3L4HA

Helical box domain and second ww domain of the human e3 ubiquitin-protein ligase hecw1
Total Genus 27
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
27
sequence length
109
structure length
109
Chain Sequence
LLLQSPAVKFITNPEFFTVLHANYSAYRVFTSSTCLKHMILKVRRDARNFERYQHNRDLVNFINMFADTRLELPRGWEIKTDQQGKSFFVDHNSRATTFIDPRIPLQNG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Protein binding
molecule keywords E3 ubiquitin-protein ligase HECW1
publication title The tandem helical box and second WW domains of human HECW1
rcsb
source organism Homo sapiens
total genus 27
structure length 109
sequence length 109
ec nomenclature ec 2.3.2.26: HECT-type E3 ubiquitin transferase.
pdb deposition date 2009-12-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF18436 HECW1_helix Helical box domain of E3 ubiquitin-protein ligase HECW1
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.20.70.10 Mainly Beta Single Sheet Ubiquitin Ligase Nedd4; Chain: W; Ubiquitin Ligase Nedd4; Chain: W; 3l4hA01
5CQ2A 2YSGA 3KADA 2ZR6A 4QIBA 4U84A 3WH0A 1EG4A 2XP8A 2M8JA 1K9QA 2DWVA 2ZR5A 2BA1A 3CNGA 2ZQVA 1ZCNA 3KCEA 2XP3A 2M8IA 2XP7A 2Q5AA 1TK7A 2RE3A 2YSHA 2ZAJA 1K9RA 2ITKA 3OOBA 5AHTA 1O6WA 3TC5A 1JMQA 4U86A 2ZR4A 2YSBA 2F21A 2DJYA 2MDIA 2ZQUA 4REXA 2JMFA 1YW5A 3TDBA 3KAIA 1NMVA 2XPBA 3TCZA 1PINA 2E45A 2JV4A 1EG3A 3KAHA 3M7NA 2ZQTA 3L4HA 2XP6A 2XPAA 1WMVA 2XP5A 2YSFA 3ODKA 1WR7A 2XP9A 4U85A 3NTPA 2XP4A 4E5RA 3M85A 2DMVA 1F8AB 2M3OW 2JXWA 2DK7A 2KXQA 2ZQSA 3LE4A 3KABA 3KAFA 2DK1A 3KAGA 1I5HW 2L4JA 2YSIA 2LAJA 2EZ5W 2JX8A
chains in the Genus database with same CATH superfamily
5CQ2A 2YAJB 1FLCA 2YSGA 3KADA 2ZR6A 4QIBA 4U84A 3WH0A 1EG4A 2XP8A 2M8JA 1K9QA 2DWVA 2ZR5A 2BA1A 3CNGA 2ZQVA 1ZCNA 2WADA 3KCEA 2XP3A 2M8IA 4A0UA 2XP7A 2Q5AA 1TK7A 2RE3A 2YSHA 2ZAJA 3MCBB 1K9RA 3FS8A 2ITKA 3OOBA 5U47A 1RP5A 4GLXA 2WAEA 5AHTA 1O6WA 5E65A 3TC5A 3MCBA 1JMQA 4U86A 2ZR4A 2YSBA 2F21A 2DJYA 2MDIA 2ZQUA 4REXA 2JMFA 1YW5A 3TDBA 3MQGA 3FSCA 2Y8NB 3LKXB 3PQHA 3KAIA 1NMVA 2XPBA 3LKXA 5E5WA 3TCZA 5E64A 1PINA 2E45A 3FSBA 2JV4A 1EG3A 3MQHA 2QRVA 3KAHA 3M7NA 2ZQTA 3L4HA 2XP6A 2XPAA 1WMVA 2XP5A 2YSFA 3ODKA 1WR7A 2XP9A 4U85A 3NTPA 2XP4A 4E5RA 3M85A 2DMVA 1F8AB 2M3OW 2JXWA 2DK7A 2KXQA 1TR8A 2ZQSA 3LE4A 3KABA 3KAFA 2DK1A 3KAGA 5E62A 2OWOA 1I5HW 2L4JA 2YSIA 2LAJA 4A0TA 2EZ5W 5E66A 2JX8A
chains in the Genus database with same CATH topology
5CQ2A 2YAJB 1FLCA 2YSGA 3KADA 2ZR6A 4QIBA 4U84A 3WH0A 1EG4A 2XP8A 2M8JA 1K9QA 2DWVA 2ZR5A 2BA1A 3CNGA 2ZQVA 1ZCNA 2WADA 3KCEA 2XP3A 2M8IA 4A0UA 2XP7A 2Q5AA 1TK7A 2RE3A 2YSHA 2ZAJA 3MCBB 1K9RA 3FS8A 2ITKA 3OOBA 5U47A 1RP5A 4GLXA 2WAEA 5AHTA 1O6WA 5E65A 3TC5A 3MCBA 1JMQA 4U86A 2ZR4A 2YSBA 2F21A 2DJYA 2MDIA 2ZQUA 4REXA 2JMFA 1YW5A 3TDBA 3MQGA 3FSCA 2Y8NB 3LKXB 3PQHA 3KAIA 1NMVA 2XPBA 3LKXA 5E5WA 3TCZA 5E64A 1PINA 2E45A 3FSBA 2JV4A 1EG3A 3MQHA 2QRVA 3KAHA 3M7NA 2ZQTA 3L4HA 2XP6A 2XPAA 1WMVA 2XP5A 2YSFA 3ODKA 1WR7A 2XP9A 4U85A 3NTPA 2XP4A 4E5RA 3M85A 2DMVA 1F8AB 2M3OW 2JXWA 2DK7A 2KXQA 1TR8A 2ZQSA 3LE4A 3KABA 3KAFA 2DK1A 3KAGA 5E62A 2OWOA 1I5HW 2L4JA 2YSIA 2LAJA 4A0TA 2EZ5W 5E66A 2JX8A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5CQ2 A;  2YSG A;  3KAD A;  2ZR6 A;  4QIB A;  4U84 A;  3WH0 A;  1EG4 A;  2XP8 A;  2M8J A;  1K9Q A;  2DWV A;  2ZR5 A;  2BA1 A;  3CNG A;  2ZQV A;  1ZCN A;  3KCE A;  2XP3 A;  2M8I A;  2XP7 A;  2Q5A A;  1TK7 A;  2RE3 A;  2YSH A;  2ZAJ A;  1K9R A;  2ITK A;  3OOB A;  5AHT A;  1O6W A;  3TC5 A;  1JMQ A;  4U86 A;  2ZR4 A;  2YSB A;  2F21 A;  2DJY A;  2MDI A;  2ZQU A;  4REX A;  2JMF A;  1YW5 A;  3TDB A;  3KAI A;  1NMV A;  2XPB A;  3TCZ A;  1PIN A;  2E45 A;  2JV4 A;  1EG3 A;  3KAH A;  3M7N A;  2ZQT A;  3L4H A;  2XP6 A;  2XPA A;  1WMV A;  2XP5 A;  2YSF A;  3ODK A;  1WR7 A;  2XP9 A;  4U85 A;  3NTP A;  2XP4 A;  4E5R A;  3M85 A;  2DMV A;  1F8A B;  2M3O W;  2JXW A;  2DK7 A;  2KXQ A;  2ZQS A;  3LE4 A;  3KAB A;  3KAF A;  2DK1 A;  3KAG A;  1I5H W;  2L4J A;  2YSI A;  2LAJ A;  2EZ5 W;  2JX8 A; 
#chains in the Genus database with same CATH topology
 5CQ2 A;  2YAJ B;  1FLC A;  2YSG A;  3KAD A;  2ZR6 A;  4QIB A;  4U84 A;  3WH0 A;  1EG4 A;  2XP8 A;  2M8J A;  1K9Q A;  2DWV A;  2ZR5 A;  2BA1 A;  3CNG A;  2ZQV A;  1ZCN A;  2WAD A;  3KCE A;  2XP3 A;  2M8I A;  4A0U A;  2XP7 A;  2Q5A A;  1TK7 A;  2RE3 A;  2YSH A;  2ZAJ A;  3MCB B;  1K9R A;  3FS8 A;  2ITK A;  3OOB A;  5U47 A;  1RP5 A;  4GLX A;  2WAE A;  5AHT A;  1O6W A;  5E65 A;  3TC5 A;  3MCB A;  1JMQ A;  4U86 A;  2ZR4 A;  2YSB A;  2F21 A;  2DJY A;  2MDI A;  2ZQU A;  4REX A;  2JMF A;  1YW5 A;  3TDB A;  3MQG A;  3FSC A;  2Y8N B;  3LKX B;  3PQH A;  3KAI A;  1NMV A;  2XPB A;  3LKX A;  5E5W A;  3TCZ A;  5E64 A;  1PIN A;  2E45 A;  3FSB A;  2JV4 A;  1EG3 A;  3MQH A;  2QRV A;  3KAH A;  3M7N A;  2ZQT A;  3L4H A;  2XP6 A;  2XPA A;  1WMV A;  2XP5 A;  2YSF A;  3ODK A;  1WR7 A;  2XP9 A;  4U85 A;  3NTP A;  2XP4 A;  4E5R A;  3M85 A;  2DMV A;  1F8A B;  2M3O W;  2JXW A;  2DK7 A;  2KXQ A;  1TR8 A;  2ZQS A;  3LE4 A;  3KAB A;  3KAF A;  2DK1 A;  3KAG A;  5E62 A;  2OWO A;  1I5H W;  2L4J A;  2YSI A;  2LAJ A;  4A0T A;  2EZ5 W;  5E66 A;  2JX8 A; 
#chains in the Genus database with same CATH homology
 5CQ2 A;  2YAJ B;  1FLC A;  2YSG A;  3KAD A;  2ZR6 A;  4QIB A;  4U84 A;  3WH0 A;  1EG4 A;  2XP8 A;  2M8J A;  1K9Q A;  2DWV A;  2ZR5 A;  2BA1 A;  3CNG A;  2ZQV A;  1ZCN A;  2WAD A;  3KCE A;  2XP3 A;  2M8I A;  4A0U A;  2XP7 A;  2Q5A A;  1TK7 A;  2RE3 A;  2YSH A;  2ZAJ A;  3MCB B;  1K9R A;  3FS8 A;  2ITK A;  3OOB A;  5U47 A;  1RP5 A;  4GLX A;  2WAE A;  5AHT A;  1O6W A;  5E65 A;  3TC5 A;  3MCB A;  1JMQ A;  4U86 A;  2ZR4 A;  2YSB A;  2F21 A;  2DJY A;  2MDI A;  2ZQU A;  4REX A;  2JMF A;  1YW5 A;  3TDB A;  3MQG A;  3FSC A;  2Y8N B;  3LKX B;  3PQH A;  3KAI A;  1NMV A;  2XPB A;  3LKX A;  5E5W A;  3TCZ A;  5E64 A;  1PIN A;  2E45 A;  3FSB A;  2JV4 A;  1EG3 A;  3MQH A;  2QRV A;  3KAH A;  3M7N A;  2ZQT A;  3L4H A;  2XP6 A;  2XPA A;  1WMV A;  2XP5 A;  2YSF A;  3ODK A;  1WR7 A;  2XP9 A;  4U85 A;  3NTP A;  2XP4 A;  4E5R A;  3M85 A;  2DMV A;  1F8A B;  2M3O W;  2JXW A;  2DK7 A;  2KXQ A;  1TR8 A;  2ZQS A;  3LE4 A;  3KAB A;  3KAF A;  2DK1 A;  3KAG A;  5E62 A;  2OWO A;  1I5H W;  2L4J A;  2YSI A;  2LAJ A;  4A0T A;  2EZ5 W;  5E66 A;  2JX8 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...