM A;  4P8U A;  1J6Y A;  3ALF A;  2DWV A;  5E64 A;  5HW7 A;  1HKI A;  2MLX A;  5GQB A;  2K8I A;  2ZQU A;  5GPG A;  3VAW A;  2XP9 A;  3ARR A;  2LAJ A;  2DSZ A;  3WQV A;  4DWS C;  1HKK A;  5HWC A;  1X6N A;  1W1V A;  3GTY X;  1D2K A;  4PTM A;  5E65 A;  2EUL A;  3UQB A;  1QPL A;  1LQ0 A;  4G2P A;  1EQ3 A;  2RUC A;  1XHG A;  1LL4 A;  2WLZ A;  1ZU8 A;  3ARY A;  3RM4 A;  2LJ4 A;  5CQ2 A;  1OGG A;  1ZK6 A;  2VCD A;  2A3C A;  1JNS A;  2L4J A;  4LAX A;  2G41 A;  4ITZ A;  1D6O A;  4HBO A;  4P8V A;  4Z2L A;  1U79 A;  1NWU A;  1I5H W;  3ARS A;  4JYS A;  1HKM A;  5D75 A;  2ESC A;  4R0X A;  3MCB B;  1TCO C;  4TX0 A;  2JV4 A;  3AS2 A;  3WD2 A;  4TNS A;  4LAW A;  4U86 A;  1FD9 A;  4QT3 A;  4C02 B;  4A0U A;  5E5W A;  1FKT A;  1W9V A;  3O5K A;  1IX5 A;  4TW6 A;  1SR0 A;  2RSE A;  5HW6 A;  4ODP A;  1FJD A;  3M85 A;  2EZ5 W;  2JXW A;  4JFM A;  3EIP A;  1C9H A;  2DMV A;  4P8X A;  2DK1 A;  2P4V A;  4HBE A;  2DG3 A;  2KR7 A;  2VN1 A;  2YSH A;  1XRV A;  3AS3 A;  2ZR5 A;  1ROU A;  4QT2 A;  5DO2 A;  1WR7 A;  3ARQ A;  2O9O A;  2MDI A;  1E44 A;  4AY1 A;  3PRB A;  2ETN A;  3GPK A;  3I6C A;  3OA5 A;  1EHN A;  4Z2K A;  1Y0O A;  3ART A;  5HT1 A;  3UF8 A;  4QZV B;  4MSP A;  1NWR A;  2RQS A;  1FKJ A;  1J4R A;  1FFQ A;  1GPF A;  2DG9 A;  2IUZ A;  4ODN A;  3RM8 A;  3FAP A;  1HJV A;  2F4E A;  3O5L A;  3NRK A;  4DRK A;  1WAW A;  5DIT A;  3PQH A;  1E6N A;  4G50 A;  5DEZ A;  3KAG A;  1Q6U A;  1K9Q A;  1ROT A;  3NTP A;  4NNR A;  4W5U A;  4S3J A;  1ZL1 A;  4DRQ A;  1UR9 A;  4DWS A;  3CGN A;  4DWS B;  1L1P A;  1VF8 A;  1EG4 A;  4J4N A;  2JMF A;  4J4O A;  1YAT A;  3FY1 A;  3NI6 A;  3O5D A;  3LUO A;  2KFW A;  1FAP A;  4WIW A;  3KCE A;  2YSI A;  4MNJ A;  2M1I A;  4URI A;  3KAC A;  3UQA A;  2ZAJ A;  2Y78 A;  5E62 A;  4W9Q A;  4A0T A;  2D9F A;  1PBK A;  4ODO A;  1EDQ A;  1W9U A;  2M2A A;  3UI5 A;  1KT1 A;  4JFI A;  1ZB5 A;  3ARP A;  3ARW A;  4W9O A;  1QPF A;  3O5J A;  2A3A A;  5AHT A;  4Z2G A;  4E5R A;  3RFW A;  3WQW A;  2OLH A;  4DT4 A;  1KFW A;  3G6L A;  2DSW A;  1BKF A;  1RD6 A;  3WD3 A;  4DIP A;  5DIV A;  4DZ3 A;  2OFN A;  2FAP A;  3WL0 A;  2AWG A;  5JH8 A;  2WK2 A;  2AOS A;  3O5G A;  4UDM A;  3KAF A;  2DT3 A;  3IKD A;  5B8I C;  3RM9 A;  3B9A A;  3JYJ A;  1ZBK A;  2MNT A;  4WKF A;  5DIU A;  1PIN A;  1LG2 A;  4DRI A;  3MCB A;  1LJY A;  1FKS A;  3WD1 A;  4JFJ A;  5HWB A;  1T11 A;  2Q5A A;  2YSG A;  4HAR A;  3WD4 A;  2F2D A;  2KI3 A;  1E9L A;  2ZQS A;  3UI4 A;  3CHF A;  5GPR A;  1WB0 A;  2RE3 A;  3O5O A;  4ZS6 A;  4Z2J A;  2UZ5 A;  4NSB A;  2DSV A;  2DPE A;  2OWO A;  3JXV A;  3QOK A;  2QRV A;  3L4H A;  3PR9 A;  3CGM A;  4TW8 A;  4FAP A;  3FXY A;  4L3N A;  1NWT A;  4MTV A;  2DT1 A;  1FFR A;  2WM0 A;  4FN2 A;  4JFL A;  4KR0 B;  4N19 A;  2F23 A;  2KO7 A;  1GUV A;  1J4H A;  3OOB A;  2XP5 A;  1D7H A;  2XP6 A;  3O5P A;  3O5I A;  3PA7 A;  3W4R A;  1HXV A;  2F21 A;  2XP4 A;  2MLY A;  5DF0 A;  1N1A A;  3KZ7 A;  1HJX A;  1FKH A;  1LL7 A;  3TCZ A;  3B9D A;  4XAK A;  5HTG A;  1H0I A;  3JYM A;  4IQ2 A;  5HW8 A;  4ODQ A;  5J6E A;  4REX A;  3IKG A;  2A3B A;  4R5E A;  3ALG A;  2XP7 A;  4P8W A;  3CZ8 A;  3CHE A;  1JND A;  2PV1 A;  1M5Y A;  1Q1C A;  4MPK A;  3M7N A;  3O5E A;  5I98 A;  1EG3 A;  5E66 A;  1HJW A;  1ITX A;  2M08 A;  1FKB A;  4MNK A;  1ZBV A;  2PPO A;  3IHZ A;  2YSF A;  4DWS D;  4WKH A;  1P5Q A;  2MLZ A;  4MNM A;  2XP8 A;  2O92 A;  3B8S A;  1GOI A;  3EY6 A;  5BXJ A;  2LGO A;  4DRJ A;  1YW5 A;  1Q6I A;  1SYT A;  2PBC A;  2RUD A;  4BF8 A;  4S3K A;  4ODK A;  1BL4 A;  4TYO A;  2JX8 A;  1E6P A;  1F40 A;  2G8Z A;  1E6Z A;  3KAB A;  1FKG A;  3IK8 A;  2WLY A;  1D7J A;  4NZC A;  4MNL A;  3MQH A;  2LKN A;  2M8I A;  2XP3 A;  2XPA A;  1FKL A;  1TFV A;  4TW7 A;  2B5U B;  4DRN A;  3LE4 A;  2RUR A;  4WKA A;  2LPV A;  4L72 B;  3CHD A;  1TR8 A;  1NH6 A;  1FKI A;  3AS0 A;  3ARU A;  4Z2H A;  1OGB A;  3O5R A;  3ODK A;  3FSC A;  2QF8 A;  4KQZ A;  4O2T A;  1TK7 A;  3H9R B;  2JZV A;  4Q22 A;  2MPH A;  1K9T A;  3RME A;  5HBF A;  1CTN A;  1LL6 A;  1QZ2 A;  2ZQT A;  2PV2 A;  4ZPT R;  2M3O W;  3KAD A;  3UI6 A;  3WKZ A;  5U47 A;  3B7X A;  1FKD A;  1GRJ A;  1W1P A;  1A7X A;  3WIJ A;  4LGX A;  2DT0 A;  4DRO A;  3BXW A;  4GLX A;  4ODR A;  5HUA A;  4ZPV R;  4JFK A;  3MDY B;  5HKG A;  2YSB A;  2PN0 A;  4ML4 A;  1H0G A;  2DSU A;  3LKX A;  4W9P A;  4LAV A;  3LKX B;  1ZBC A;  3B9E A;  3ARV A;  3WL1 A;  1JNT A;  4IT6 A;  4U85 A;  4ODM A;  2B31 A;  1J4I A;  4ZPW R;  1FKK A;  4DZ2 A;  2YAJ B;  1RP5 A;  1JCH B;  3CH9 A;  1K9R A;  1NWS A;  1O6W A;  1UR8 A;  3AQU A;  1FKR A;  3KAH A;  3WD0 A;  2DJY A;  4WJX A;  1X6L A;  1ZBW A;  2L2S A;  1ZCN A;  2RUQ A;  2FKE A;  3ARZ A;  3MQG A;  1JMQ A;  3TDB A;  1Q6H A;  1FKF A;  2DT2 A;  4GIV A;  3UQI A;  4LAY A;  3PRA A;  4MAV A;  3BMB A;  3ARO A;  2E45 A;  3CHC A;  2ITK A;  1R9H A;  2Y8N B;  1FLC A;  3GU0 A;  3ARX A;  1W9P A;  2M8J A;  2PPP A;  3O5F A;  2DK7 A;  1LG1 A;  3RGC A;  2YBU A;  3CNG A;  4ODL A;  2WAD A;  1W1T A;  2WAE A;  4IQC A;  2ZR4 A;  2PV3 A;  2ZR6 A;  2YBT A;  4IT4 A;  1KT0 A;  1W1Y A;  4GGQ A;  3WH0 A;  4DRH A;  4DH0 A;  4U84 A;  1EIB A;  1WNO A;  1EYM A;  3FSB A;  2PPN A;  2ZQV A;  3KAI A;  2KXQ A;  1WMV A;  3FS8 A;  1W26 A;  4QIB A;  1E6R A;  2BA1 A;  1OWQ A;  1JNE A;  2XPB A;  3O5Q A;  1F8A B;  2KGJ A;  1E15 A;  3G6M A;  4MGV A;  1HKJ A;  4WK9 A;  4Q7N A;  1NSG A;  2MF9 A;  1NMW A;  2A3E A;  1JVW A;  2DG4 A;  2KE0 A;  1D7I A;  1NMV A;  2PI6 A; 
#chains in the Genus database with same CATH homology
 3AS1 A;  3O5M A;  2FDM A;  3TC5 A;  4DRP A;  3PRD A;  4IPX A;  1O6I A;  2IF4 A;  4Z2I A;  1B6C A;  2N87 A;  4DRM A;  4P8U A;  1J6Y A;  3ALF A;  2DWV A;  5E64 A;  5HW7 A;  1HKI A;  2MLX A;  5GQB A;  2K8I A;  2ZQU A;  5GPG A;  3VAW A;  2XP9 A;  3ARR A;  2LAJ A;  2DSZ A;  3WQV A;  4DWS C;  1HKK A;  5HWC A;  1X6N A;  1W1V A;  1D2K A;  4PTM A;  5E65 A;  3UQB A;  1QPL A;  1LQ0 A;  4G2P A;  1EQ3 A;  2RUC A;  1XHG A;  1LL4 A;  2WLZ A;  1ZU8 A;  3ARY A;  3RM4 A;  2LJ4 A;  5CQ2 A;  1OGG A;  1ZK6 A;  2VCD A;  2A3C A;  1JNS A;  2L4J A;  4LAX A;  2G41 A;  4ITZ A;  1D6O A;  4HBO A;  4P8V A;  4Z2L A;  1U79 A;  1NWU A;  1I5H W;  3ARS A;  4JYS A;  1HKM A;  5D75 A;  2ESC A;  4R0X A;  3MCB B;  1TCO C;  4TX0 A;  2JV4 A;  3AS2 A;  3WD2 A;  4TNS A;  4LAW A;  4U86 A;  1FD9 A;  4QT3 A;  4C02 B;  4A0U A;  5E5W A;  1FKT A;  1W9V A;  3O5K A;  1IX5 A;  4TW6 A;  1SR0 A;  2RSE A;  5HW6 A;  4ODP A;  1FJD A;  3M85 A;  2EZ5 W;  2JXW A;  4JFM A;  1C9H A;  2DMV A;  4P8X A;  2DK1 A;  4HBE A;  2DG3 A;  2KR7 A;  2VN1 A;  2YSH A;  1XRV A;  3AS3 A;  2ZR5 A;  1ROU A;  4QT2 A;  5DO2 A;  1WR7 A;  3ARQ A;  2O9O A;  2MDI A;  4AY1 A;  3PRB A;  3GPK A;  3I6C A;  3OA5 A;  1EHN A;  4Z2K A;  1Y0O A;  3ART A;  5HT1 A;  3UF8 A;  4QZV B;  4MSP A;  1NWR A;  2RQS A;  1FKJ A;  1J4R A;  1FFQ A;  1GPF A;  2DG9 A;  2IUZ A;  4ODN A;  3RM8 A;  3FAP A;  1HJV A;  2F4E A;  3O5L A;  3NRK A;  4DRK A;  1WAW A;  5DIT A;  3PQH A;  1E6N A;  4G50 A;  5DEZ A;  3KAG A;  1Q6U A;  1K9Q A;  1ROT A;  3NTP A;  4NNR A;  4W5U A;  4S3J A;  1ZL1 A;  4DRQ A;  1UR9 A;  4DWS A;  3CGN A;  4DWS B;  1L1P A;  1VF8 A;  1EG4 A;  4J4N A;  2JMF A;  4J4O A;  1YAT A;  3FY1 A;  3NI6 A;  3O5D A;  3LUO A;  2KFW A;  1FAP A;  4WIW A;  3KCE A;  2YSI A;  4MNJ A;  2M1I A;  4URI A;  3KAC A;  3UQA A;  2ZAJ A;  2Y78 A;  5E62 A;  4W9Q A;  4A0T A;  2D9F A;  1PBK A;  4ODO A;  1EDQ A;  1W9U A;  2M2A A;  3UI5 A;  1KT1 A;  4JFI A;  1ZB5 A;  3ARP A;  3ARW A;  4W9O A;  1QPF A;  3O5J A;  2A3A A;  5AHT A;  4Z2G A;  4E5R A;  3RFW A;  3WQW A;  2OLH A;  4DT4 A;  1KFW A;  3G6L A;  2DSW A;  1BKF A;  1RD6 A;  3WD3 A;  4DIP A;  5DIV A;  4DZ3 A;  2OFN A;  2FAP A;  3WL0 A;  2AWG A;  5JH8 A;  2WK2 A;  2AOS A;  3O5G A;  3KAF A;  2DT3 A;  3IKD A;  5B8I C;  3RM9 A;  3B9A A;  3JYJ A;  1ZBK A;  2MNT A;  4WKF A;  5DIU A;  1PIN A;  1LG2 A;  4DRI A;  3MCB A;  1LJY A;  1FKS A;  3WD1 A;  4JFJ A;  5HWB A;  1T11 A;  2Q5A A;  2YSG A;  4HAR A;  3WD4 A;  2F2D A;  2KI3 A;  1E9L A;  2ZQS A;  3UI4 A;  3CHF A;  5GPR A;  1WB0 A;  2RE3 A;  3O5O A;  4ZS6 A;  4Z2J A;  2UZ5 A;  4NSB A;  2DSV A;  2DPE A;  2OWO A;  3JXV A;  3QOK A;  2QRV A;  3L4H A;  3PR9 A;  3CGM A;  4TW8 A;  4FAP A;  3FXY A;  4L3N A;  1NWT A;  4MTV A;  2DT1 A;  1FFR A;  2WM0 A;  4FN2 A;  4JFL A;  4KR0 B;  4N19 A;  2KO7 A;  1GUV A;  1J4H A;  3OOB A;  2XP5 A;  1D7H A;  2XP6 A;  3O5P A;  3O5I A;  3PA7 A;  3W4R A;  1HXV A;  2F21 A;  2XP4 A;  2MLY A;  5DF0 A;  1N1A A;  3KZ7 A;  1HJX A;  1FKH A;  1LL7 A;  3TCZ A;  3B9D A;  4XAK A;  5HTG A;  1H0I A;  3JYM A;  4IQ2 A;  5HW8 A;  4ODQ A;  5J6E A;  4REX A;  3IKG A;  2A3B A;  4R5E A;  3ALG A;  2XP7 A;  4P8W A;  3CZ8 A;  3CHE A;  1JND A;  2PV1 A;  1M5Y A;  1Q1C A;  4MPK A;  3M7N A;  3O5E A;  5I98 A;  1EG3 A;  5E66 A;  1HJW A;  1ITX A;  2M08 A;  1FKB A;  4MNK A;  1ZBV A;  2PPO A;  3IHZ A;  2YSF A;  4DWS D;  4WKH A;  1P5Q A;  2MLZ A;  4MNM A;  2XP8 A;  2O92 A;  3B8S A;  1GOI A;  3EY6 A;  5BXJ A;  2LGO A;  4DRJ A;  1YW5 A;  1Q6I A;  1SYT A;  2PBC A;  2RUD A;  4BF8 A;  4S3K A;  4ODK A;  1BL4 A;  4TYO A;  2JX8 A;  1E6P A;  1F40 A;  2G8Z A;  1E6Z A;  3KAB A;  1FKG A;  3IK8 A;  2WLY A;  1D7J A;  4NZC A;  4MNL A;  3MQH A;  2LKN A;  2M8I A;  2XP3 A;  2XPA A;  1FKL A;  1TFV A;  4TW7 A;  4DRN A;  3LE4 A;  2RUR A;  4WKA A;  2LPV A;  4L72 B;  3CHD A;  1TR8 A;  1NH6 A;  1FKI A;  3AS0 A;  3ARU A;  4Z2H A;  1OGB A;  3O5R A;  3ODK A;  3FSC A;  2QF8 A;  4KQZ A;  4O2T A;  1TK7 A;  3H9R B;  2JZV A;  4Q22 A;  2MPH A;  1K9T A;  3RME A;  5HBF A;  1CTN A;  1LL6 A;  1QZ2 A;  2ZQT A;  2PV2 A;  4ZPT R;  2M3O W;  3KAD A;  3UI6 A;  3WKZ A;  5U47 A;  3B7X A;  1FKD A;  1W1P A;  1A7X A;  3WIJ A;  4LGX A;  2DT0 A;  4DRO A;  3BXW A;  4GLX A;  4ODR A;  5HUA A;  4ZPV R;  4JFK A;  3MDY B;  5HKG A;  2YSB A;  4ML4 A;  1H0G A;  2DSU A;  3LKX A;  4W9P A;  4LAV A;  3LKX B;  1ZBC A;  3B9E A;  3ARV A;  3WL1 A;  1JNT A;  4IT6 A;  4U85 A;  4ODM A;  2B31 A;  1J4I A;  4ZPW R;  1FKK A;  4DZ2 A;  2YAJ B;  1RP5 A;  3CH9 A;  1K9R A;  1NWS A;  1O6W A;  1UR8 A;  3AQU A;  1FKR A;  3KAH A;  3WD0 A;  2DJY A;  4WJX A;  1X6L A;  1ZBW A;  2L2S A;  1ZCN A;  2RUQ A;  2FKE A;  3ARZ A;  3MQG A;  1JMQ A;  3TDB A;  1Q6H A;  1FKF A;  2DT2 A;  4GIV A;  3UQI A;  4LAY A;  3PRA A;  4MAV A;  3ARO A;  2E45 A;  3CHC A;  2ITK A;  1R9H A;  2Y8N B;  1FLC A;  3ARX A;  1W9P A;  2M8J A;  2PPP A;  3O5F A;  2DK7 A;  1LG1 A;  3RGC A;  2YBU A;  3CNG A;  4ODL A;  2WAD A;  1W1T A;  2WAE A;  4IQC A;  2ZR4 A;  2PV3 A;  2ZR6 A;  2YBT A;  4IT4 A;  1KT0 A;  1W1Y A;  4GGQ A;  3WH0 A;  4DRH A;  4DH0 A;  4U84 A;  1EIB A;  1WNO A;  1EYM A;  3FSB A;  2PPN A;  2ZQV A;  3KAI A;  2KXQ A;  1WMV A;  3FS8 A;  1W26 A;  4QIB A;  1E6R A;  2BA1 A;  1OWQ A;  1JNE A;  2XPB A;  3O5Q A;  1F8A B;  2KGJ A;  1E15 A;  3G6M A;  4MGV A;  1HKJ A;  4WK9 A;  4Q7N A;  1NSG A;  2MF9 A;  1NMW A;  2A3E A;  1JVW A;  2DG4 A;  2KE0 A;  1D7I A;  1NMV A;  2PI6 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...