The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.
Total Genus |
27
|
sequence length |
109
|
structure length |
109
|
Chain Sequence |
LLLQSPAVKFITNPEFFTVLHANYSAYRVFTSSTCLKHMILKVRRDARNFERYQHNRDLVNFINMFADTRLELPRGWEIKTDQQGKSFFVDHNSRATTFIDPRIPLQNG
|
The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.
After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.
molecule keywords |
E3 ubiquitin-protein ligase HECW1
|
publication title |
The tandem helical box and second WW domains of human HECW1
rcsb |
source organism |
Homo sapiens
|
molecule tags |
Protein binding
|
total genus |
27
|
structure length |
109
|
sequence length |
109
|
ec nomenclature |
ec
2.3.2.26: HECT-type E3 ubiquitin transferase. |
pdb deposition date | 2009-12-20 |
chain | Pfam Accession Code | Pfam Family Identifier | Pfam Description |
---|---|---|---|
A | PF18436 | HECW1_helix | Helical box domain of E3 ubiquitin-protein ligase HECW1 |
cath code
| Class | Architecture | Topology | Homology | Domain |
---|---|---|---|---|---|
Mainly Beta | Single Sheet | Ubiquitin Ligase Nedd4; Chain: W; | Ubiquitin Ligase Nedd4; Chain: W; |
#chains in the Genus database with same CATH superfamily 3KAF A; 2ITK A; 2XP6 A; 1ZCN A; 1TK7 A; 3TDB A; 2ZQV A; 3TC5 A; 2KXQ A; 2DMV A; 4QIB A; 3ODK A; 1WMV A; 2XPA A; 4U84 A; 2XP3 A; 2XP5 A; 2XPB A; 2ZAJ A; 1EG4 A; 3KAH A; 2JV4 A; 2XP7 A; 3M85 A; 3KAG A; 1JMQ A; 2Q5A A; 2DJY A; 2ZR5 A; 2BA1 A; 3NTP A; 3KAB A; 1EG3 A; 2YSI A; 2JX8 A; 1K9R A; 1F8A B; 2M8I A; 2XP4 A; 2ZQS A; 2DWV A; 1WR7 A; 4U86 A; 4U85 A; 3WH0 A; 2F21 A; 1I5H W; 3CNG A; 3KAD A; 5CQ2 A; 4REX A; 2XP9 A; 3TCZ A; 3M7N A; 2ZR6 A; 1PIN A; 2L4J A; 4E5R A; 1O6W A; 1NMV A; 2MDI A; 3L4H A; 2ZR4 A; 2DK1 A; 2RE3 A; 2E45 A; 2YSB A; 2YSG A; 2JMF A; 2M8J A; 2JXW A; 2DK7 A; 2M3O W; 2EZ5 W; 3OOB A; 2ZQT A; 2XP8 A; 1YW5 A; 2ZQU A; 3LE4 A; 1K9Q A; 2YSH A; 3KAI A; 5AHT A; 2YSF A; 2LAJ A; 3KCE A; #chains in the Genus database with same CATH topology 4A0T A; 3KAF A; 2ITK A; 2XP6 A; 1ZCN A; 1TK7 A; 3LKX A; 3TDB A; 3MCB B; 2ZQV A; 3TC5 A; 2KXQ A; 2DMV A; 4QIB A; 3ODK A; 1WMV A; 2XPA A; 5E65 A; 4U84 A; 2XP3 A; 2XP5 A; 2XPB A; 2ZAJ A; 2QRV A; 1EG4 A; 3KAH A; 2JV4 A; 2XP7 A; 3M85 A; 3KAG A; 1JMQ A; 2Q5A A; 2DJY A; 2ZR5 A; 5E62 A; 2WAD A; 2BA1 A; 3NTP A; 2YAJ B; 3KAB A; 1EG3 A; 2YSI A; 2JX8 A; 1K9R A; 1F8A B; 2M8I A; 2XP4 A; 2ZQS A; 2DWV A; 1WR7 A; 3FSC A; 4U86 A; 4U85 A; 3WH0 A; 3PQH A; 2F21 A; 2Y8N B; 1I5H W; 3CNG A; 3KAD A; 5CQ2 A; 3MQH A; 2OWO A; 4REX A; 2XP9 A; 3TCZ A; 3M7N A; 2ZR6 A; 3LKX B; 1TR8 A; 1PIN A; 2L4J A; 4E5R A; 1O6W A; 1NMV A; 5E5W A; 3FS8 A; 2MDI A; 3L4H A; 2ZR4 A; 2WAE A; 2DK1 A; 4GLX A; 3FSB A; 2RE3 A; 2E45 A; 3MCB A; 2YSB A; 2YSG A; 2JMF A; 2M8J A; 2JXW A; 2DK7 A; 2M3O W; 2EZ5 W; 3OOB A; 2ZQT A; 2XP8 A; 5U47 A; 4A0U A; 1YW5 A; 2ZQU A; 3LE4 A; 1K9Q A; 1FLC A; 2YSH A; 5E66 A; 3KAI A; 5AHT A; 2YSF A; 3MQG A; 1RP5 A; 2LAJ A; 3KCE A; 5E64 A; #chains in the Genus database with same CATH homology 4A0T A; 3KAF A; 2ITK A; 2XP6 A; 1ZCN A; 1TK7 A; 3LKX A; 3TDB A; 3MCB B; 2ZQV A; 3TC5 A; 2KXQ A; 2DMV A; 4QIB A; 3ODK A; 1WMV A; 2XPA A; 5E65 A; 4U84 A; 2XP3 A; 2XP5 A; 2XPB A; 2ZAJ A; 2QRV A; 1EG4 A; 3KAH A; 2JV4 A; 2XP7 A; 3M85 A; 3KAG A; 1JMQ A; 2Q5A A; 2DJY A; 2ZR5 A; 5E62 A; 2WAD A; 2BA1 A; 3NTP A; 2YAJ B; 3KAB A; 1EG3 A; 2YSI A; 2JX8 A; 1K9R A; 1F8A B; 2M8I A; 2XP4 A; 2ZQS A; 2DWV A; 1WR7 A; 3FSC A; 4U86 A; 4U85 A; 3WH0 A; 3PQH A; 2F21 A; 2Y8N B; 1I5H W; 3CNG A; 3KAD A; 5CQ2 A; 3MQH A; 2OWO A; 4REX A; 2XP9 A; 3TCZ A; 3M7N A; 2ZR6 A; 3LKX B; 1TR8 A; 1PIN A; 2L4J A; 4E5R A; 1O6W A; 1NMV A; 5E5W A; 3FS8 A; 2MDI A; 3L4H A; 2ZR4 A; 2WAE A; 2DK1 A; 4GLX A; 3FSB A; 2RE3 A; 2E45 A; 3MCB A; 2YSB A; 2YSG A; 2JMF A; 2M8J A; 2JXW A; 2DK7 A; 2M3O W; 2EZ5 W; 3OOB A; 2ZQT A; 2XP8 A; 5U47 A; 4A0U A; 1YW5 A; 2ZQU A; 3LE4 A; 1K9Q A; 1FLC A; 2YSH A; 5E66 A; 3KAI A; 5AHT A; 2YSF A; 3MQG A; 1RP5 A; 2LAJ A; 3KCE A; 5E64 A;
#similar chains in the Genus database (?% sequence similarity) ...loading similar chains, please wait... #similar chains, but unknotted ...loading similar chains, please wait... #similar chains in the pdb database (?% sequence similarity) ...loading similar chains, please wait...