2LAJA

Third ww domain of human nedd4l in complex with doubly phosphorylated human smad3 derived peptide
Total Genus 4
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
4
sequence length
40
structure length
40
Chain Sequence
QSFLPPGWEMRIAPNGRPFFYDHNTKTTTWEDPRLKFPVH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords E3 ubiquitin-protein ligase NEDD4-like
publication title A Smad action turnover switch operated by WW domain readers of a phosphoserine code.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Ligase/transcription regulator
total genus 4
structure length 40
sequence length 40
ec nomenclature ec 2.3.2.26: HECT-type E3 ubiquitin transferase.
pdb deposition date 2011-03-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00397 WW WW domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.20.70.10 Mainly Beta Single Sheet Ubiquitin Ligase Nedd4; Chain: W; Ubiquitin Ligase Nedd4; Chain: W; 2lajA01
4QIBA 2M8IA 3ODKA 2DMVA 2ZQUA 2Q5AA 2EZ5W 3KAHA 2BA1A 3TCZA 3M7NA 1EG3A 2M3OW 3KAFA 3TC5A 2JV4A 2LAJA 2E45A 1TK7A 2XP6A 3KAGA 1WMVA 2L4JA 2YSGA 3LE4A 2ZR4A 1WR7A 2KXQA 2M8JA 2XP7A 4U84A 1F8AB 2DK7A 1K9QA 2JXWA 3CNGA 2YSFA 3TDBA 3L4HA 5CQ2A 5AHTA 2DJYA 2YSIA 1NMVA 3KAIA 3KADA 2XP8A 2DWVA 2JX8A 2ZR6A 2YSHA 2ZQSA 1PINA 2ZAJA 3WH0A 2XP9A 4U85A 2XP4A 4REXA 1JMQA 2XPAA 2JMFA 3KCEA 3M85A 1YW5A 4E5RA 2DK1A 2XP3A 3NTPA 3KABA 2F21A 1I5HW 1ZCNA 2XPBA 1EG4A 2ZR5A 2XP5A 2YSBA 2ITKA 2MDIA 4U86A 1K9RA 2ZQTA 2ZQVA 2RE3A 3OOBA 1O6WA
chains in the Genus database with same CATH superfamily
4QIBA 2M8IA 3ODKA 5E5WA 2DMVA 2ZQUA 2Q5AA 2EZ5W 5E64A 3MQGA 3MCBA 3KAHA 2BA1A 5E66A 3TCZA 3M7NA 1EG3A 2M3OW 3KAFA 3TC5A 2JV4A 2LAJA 3FS8A 2Y8NB 2E45A 1TK7A 2XP6A 3KAGA 1WMVA 2L4JA 5E65A 2YSGA 3LE4A 2ZR4A 1WR7A 2KXQA 2M8JA 2XP7A 4U84A 1F8AB 2DK7A 1K9QA 2JXWA 3CNGA 2YSFA 3LKXB 3TDBA 2QRVA 3L4HA 5CQ2A 2WADA 5AHTA 2DJYA 2YSIA 1NMVA 1FLCA 3MQHA 5U47A 1TR8A 3KAIA 3KADA 2XP8A 2WAEA 2DWVA 2JX8A 5E62A 2ZR6A 3FSCA 2YSHA 2ZQSA 1RP5A 1PINA 2ZAJA 4GLXA 3WH0A 4A0UA 2XP9A 4U85A 2XP4A 3LKXA 4REXA 1JMQA 2XPAA 2JMFA 3KCEA 3M85A 1YW5A 4E5RA 2DK1A 3MCBB 2XP3A 3NTPA 3KABA 3PQHA 2F21A 1I5HW 4A0TA 1ZCNA 2XPBA 1EG4A 2ZR5A 2XP5A 2YSBA 2ITKA 2MDIA 4U86A 1K9RA 3FSBA 2OWOA 2ZQTA 2YAJB 2ZQVA 2RE3A 3OOBA 1O6WA
chains in the Genus database with same CATH topology
4QIBA 2M8IA 3ODKA 5E5WA 2DMVA 2ZQUA 2Q5AA 2EZ5W 5E64A 3MQGA 3MCBA 3KAHA 2BA1A 5E66A 3TCZA 3M7NA 1EG3A 2M3OW 3KAFA 3TC5A 2JV4A 2LAJA 3FS8A 2Y8NB 2E45A 1TK7A 2XP6A 3KAGA 1WMVA 2L4JA 5E65A 2YSGA 3LE4A 2ZR4A 1WR7A 2KXQA 2M8JA 2XP7A 4U84A 1F8AB 2DK7A 1K9QA 2JXWA 3CNGA 2YSFA 3LKXB 3TDBA 2QRVA 3L4HA 5CQ2A 2WADA 5AHTA 2DJYA 2YSIA 1NMVA 1FLCA 3MQHA 5U47A 1TR8A 3KAIA 3KADA 2XP8A 2WAEA 2DWVA 2JX8A 5E62A 2ZR6A 3FSCA 2YSHA 2ZQSA 1RP5A 1PINA 2ZAJA 4GLXA 3WH0A 4A0UA 2XP9A 4U85A 2XP4A 3LKXA 4REXA 1JMQA 2XPAA 2JMFA 3KCEA 3M85A 1YW5A 4E5RA 2DK1A 3MCBB 2XP3A 3NTPA 3KABA 3PQHA 2F21A 1I5HW 4A0TA 1ZCNA 2XPBA 1EG4A 2ZR5A 2XP5A 2YSBA 2ITKA 2MDIA 4U86A 1K9RA 3FSBA 2OWOA 2ZQTA 2YAJB 2ZQVA 2RE3A 3OOBA 1O6WA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4QIB A;  2M8I A;  3ODK A;  2DMV A;  2ZQU A;  2Q5A A;  2EZ5 W;  3KAH A;  2BA1 A;  3TCZ A;  3M7N A;  1EG3 A;  2M3O W;  3KAF A;  3TC5 A;  2JV4 A;  2LAJ A;  2E45 A;  1TK7 A;  2XP6 A;  3KAG A;  1WMV A;  2L4J A;  2YSG A;  3LE4 A;  2ZR4 A;  1WR7 A;  2KXQ A;  2M8J A;  2XP7 A;  4U84 A;  1F8A B;  2DK7 A;  1K9Q A;  2JXW A;  3CNG A;  2YSF A;  3TDB A;  3L4H A;  5CQ2 A;  5AHT A;  2DJY A;  2YSI A;  1NMV A;  3KAI A;  3KAD A;  2XP8 A;  2DWV A;  2JX8 A;  2ZR6 A;  2YSH A;  2ZQS A;  1PIN A;  2ZAJ A;  3WH0 A;  2XP9 A;  4U85 A;  2XP4 A;  4REX A;  1JMQ A;  2XPA A;  2JMF A;  3KCE A;  3M85 A;  1YW5 A;  4E5R A;  2DK1 A;  2XP3 A;  3NTP A;  3KAB A;  2F21 A;  1I5H W;  1ZCN A;  2XPB A;  1EG4 A;  2ZR5 A;  2XP5 A;  2YSB A;  2ITK A;  2MDI A;  4U86 A;  1K9R A;  2ZQT A;  2ZQV A;  2RE3 A;  3OOB A;  1O6W A; 
#chains in the Genus database with same CATH topology
 4QIB A;  2M8I A;  3ODK A;  5E5W A;  2DMV A;  2ZQU A;  2Q5A A;  2EZ5 W;  5E64 A;  3MQG A;  3MCB A;  3KAH A;  2BA1 A;  5E66 A;  3TCZ A;  3M7N A;  1EG3 A;  2M3O W;  3KAF A;  3TC5 A;  2JV4 A;  2LAJ A;  3FS8 A;  2Y8N B;  2E45 A;  1TK7 A;  2XP6 A;  3KAG A;  1WMV A;  2L4J A;  5E65 A;  2YSG A;  3LE4 A;  2ZR4 A;  1WR7 A;  2KXQ A;  2M8J A;  2XP7 A;  4U84 A;  1F8A B;  2DK7 A;  1K9Q A;  2JXW A;  3CNG A;  2YSF A;  3LKX B;  3TDB A;  2QRV A;  3L4H A;  5CQ2 A;  2WAD A;  5AHT A;  2DJY A;  2YSI A;  1NMV A;  1FLC A;  3MQH A;  5U47 A;  1TR8 A;  3KAI A;  3KAD A;  2XP8 A;  2WAE A;  2DWV A;  2JX8 A;  5E62 A;  2ZR6 A;  3FSC A;  2YSH A;  2ZQS A;  1RP5 A;  1PIN A;  2ZAJ A;  4GLX A;  3WH0 A;  4A0U A;  2XP9 A;  4U85 A;  2XP4 A;  3LKX A;  4REX A;  1JMQ A;  2XPA A;  2JMF A;  3KCE A;  3M85 A;  1YW5 A;  4E5R A;  2DK1 A;  3MCB B;  2XP3 A;  3NTP A;  3KAB A;  3PQH A;  2F21 A;  1I5H W;  4A0T A;  1ZCN A;  2XPB A;  1EG4 A;  2ZR5 A;  2XP5 A;  2YSB A;  2ITK A;  2MDI A;  4U86 A;  1K9R A;  3FSB A;  2OWO A;  2ZQT A;  2YAJ B;  2ZQV A;  2RE3 A;  3OOB A;  1O6W A; 
#chains in the Genus database with same CATH homology
 4QIB A;  2M8I A;  3ODK A;  5E5W A;  2DMV A;  2ZQU A;  2Q5A A;  2EZ5 W;  5E64 A;  3MQG A;  3MCB A;  3KAH A;  2BA1 A;  5E66 A;  3TCZ A;  3M7N A;  1EG3 A;  2M3O W;  3KAF A;  3TC5 A;  2JV4 A;  2LAJ A;  3FS8 A;  2Y8N B;  2E45 A;  1TK7 A;  2XP6 A;  3KAG A;  1WMV A;  2L4J A;  5E65 A;  2YSG A;  3LE4 A;  2ZR4 A;  1WR7 A;  2KXQ A;  2M8J A;  2XP7 A;  4U84 A;  1F8A B;  2DK7 A;  1K9Q A;  2JXW A;  3CNG A;  2YSF A;  3LKX B;  3TDB A;  2QRV A;  3L4H A;  5CQ2 A;  2WAD A;  5AHT A;  2DJY A;  2YSI A;  1NMV A;  1FLC A;  3MQH A;  5U47 A;  1TR8 A;  3KAI A;  3KAD A;  2XP8 A;  2WAE A;  2DWV A;  2JX8 A;  5E62 A;  2ZR6 A;  3FSC A;  2YSH A;  2ZQS A;  1RP5 A;  1PIN A;  2ZAJ A;  4GLX A;  3WH0 A;  4A0U A;  2XP9 A;  4U85 A;  2XP4 A;  3LKX A;  4REX A;  1JMQ A;  2XPA A;  2JMF A;  3KCE A;  3M85 A;  1YW5 A;  4E5R A;  2DK1 A;  3MCB B;  2XP3 A;  3NTP A;  3KAB A;  3PQH A;  2F21 A;  1I5H W;  4A0T A;  1ZCN A;  2XPB A;  1EG4 A;  2ZR5 A;  2XP5 A;  2YSB A;  2ITK A;  2MDI A;  4U86 A;  1K9R A;  3FSB A;  2OWO A;  2ZQT A;  2YAJ B;  2ZQV A;  2RE3 A;  3OOB A;  1O6W A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...