2LAJA

Third ww domain of human nedd4l in complex with doubly phosphorylated human smad3 derived peptide
Total Genus 4
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
4
sequence length
40
structure length
40
Chain Sequence
QSFLPPGWEMRIAPNGRPFFYDHNTKTTTWEDPRLKFPVH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Ligase/transcription regulator
molecule keywords E3 ubiquitin-protein ligase NEDD4-like
publication title A Smad action turnover switch operated by WW domain readers of a phosphoserine code.
pubmed doi rcsb
source organism Homo sapiens
total genus 4
structure length 40
sequence length 40
ec nomenclature ec 2.3.2.26: HECT-type E3 ubiquitin transferase.
pdb deposition date 2011-03-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00397 WW WW domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.20.70.10 Mainly Beta Single Sheet Ubiquitin Ligase Nedd4; Chain: W; Ubiquitin Ligase Nedd4; Chain: W; 2lajA01
2ZR6A 1EG3A 2XPAA 2JX8A 2RE3A 2XP9A 2DJYA 2M3OW 4REXA 2DK1A 1K9RA 1WMVA 3LE4A 3KABA 3KAFA 2LAJA 2ZQVA 3KAIA 2XP7A 3TDBA 3OOBA 2YSBA 2M8JA 2KXQA 3KAHA 3TCZA 2XP5A 2DWVA 5AHTA 3KCEA 1F8AB 1EG4A 3WH0A 2M8IA 3CNGA 3M7NA 3KAGA 5CQ2A 2XP3A 4U85A 4QIBA 2L4JA 2Q5AA 2JMFA 1O6WA 3M85A 3KADA 2XP6A 1I5HW 2MDIA 1K9QA 2E45A 2YSIA 2EZ5W 2JV4A 2XP4A 2XPBA 2ZQTA 1WR7A 2ZQSA 2XP8A 3L4HA 2ZAJA 1PINA 3ODKA 2YSFA 2JXWA 2YSHA 1ZCNA 1TK7A 4E5RA 2BA1A 1JMQA 1YW5A 2ZR5A 4U84A 2DK7A 2ZR4A 3NTPA 2DMVA 4U86A 3TC5A 2F21A 1NMVA 2YSGA 2ITKA 2ZQUA
chains in the Genus database with same CATH superfamily
2ZR6A 1EG3A 2XPAA 5U47A 3LKXB 4GLXA 2JX8A 2RE3A 2XP9A 2DJYA 2M3OW 4REXA 2DK1A 1K9RA 1WMVA 3LE4A 3KABA 3KAFA 2LAJA 2ZQVA 3KAIA 5E64A 2XP7A 3TDBA 3OOBA 2YSBA 1RP5A 2M8JA 2KXQA 3KAHA 3TCZA 2XP5A 2DWVA 5AHTA 3KCEA 1F8AB 2QRVA 1TR8A 1EG4A 3WH0A 2M8IA 3CNGA 3M7NA 3KAGA 3MQGA 3MCBA 5CQ2A 3PQHA 2XP3A 4U85A 3MQHA 2YAJB 4QIBA 2L4JA 2WADA 5E5WA 2Q5AA 2JMFA 1O6WA 3M85A 3KADA 2XP6A 1I5HW 2MDIA 1K9QA 2E45A 3FSBA 2YSIA 2EZ5W 2JV4A 2XP4A 2XPBA 5E65A 2ZQTA 1FLCA 1WR7A 2Y8NB 2ZQSA 2XP8A 5E62A 3L4HA 2ZAJA 1PINA 3ODKA 2YSFA 2JXWA 2YSHA 1ZCNA 1TK7A 4E5RA 3FSCA 3MCBB 4A0UA 4A0TA 2BA1A 1JMQA 1YW5A 2ZR5A 4U84A 2DK7A 2ZR4A 3NTPA 3LKXA 5E66A 3FS8A 2DMVA 4U86A 3TC5A 2F21A 2WAEA 1NMVA 2YSGA 2ITKA 2ZQUA 2OWOA
chains in the Genus database with same CATH topology
2ZR6A 1EG3A 2XPAA 5U47A 3LKXB 4GLXA 2JX8A 2RE3A 2XP9A 2DJYA 2M3OW 4REXA 2DK1A 1K9RA 1WMVA 3LE4A 3KABA 3KAFA 2LAJA 2ZQVA 3KAIA 5E64A 2XP7A 3TDBA 3OOBA 2YSBA 1RP5A 2M8JA 2KXQA 3KAHA 3TCZA 2XP5A 2DWVA 5AHTA 3KCEA 1F8AB 2QRVA 1TR8A 1EG4A 3WH0A 2M8IA 3CNGA 3M7NA 3KAGA 3MQGA 3MCBA 5CQ2A 3PQHA 2XP3A 4U85A 3MQHA 2YAJB 4QIBA 2L4JA 2WADA 5E5WA 2Q5AA 2JMFA 1O6WA 3M85A 3KADA 2XP6A 1I5HW 2MDIA 1K9QA 2E45A 3FSBA 2YSIA 2EZ5W 2JV4A 2XP4A 2XPBA 5E65A 2ZQTA 1FLCA 1WR7A 2Y8NB 2ZQSA 2XP8A 5E62A 3L4HA 2ZAJA 1PINA 3ODKA 2YSFA 2JXWA 2YSHA 1ZCNA 1TK7A 4E5RA 3FSCA 3MCBB 4A0UA 4A0TA 2BA1A 1JMQA 1YW5A 2ZR5A 4U84A 2DK7A 2ZR4A 3NTPA 3LKXA 5E66A 3FS8A 2DMVA 4U86A 3TC5A 2F21A 2WAEA 1NMVA 2YSGA 2ITKA 2ZQUA 2OWOA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2ZR6 A;  1EG3 A;  2XPA A;  2JX8 A;  2RE3 A;  2XP9 A;  2DJY A;  2M3O W;  4REX A;  2DK1 A;  1K9R A;  1WMV A;  3LE4 A;  3KAB A;  3KAF A;  2LAJ A;  2ZQV A;  3KAI A;  2XP7 A;  3TDB A;  3OOB A;  2YSB A;  2M8J A;  2KXQ A;  3KAH A;  3TCZ A;  2XP5 A;  2DWV A;  5AHT A;  3KCE A;  1F8A B;  1EG4 A;  3WH0 A;  2M8I A;  3CNG A;  3M7N A;  3KAG A;  5CQ2 A;  2XP3 A;  4U85 A;  4QIB A;  2L4J A;  2Q5A A;  2JMF A;  1O6W A;  3M85 A;  3KAD A;  2XP6 A;  1I5H W;  2MDI A;  1K9Q A;  2E45 A;  2YSI A;  2EZ5 W;  2JV4 A;  2XP4 A;  2XPB A;  2ZQT A;  1WR7 A;  2ZQS A;  2XP8 A;  3L4H A;  2ZAJ A;  1PIN A;  3ODK A;  2YSF A;  2JXW A;  2YSH A;  1ZCN A;  1TK7 A;  4E5R A;  2BA1 A;  1JMQ A;  1YW5 A;  2ZR5 A;  4U84 A;  2DK7 A;  2ZR4 A;  3NTP A;  2DMV A;  4U86 A;  3TC5 A;  2F21 A;  1NMV A;  2YSG A;  2ITK A;  2ZQU A; 
#chains in the Genus database with same CATH topology
 2ZR6 A;  1EG3 A;  2XPA A;  5U47 A;  3LKX B;  4GLX A;  2JX8 A;  2RE3 A;  2XP9 A;  2DJY A;  2M3O W;  4REX A;  2DK1 A;  1K9R A;  1WMV A;  3LE4 A;  3KAB A;  3KAF A;  2LAJ A;  2ZQV A;  3KAI A;  5E64 A;  2XP7 A;  3TDB A;  3OOB A;  2YSB A;  1RP5 A;  2M8J A;  2KXQ A;  3KAH A;  3TCZ A;  2XP5 A;  2DWV A;  5AHT A;  3KCE A;  1F8A B;  2QRV A;  1TR8 A;  1EG4 A;  3WH0 A;  2M8I A;  3CNG A;  3M7N A;  3KAG A;  3MQG A;  3MCB A;  5CQ2 A;  3PQH A;  2XP3 A;  4U85 A;  3MQH A;  2YAJ B;  4QIB A;  2L4J A;  2WAD A;  5E5W A;  2Q5A A;  2JMF A;  1O6W A;  3M85 A;  3KAD A;  2XP6 A;  1I5H W;  2MDI A;  1K9Q A;  2E45 A;  3FSB A;  2YSI A;  2EZ5 W;  2JV4 A;  2XP4 A;  2XPB A;  5E65 A;  2ZQT A;  1FLC A;  1WR7 A;  2Y8N B;  2ZQS A;  2XP8 A;  5E62 A;  3L4H A;  2ZAJ A;  1PIN A;  3ODK A;  2YSF A;  2JXW A;  2YSH A;  1ZCN A;  1TK7 A;  4E5R A;  3FSC A;  3MCB B;  4A0U A;  4A0T A;  2BA1 A;  1JMQ A;  1YW5 A;  2ZR5 A;  4U84 A;  2DK7 A;  2ZR4 A;  3NTP A;  3LKX A;  5E66 A;  3FS8 A;  2DMV A;  4U86 A;  3TC5 A;  2F21 A;  2WAE A;  1NMV A;  2YSG A;  2ITK A;  2ZQU A;  2OWO A; 
#chains in the Genus database with same CATH homology
 2ZR6 A;  1EG3 A;  2XPA A;  5U47 A;  3LKX B;  4GLX A;  2JX8 A;  2RE3 A;  2XP9 A;  2DJY A;  2M3O W;  4REX A;  2DK1 A;  1K9R A;  1WMV A;  3LE4 A;  3KAB A;  3KAF A;  2LAJ A;  2ZQV A;  3KAI A;  5E64 A;  2XP7 A;  3TDB A;  3OOB A;  2YSB A;  1RP5 A;  2M8J A;  2KXQ A;  3KAH A;  3TCZ A;  2XP5 A;  2DWV A;  5AHT A;  3KCE A;  1F8A B;  2QRV A;  1TR8 A;  1EG4 A;  3WH0 A;  2M8I A;  3CNG A;  3M7N A;  3KAG A;  3MQG A;  3MCB A;  5CQ2 A;  3PQH A;  2XP3 A;  4U85 A;  3MQH A;  2YAJ B;  4QIB A;  2L4J A;  2WAD A;  5E5W A;  2Q5A A;  2JMF A;  1O6W A;  3M85 A;  3KAD A;  2XP6 A;  1I5H W;  2MDI A;  1K9Q A;  2E45 A;  3FSB A;  2YSI A;  2EZ5 W;  2JV4 A;  2XP4 A;  2XPB A;  5E65 A;  2ZQT A;  1FLC A;  1WR7 A;  2Y8N B;  2ZQS A;  2XP8 A;  5E62 A;  3L4H A;  2ZAJ A;  1PIN A;  3ODK A;  2YSF A;  2JXW A;  2YSH A;  1ZCN A;  1TK7 A;  4E5R A;  3FSC A;  3MCB B;  4A0U A;  4A0T A;  2BA1 A;  1JMQ A;  1YW5 A;  2ZR5 A;  4U84 A;  2DK7 A;  2ZR4 A;  3NTP A;  3LKX A;  5E66 A;  3FS8 A;  2DMV A;  4U86 A;  3TC5 A;  2F21 A;  2WAE A;  1NMV A;  2YSG A;  2ITK A;  2ZQU A;  2OWO A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...