4A0UA

Structure of the carboxy-terminal domain of bacteriophage t7 fibre gp17 containing residues 371-553, c2221 crystal form.
Total Genus 43
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
43
sequence length
183
structure length
183
Chain Sequence
GHVLQLESASDKAHYILSKDGNRNNWYIGRGSDNNNDCTFHSYVHGTTLTLKQDYAVVNKHFHVGQAVVATDGNIQGTKWGGKWLDAYLRDSFVAKSKAWTQVWSGSAGGGVSVTVSQDLRFRNIWIKCANNSWNFFRTGPDGIYFIASDGGWLRFQIHSNGLGFKNIADSRSVPNAIMVENE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords TAIL FIBER PROTEIN
publication title Structure of the receptor-binding carboxy-terminal domain of bacteriophage T7 tail fibers.
pubmed doi rcsb
source organism Enterobacteria phage t7
molecule tags Viral protein
total genus 43
structure length 183
sequence length 183
chains with identical sequence B, C
ec nomenclature
pdb deposition date 2011-09-12
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.20.70.120 Mainly Beta Single Sheet Ubiquitin Ligase Nedd4; Chain: W; Ubiquitin Ligase Nedd4; Chain: W; 4a0uA02
2.20.220.30 Mainly Beta Single Sheet Glycosyl hydrolase fold Glycosyl hydrolase fold 4a0uA01
2.60.320.30 Mainly Beta Sandwich mini-chromosome maintenance (MCM) complex, domain 2 mini-chromosome maintenance (MCM) complex, domain 2 4a0uA03
4A0UA 4A0TA
chains in the Genus database with same CATH superfamily
2DK7A 5AHTA 2YAJB 2YSIA 1TR8A 3KAFA 2XP4A 1FLCA 2JV4A 1EG4A 2RE3A 3FSCA 5CQ2A 3CNGA 2MDIA 2DJYA 2BA1A 2YSGA 3KAIA 3KAGA 1NMVA 4QIBA 3MQGA 3M7NA 2E45A 3KCEA 4GLXA 2GDVA 2JMFA 4REXA 2WADA 5E5WA 2L4JA 3ODKA 4A0UA 2WAEA 3LKXB 2EZ5W 3LD7A 2XP8A 2ZR4A 1I5HW 2XP6A 3PQHA 3L4HA 3TCZA 3KADA 3LKXA 1M1HA 1YW5A 5C8BB 2Y8NB 3KAHA 5U47A 3M85A 2OWOA 4U86A 1NPPA 1O6WA 1TK7A 2XP5A 2JX8A 3MCBB 2ZR5A 4A0TA 2JXWA 5E65A 1EG3A 2XP9A 3KABA 2YQ2A 2QRVA 2Q5AA 2LAJA 2ZQTA 3MCBA 1K9QA 4OBIA 1F8AB 3MQHA 3LE4A 1RP5A 2DWVA 1R7AA 5E62A 5E66A 2XP3A 2M8JA 2DK1A 4U85A 2GDUA 2YSBA 1WMVA 3FSBA 2ITKA 2M3OW 3WH0A 1JMQA 3WITA 2DMVA 1NPRA 2F21A 3TC5A 2ZQSA 3NTPA 3TDBA 2XP7A 1K9RA 2YSHA 1M1GA 2ZR6A 5E64A 4E5RA 4ESNA 2ZQUA 2ZAJA 1ZCNA 2ZQVA 3OOBA 2M8IA 4U84A 2KXQA 2KPPA 1WR7A 3FS8A 1PINA 2XPAA 2XPBA 2YSFA
chains in the Genus database with same CATH topology
2DK7A 5AHTA 2YAJB 2YSIA 1TR8A 3KAFA 2XP4A 1FLCA 2JV4A 1EG4A 2RE3A 3FSCA 5CQ2A 3CNGA 2MDIA 2DJYA 2BA1A 2YSGA 3KAIA 3KAGA 1NMVA 4QIBA 3MQGA 3M7NA 2E45A 3KCEA 4GLXA 2JMFA 4REXA 2WADA 5E5WA 2L4JA 3ODKA 4A0UA 2WAEA 3LKXB 2EZ5W 2XP8A 2ZR4A 1I5HW 2XP6A 3PQHA 3L4HA 3TCZA 3KADA 3LKXA 1YW5A 2Y8NB 3KAHA 5U47A 3M85A 2OWOA 4U86A 1O6WA 1TK7A 2XP5A 2JX8A 3MCBB 2ZR5A 4A0TA 2JXWA 5E65A 1EG3A 2XP9A 3KABA 2YQ2A 2QRVA 2Q5AA 2LAJA 2ZQTA 3MCBA 1K9QA 1F8AB 3MQHA 3LE4A 1RP5A 2DWVA 5E62A 5E66A 2XP3A 2M8JA 2DK1A 4U85A 2YSBA 1WMVA 3FSBA 2ITKA 2M3OW 3WH0A 1JMQA 3WITA 2DMVA 2F21A 3TC5A 2ZQSA 3NTPA 3TDBA 2XP7A 1K9RA 2YSHA 2ZR6A 5E64A 4E5RA 2ZQUA 2ZAJA 1ZCNA 2ZQVA 3OOBA 2M8IA 4U84A 2KXQA 1WR7A 3FS8A 1PINA 2XPAA 2XPBA 2YSFA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4A0U A;  4A0T A; 
#chains in the Genus database with same CATH topology
 2DK7 A;  5AHT A;  2YAJ B;  2YSI A;  1TR8 A;  3KAF A;  2XP4 A;  1FLC A;  2JV4 A;  1EG4 A;  2RE3 A;  3FSC A;  5CQ2 A;  3CNG A;  2MDI A;  2DJY A;  2BA1 A;  2YSG A;  3KAI A;  3KAG A;  1NMV A;  4QIB A;  3MQG A;  3M7N A;  2E45 A;  3KCE A;  4GLX A;  2GDV A;  2JMF A;  4REX A;  2WAD A;  5E5W A;  2L4J A;  3ODK A;  4A0U A;  2WAE A;  3LKX B;  2EZ5 W;  3LD7 A;  2XP8 A;  2ZR4 A;  1I5H W;  2XP6 A;  3PQH A;  3L4H A;  3TCZ A;  3KAD A;  3LKX A;  1M1H A;  1YW5 A;  5C8B B;  2Y8N B;  3KAH A;  5U47 A;  3M85 A;  2OWO A;  4U86 A;  1NPP A;  1O6W A;  1TK7 A;  2XP5 A;  2JX8 A;  3MCB B;  2ZR5 A;  4A0T A;  2JXW A;  5E65 A;  1EG3 A;  2XP9 A;  3KAB A;  2YQ2 A;  2QRV A;  2Q5A A;  2LAJ A;  2ZQT A;  3MCB A;  1K9Q A;  4OBI A;  1F8A B;  3MQH A;  3LE4 A;  1RP5 A;  2DWV A;  1R7A A;  5E62 A;  5E66 A;  2XP3 A;  2M8J A;  2DK1 A;  4U85 A;  2GDU A;  2YSB A;  1WMV A;  3FSB A;  2ITK A;  2M3O W;  3WH0 A;  1JMQ A;  3WIT A;  2DMV A;  1NPR A;  2F21 A;  3TC5 A;  2ZQS A;  3NTP A;  3TDB A;  2XP7 A;  1K9R A;  2YSH A;  1M1G A;  2ZR6 A;  5E64 A;  4E5R A;  4ESN A;  2ZQU A;  2ZAJ A;  1ZCN A;  2ZQV A;  3OOB A;  2M8I A;  4U84 A;  2KXQ A;  2KPP A;  1WR7 A;  3FS8 A;  1PIN A;  2XPA A;  2XPB A;  2YSF A; 
#chains in the Genus database with same CATH homology
 2DK7 A;  5AHT A;  2YAJ B;  2YSI A;  1TR8 A;  3KAF A;  2XP4 A;  1FLC A;  2JV4 A;  1EG4 A;  2RE3 A;  3FSC A;  5CQ2 A;  3CNG A;  2MDI A;  2DJY A;  2BA1 A;  2YSG A;  3KAI A;  3KAG A;  1NMV A;  4QIB A;  3MQG A;  3M7N A;  2E45 A;  3KCE A;  4GLX A;  2JMF A;  4REX A;  2WAD A;  5E5W A;  2L4J A;  3ODK A;  4A0U A;  2WAE A;  3LKX B;  2EZ5 W;  2XP8 A;  2ZR4 A;  1I5H W;  2XP6 A;  3PQH A;  3L4H A;  3TCZ A;  3KAD A;  3LKX A;  1YW5 A;  2Y8N B;  3KAH A;  5U47 A;  3M85 A;  2OWO A;  4U86 A;  1O6W A;  1TK7 A;  2XP5 A;  2JX8 A;  3MCB B;  2ZR5 A;  4A0T A;  2JXW A;  5E65 A;  1EG3 A;  2XP9 A;  3KAB A;  2YQ2 A;  2QRV A;  2Q5A A;  2LAJ A;  2ZQT A;  3MCB A;  1K9Q A;  1F8A B;  3MQH A;  3LE4 A;  1RP5 A;  2DWV A;  5E62 A;  5E66 A;  2XP3 A;  2M8J A;  2DK1 A;  4U85 A;  2YSB A;  1WMV A;  3FSB A;  2ITK A;  2M3O W;  3WH0 A;  1JMQ A;  3WIT A;  2DMV A;  2F21 A;  3TC5 A;  2ZQS A;  3NTP A;  3TDB A;  2XP7 A;  1K9R A;  2YSH A;  2ZR6 A;  5E64 A;  4E5R A;  2ZQU A;  2ZAJ A;  1ZCN A;  2ZQV A;  3OOB A;  2M8I A;  4U84 A;  2KXQ A;  1WR7 A;  3FS8 A;  1PIN A;  2XPA A;  2XPB A;  2YSF A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...