3L4HA

Helical box domain and second ww domain of the human e3 ubiquitin-protein ligase hecw1
Total Genus 27
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
27
sequence length
109
structure length
109
Chain Sequence
LLLQSPAVKFITNPEFFTVLHANYSAYRVFTSSTCLKHMILKVRRDARNFERYQHNRDLVNFINMFADTRLELPRGWEIKTDQQGKSFFVDHNSRATTFIDPRIPLQNG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords E3 ubiquitin-protein ligase HECW1
publication title The tandem helical box and second WW domains of human HECW1
rcsb
source organism Homo sapiens
molecule tags Protein binding
total genus 27
structure length 109
sequence length 109
ec nomenclature ec 2.3.2.26: HECT-type E3 ubiquitin transferase.
pdb deposition date 2009-12-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF18436 HECW1_helix Helical box domain of E3 ubiquitin-protein ligase HECW1
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.20.70.10 Mainly Beta Single Sheet Ubiquitin Ligase Nedd4; Chain: W; Ubiquitin Ligase Nedd4; Chain: W; 3l4hA01
3KAFA 2ITKA 2XP6A 1ZCNA 1TK7A 3TDBA 2ZQVA 3TC5A 2KXQA 2DMVA 4QIBA 3ODKA 1WMVA 2XPAA 4U84A 2XP3A 2XP5A 2XPBA 2ZAJA 1EG4A 3KAHA 2JV4A 2XP7A 3M85A 3KAGA 1JMQA 2Q5AA 2DJYA 2ZR5A 2BA1A 3NTPA 3KABA 1EG3A 2YSIA 2JX8A 1K9RA 1F8AB 2M8IA 2XP4A 2ZQSA 2DWVA 1WR7A 4U86A 4U85A 3WH0A 2F21A 1I5HW 3CNGA 3KADA 5CQ2A 4REXA 2XP9A 3TCZA 3M7NA 2ZR6A 1PINA 2L4JA 4E5RA 1O6WA 1NMVA 2MDIA 3L4HA 2ZR4A 2DK1A 2RE3A 2E45A 2YSBA 2YSGA 2JMFA 2M8JA 2JXWA 2DK7A 2M3OW 2EZ5W 3OOBA 2ZQTA 2XP8A 1YW5A 2ZQUA 3LE4A 1K9QA 2YSHA 3KAIA 5AHTA 2YSFA 2LAJA 3KCEA
chains in the Genus database with same CATH superfamily
4A0TA 3KAFA 2ITKA 2XP6A 1ZCNA 1TK7A 3LKXA 3TDBA 3MCBB 2ZQVA 3TC5A 2KXQA 2DMVA 4QIBA 3ODKA 1WMVA 2XPAA 5E65A 4U84A 2XP3A 2XP5A 2XPBA 2ZAJA 2QRVA 1EG4A 3KAHA 2JV4A 2XP7A 3M85A 3KAGA 1JMQA 2Q5AA 2DJYA 2ZR5A 5E62A 2WADA 2BA1A 3NTPA 2YAJB 3KABA 1EG3A 2YSIA 2JX8A 1K9RA 1F8AB 2M8IA 2XP4A 2ZQSA 2DWVA 1WR7A 3FSCA 4U86A 4U85A 3WH0A 3PQHA 2F21A 2Y8NB 1I5HW 3CNGA 3KADA 5CQ2A 3MQHA 2OWOA 4REXA 2XP9A 3TCZA 3M7NA 2ZR6A 3LKXB 1TR8A 1PINA 2L4JA 4E5RA 1O6WA 1NMVA 5E5WA 3FS8A 2MDIA 3L4HA 2ZR4A 2WAEA 2DK1A 4GLXA 3FSBA 2RE3A 2E45A 3MCBA 2YSBA 2YSGA 2JMFA 2M8JA 2JXWA 2DK7A 2M3OW 2EZ5W 3OOBA 2ZQTA 2XP8A 5U47A 4A0UA 1YW5A 2ZQUA 3LE4A 1K9QA 1FLCA 2YSHA 5E66A 3KAIA 5AHTA 2YSFA 3MQGA 1RP5A 2LAJA 3KCEA 5E64A
chains in the Genus database with same CATH topology
4A0TA 3KAFA 2ITKA 2XP6A 1ZCNA 1TK7A 3LKXA 3TDBA 3MCBB 2ZQVA 3TC5A 2KXQA 2DMVA 4QIBA 3ODKA 1WMVA 2XPAA 5E65A 4U84A 2XP3A 2XP5A 2XPBA 2ZAJA 2QRVA 1EG4A 3KAHA 2JV4A 2XP7A 3M85A 3KAGA 1JMQA 2Q5AA 2DJYA 2ZR5A 5E62A 2WADA 2BA1A 3NTPA 2YAJB 3KABA 1EG3A 2YSIA 2JX8A 1K9RA 1F8AB 2M8IA 2XP4A 2ZQSA 2DWVA 1WR7A 3FSCA 4U86A 4U85A 3WH0A 3PQHA 2F21A 2Y8NB 1I5HW 3CNGA 3KADA 5CQ2A 3MQHA 2OWOA 4REXA 2XP9A 3TCZA 3M7NA 2ZR6A 3LKXB 1TR8A 1PINA 2L4JA 4E5RA 1O6WA 1NMVA 5E5WA 3FS8A 2MDIA 3L4HA 2ZR4A 2WAEA 2DK1A 4GLXA 3FSBA 2RE3A 2E45A 3MCBA 2YSBA 2YSGA 2JMFA 2M8JA 2JXWA 2DK7A 2M3OW 2EZ5W 3OOBA 2ZQTA 2XP8A 5U47A 4A0UA 1YW5A 2ZQUA 3LE4A 1K9QA 1FLCA 2YSHA 5E66A 3KAIA 5AHTA 2YSFA 3MQGA 1RP5A 2LAJA 3KCEA 5E64A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3KAF A;  2ITK A;  2XP6 A;  1ZCN A;  1TK7 A;  3TDB A;  2ZQV A;  3TC5 A;  2KXQ A;  2DMV A;  4QIB A;  3ODK A;  1WMV A;  2XPA A;  4U84 A;  2XP3 A;  2XP5 A;  2XPB A;  2ZAJ A;  1EG4 A;  3KAH A;  2JV4 A;  2XP7 A;  3M85 A;  3KAG A;  1JMQ A;  2Q5A A;  2DJY A;  2ZR5 A;  2BA1 A;  3NTP A;  3KAB A;  1EG3 A;  2YSI A;  2JX8 A;  1K9R A;  1F8A B;  2M8I A;  2XP4 A;  2ZQS A;  2DWV A;  1WR7 A;  4U86 A;  4U85 A;  3WH0 A;  2F21 A;  1I5H W;  3CNG A;  3KAD A;  5CQ2 A;  4REX A;  2XP9 A;  3TCZ A;  3M7N A;  2ZR6 A;  1PIN A;  2L4J A;  4E5R A;  1O6W A;  1NMV A;  2MDI A;  3L4H A;  2ZR4 A;  2DK1 A;  2RE3 A;  2E45 A;  2YSB A;  2YSG A;  2JMF A;  2M8J A;  2JXW A;  2DK7 A;  2M3O W;  2EZ5 W;  3OOB A;  2ZQT A;  2XP8 A;  1YW5 A;  2ZQU A;  3LE4 A;  1K9Q A;  2YSH A;  3KAI A;  5AHT A;  2YSF A;  2LAJ A;  3KCE A; 
#chains in the Genus database with same CATH topology
 4A0T A;  3KAF A;  2ITK A;  2XP6 A;  1ZCN A;  1TK7 A;  3LKX A;  3TDB A;  3MCB B;  2ZQV A;  3TC5 A;  2KXQ A;  2DMV A;  4QIB A;  3ODK A;  1WMV A;  2XPA A;  5E65 A;  4U84 A;  2XP3 A;  2XP5 A;  2XPB A;  2ZAJ A;  2QRV A;  1EG4 A;  3KAH A;  2JV4 A;  2XP7 A;  3M85 A;  3KAG A;  1JMQ A;  2Q5A A;  2DJY A;  2ZR5 A;  5E62 A;  2WAD A;  2BA1 A;  3NTP A;  2YAJ B;  3KAB A;  1EG3 A;  2YSI A;  2JX8 A;  1K9R A;  1F8A B;  2M8I A;  2XP4 A;  2ZQS A;  2DWV A;  1WR7 A;  3FSC A;  4U86 A;  4U85 A;  3WH0 A;  3PQH A;  2F21 A;  2Y8N B;  1I5H W;  3CNG A;  3KAD A;  5CQ2 A;  3MQH A;  2OWO A;  4REX A;  2XP9 A;  3TCZ A;  3M7N A;  2ZR6 A;  3LKX B;  1TR8 A;  1PIN A;  2L4J A;  4E5R A;  1O6W A;  1NMV A;  5E5W A;  3FS8 A;  2MDI A;  3L4H A;  2ZR4 A;  2WAE A;  2DK1 A;  4GLX A;  3FSB A;  2RE3 A;  2E45 A;  3MCB A;  2YSB A;  2YSG A;  2JMF A;  2M8J A;  2JXW A;  2DK7 A;  2M3O W;  2EZ5 W;  3OOB A;  2ZQT A;  2XP8 A;  5U47 A;  4A0U A;  1YW5 A;  2ZQU A;  3LE4 A;  1K9Q A;  1FLC A;  2YSH A;  5E66 A;  3KAI A;  5AHT A;  2YSF A;  3MQG A;  1RP5 A;  2LAJ A;  3KCE A;  5E64 A; 
#chains in the Genus database with same CATH homology
 4A0T A;  3KAF A;  2ITK A;  2XP6 A;  1ZCN A;  1TK7 A;  3LKX A;  3TDB A;  3MCB B;  2ZQV A;  3TC5 A;  2KXQ A;  2DMV A;  4QIB A;  3ODK A;  1WMV A;  2XPA A;  5E65 A;  4U84 A;  2XP3 A;  2XP5 A;  2XPB A;  2ZAJ A;  2QRV A;  1EG4 A;  3KAH A;  2JV4 A;  2XP7 A;  3M85 A;  3KAG A;  1JMQ A;  2Q5A A;  2DJY A;  2ZR5 A;  5E62 A;  2WAD A;  2BA1 A;  3NTP A;  2YAJ B;  3KAB A;  1EG3 A;  2YSI A;  2JX8 A;  1K9R A;  1F8A B;  2M8I A;  2XP4 A;  2ZQS A;  2DWV A;  1WR7 A;  3FSC A;  4U86 A;  4U85 A;  3WH0 A;  3PQH A;  2F21 A;  2Y8N B;  1I5H W;  3CNG A;  3KAD A;  5CQ2 A;  3MQH A;  2OWO A;  4REX A;  2XP9 A;  3TCZ A;  3M7N A;  2ZR6 A;  3LKX B;  1TR8 A;  1PIN A;  2L4J A;  4E5R A;  1O6W A;  1NMV A;  5E5W A;  3FS8 A;  2MDI A;  3L4H A;  2ZR4 A;  2WAE A;  2DK1 A;  4GLX A;  3FSB A;  2RE3 A;  2E45 A;  3MCB A;  2YSB A;  2YSG A;  2JMF A;  2M8J A;  2JXW A;  2DK7 A;  2M3O W;  2EZ5 W;  3OOB A;  2ZQT A;  2XP8 A;  5U47 A;  4A0U A;  1YW5 A;  2ZQU A;  3LE4 A;  1K9Q A;  1FLC A;  2YSH A;  5E66 A;  3KAI A;  5AHT A;  2YSF A;  3MQG A;  1RP5 A;  2LAJ A;  3KCE A;  5E64 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...