3L4HA

Helical box domain and second ww domain of the human e3 ubiquitin-protein ligase hecw1
Total Genus 27
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
27
sequence length
109
structure length
109
Chain Sequence
LLLQSPAVKFITNPEFFTVLHANYSAYRVFTSSTCLKHMILKVRRDARNFERYQHNRDLVNFINMFADTRLELPRGWEIKTDQQGKSFFVDHNSRATTFIDPRIPLQNG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords E3 ubiquitin-protein ligase HECW1
publication title The tandem helical box and second WW domains of human HECW1
rcsb
source organism Homo sapiens
molecule tags Protein binding
total genus 27
structure length 109
sequence length 109
ec nomenclature ec 2.3.2.26: HECT-type E3 ubiquitin transferase.
pdb deposition date 2009-12-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF18436 HECW1_helix Helical box domain of E3 ubiquitin-protein ligase HECW1
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.20.70.10 Mainly Beta Single Sheet Ubiquitin Ligase Nedd4; Chain: W; Ubiquitin Ligase Nedd4; Chain: W; 3l4hA01
2ZQUA 3KAHA 4QIBA 4REXA 4U84A 2XP3A 1WMVA 1TK7A 1JMQA 3M7NA 2ZQSA 2M3OW 2DK7A 1K9QA 2DMVA 3TCZA 2JMFA 3KADA 2XP4A 2XPAA 1NMVA 2ZR6A 1EG3A 2ZR4A 2XP7A 2XPBA 1ZCNA 2L4JA 4U85A 3M85A 2ZQVA 2RE3A 2XP5A 5AHTA 3CNGA 3TC5A 3L4HA 1F8AB 2BA1A 2XP9A 2DK1A 2XP6A 2F21A 2M8JA 2YSGA 2JX8A 2JV4A 2MDIA 2ZQTA 1K9RA 2KXQA 2XP8A 3TDBA 2M8IA 2ITKA 2EZ5W 1PINA 2E45A 2LAJA 3LE4A 2DWVA 1WR7A 4U86A 2JXWA 3KAIA 1O6WA 1EG4A 2YSFA 3KAFA 3KAGA 2YSIA 3KABA 2YSHA 3WH0A 2DJYA 5CQ2A 1YW5A 2ZAJA 3KCEA 1I5HW 2YSBA 3ODKA 2ZR5A 4E5RA 3NTPA 3OOBA 2Q5AA
chains in the Genus database with same CATH superfamily
3LKXA 3FSBA 2ZQUA 3KAHA 4QIBA 4REXA 2WADA 3FS8A 2XP3A 3FSCA 4U84A 1WMVA 1TK7A 1JMQA 3M7NA 2ZQSA 2M3OW 2DK7A 1K9QA 2DMVA 3TCZA 3MCBA 2Y8NB 2JMFA 3KADA 1TR8A 2XP4A 2XPAA 1NMVA 2ZR6A 4A0TA 1EG3A 4A0UA 2ZR4A 2XP7A 2XPBA 1ZCNA 2L4JA 4U85A 3M85A 2ZQVA 3PQHA 2RE3A 2XP5A 5AHTA 1FLCA 5U47A 3CNGA 3TC5A 3L4HA 1F8AB 2BA1A 2XP9A 2DK1A 2XP6A 2F21A 2M8JA 2YSGA 2JX8A 3MQGA 2JV4A 2MDIA 2ZQTA 3MQHA 1K9RA 5E66A 2KXQA 3LKXB 5E65A 2XP8A 3TDBA 2M8IA 2ITKA 2OWOA 2EZ5W 1PINA 2E45A 2LAJA 3LE4A 2DWVA 1WR7A 4U86A 2JXWA 3KAIA 1O6WA 5E62A 1EG4A 2YSFA 3KAFA 3MCBB 3KAGA 2WAEA 4GLXA 2YSIA 3KABA 2YAJB 1RP5A 2YSHA 5E5WA 3WH0A 2DJYA 5CQ2A 2QRVA 1YW5A 2ZAJA 3KCEA 1I5HW 2YSBA 5E64A 3ODKA 2ZR5A 4E5RA 3NTPA 3OOBA 2Q5AA
chains in the Genus database with same CATH topology
3LKXA 3FSBA 2ZQUA 3KAHA 4QIBA 4REXA 2WADA 3FS8A 2XP3A 3FSCA 4U84A 1WMVA 1TK7A 1JMQA 3M7NA 2ZQSA 2M3OW 2DK7A 1K9QA 2DMVA 3TCZA 3MCBA 2Y8NB 2JMFA 3KADA 1TR8A 2XP4A 2XPAA 1NMVA 2ZR6A 4A0TA 1EG3A 4A0UA 2ZR4A 2XP7A 2XPBA 1ZCNA 2L4JA 4U85A 3M85A 2ZQVA 3PQHA 2RE3A 2XP5A 5AHTA 1FLCA 5U47A 3CNGA 3TC5A 3L4HA 1F8AB 2BA1A 2XP9A 2DK1A 2XP6A 2F21A 2M8JA 2YSGA 2JX8A 3MQGA 2JV4A 2MDIA 2ZQTA 3MQHA 1K9RA 5E66A 2KXQA 3LKXB 5E65A 2XP8A 3TDBA 2M8IA 2ITKA 2OWOA 2EZ5W 1PINA 2E45A 2LAJA 3LE4A 2DWVA 1WR7A 4U86A 2JXWA 3KAIA 1O6WA 5E62A 1EG4A 2YSFA 3KAFA 3MCBB 3KAGA 2WAEA 4GLXA 2YSIA 3KABA 2YAJB 1RP5A 2YSHA 5E5WA 3WH0A 2DJYA 5CQ2A 2QRVA 1YW5A 2ZAJA 3KCEA 1I5HW 2YSBA 5E64A 3ODKA 2ZR5A 4E5RA 3NTPA 3OOBA 2Q5AA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2ZQU A;  3KAH A;  4QIB A;  4REX A;  4U84 A;  2XP3 A;  1WMV A;  1TK7 A;  1JMQ A;  3M7N A;  2ZQS A;  2M3O W;  2DK7 A;  1K9Q A;  2DMV A;  3TCZ A;  2JMF A;  3KAD A;  2XP4 A;  2XPA A;  1NMV A;  2ZR6 A;  1EG3 A;  2ZR4 A;  2XP7 A;  2XPB A;  1ZCN A;  2L4J A;  4U85 A;  3M85 A;  2ZQV A;  2RE3 A;  2XP5 A;  5AHT A;  3CNG A;  3TC5 A;  3L4H A;  1F8A B;  2BA1 A;  2XP9 A;  2DK1 A;  2XP6 A;  2F21 A;  2M8J A;  2YSG A;  2JX8 A;  2JV4 A;  2MDI A;  2ZQT A;  1K9R A;  2KXQ A;  2XP8 A;  3TDB A;  2M8I A;  2ITK A;  2EZ5 W;  1PIN A;  2E45 A;  2LAJ A;  3LE4 A;  2DWV A;  1WR7 A;  4U86 A;  2JXW A;  3KAI A;  1O6W A;  1EG4 A;  2YSF A;  3KAF A;  3KAG A;  2YSI A;  3KAB A;  2YSH A;  3WH0 A;  2DJY A;  5CQ2 A;  1YW5 A;  2ZAJ A;  3KCE A;  1I5H W;  2YSB A;  3ODK A;  2ZR5 A;  4E5R A;  3NTP A;  3OOB A;  2Q5A A; 
#chains in the Genus database with same CATH topology
 3LKX A;  3FSB A;  2ZQU A;  3KAH A;  4QIB A;  4REX A;  2WAD A;  3FS8 A;  2XP3 A;  3FSC A;  4U84 A;  1WMV A;  1TK7 A;  1JMQ A;  3M7N A;  2ZQS A;  2M3O W;  2DK7 A;  1K9Q A;  2DMV A;  3TCZ A;  3MCB A;  2Y8N B;  2JMF A;  3KAD A;  1TR8 A;  2XP4 A;  2XPA A;  1NMV A;  2ZR6 A;  4A0T A;  1EG3 A;  4A0U A;  2ZR4 A;  2XP7 A;  2XPB A;  1ZCN A;  2L4J A;  4U85 A;  3M85 A;  2ZQV A;  3PQH A;  2RE3 A;  2XP5 A;  5AHT A;  1FLC A;  5U47 A;  3CNG A;  3TC5 A;  3L4H A;  1F8A B;  2BA1 A;  2XP9 A;  2DK1 A;  2XP6 A;  2F21 A;  2M8J A;  2YSG A;  2JX8 A;  3MQG A;  2JV4 A;  2MDI A;  2ZQT A;  3MQH A;  1K9R A;  5E66 A;  2KXQ A;  3LKX B;  5E65 A;  2XP8 A;  3TDB A;  2M8I A;  2ITK A;  2OWO A;  2EZ5 W;  1PIN A;  2E45 A;  2LAJ A;  3LE4 A;  2DWV A;  1WR7 A;  4U86 A;  2JXW A;  3KAI A;  1O6W A;  5E62 A;  1EG4 A;  2YSF A;  3KAF A;  3MCB B;  3KAG A;  2WAE A;  4GLX A;  2YSI A;  3KAB A;  2YAJ B;  1RP5 A;  2YSH A;  5E5W A;  3WH0 A;  2DJY A;  5CQ2 A;  2QRV A;  1YW5 A;  2ZAJ A;  3KCE A;  1I5H W;  2YSB A;  5E64 A;  3ODK A;  2ZR5 A;  4E5R A;  3NTP A;  3OOB A;  2Q5A A; 
#chains in the Genus database with same CATH homology
 3LKX A;  3FSB A;  2ZQU A;  3KAH A;  4QIB A;  4REX A;  2WAD A;  3FS8 A;  2XP3 A;  3FSC A;  4U84 A;  1WMV A;  1TK7 A;  1JMQ A;  3M7N A;  2ZQS A;  2M3O W;  2DK7 A;  1K9Q A;  2DMV A;  3TCZ A;  3MCB A;  2Y8N B;  2JMF A;  3KAD A;  1TR8 A;  2XP4 A;  2XPA A;  1NMV A;  2ZR6 A;  4A0T A;  1EG3 A;  4A0U A;  2ZR4 A;  2XP7 A;  2XPB A;  1ZCN A;  2L4J A;  4U85 A;  3M85 A;  2ZQV A;  3PQH A;  2RE3 A;  2XP5 A;  5AHT A;  1FLC A;  5U47 A;  3CNG A;  3TC5 A;  3L4H A;  1F8A B;  2BA1 A;  2XP9 A;  2DK1 A;  2XP6 A;  2F21 A;  2M8J A;  2YSG A;  2JX8 A;  3MQG A;  2JV4 A;  2MDI A;  2ZQT A;  3MQH A;  1K9R A;  5E66 A;  2KXQ A;  3LKX B;  5E65 A;  2XP8 A;  3TDB A;  2M8I A;  2ITK A;  2OWO A;  2EZ5 W;  1PIN A;  2E45 A;  2LAJ A;  3LE4 A;  2DWV A;  1WR7 A;  4U86 A;  2JXW A;  3KAI A;  1O6W A;  5E62 A;  1EG4 A;  2YSF A;  3KAF A;  3MCB B;  3KAG A;  2WAE A;  4GLX A;  2YSI A;  3KAB A;  2YAJ B;  1RP5 A;  2YSH A;  5E5W A;  3WH0 A;  2DJY A;  5CQ2 A;  2QRV A;  1YW5 A;  2ZAJ A;  3KCE A;  1I5H W;  2YSB A;  5E64 A;  3ODK A;  2ZR5 A;  4E5R A;  3NTP A;  3OOB A;  2Q5A A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...