4A0UA

Structure of the carboxy-terminal domain of bacteriophage t7 fibre gp17 containing residues 371-553, c2221 crystal form.
Total Genus 43
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
43
sequence length
183
structure length
183
Chain Sequence
GHVLQLESASDKAHYILSKDGNRNNWYIGRGSDNNNDCTFHSYVHGTTLTLKQDYAVVNKHFHVGQAVVATDGNIQGTKWGGKWLDAYLRDSFVAKSKAWTQVWSGSAGGGVSVTVSQDLRFRNIWIKCANNSWNFFRTGPDGIYFIASDGGWLRFQIHSNGLGFKNIADSRSVPNAIMVENE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Viral protein
molecule keywords TAIL FIBER PROTEIN
publication title Structure of the receptor-binding carboxy-terminal domain of bacteriophage T7 tail fibers.
pubmed doi rcsb
source organism Enterobacteria phage t7
total genus 43
structure length 183
sequence length 183
chains with identical sequence B, C
ec nomenclature
pdb deposition date 2011-09-12
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.20.70.120 Mainly Beta Single Sheet Ubiquitin Ligase Nedd4; Chain: W; Ubiquitin Ligase Nedd4; Chain: W; 4a0uA02
2.20.220.30 Mainly Beta Single Sheet Glycosyl hydrolase fold Glycosyl hydrolase fold 4a0uA01
2.60.320.30 Mainly Beta Sandwich mini-chromosome maintenance (MCM) complex, domain 2 mini-chromosome maintenance (MCM) complex, domain 2 4a0uA03
4A0TA 4A0UA
chains in the Genus database with same CATH superfamily
1RP5A 3ODKA 5E64A 2KPPA 5E5WA 5E66A 2M8IA 4E5RA 4U84A 2ZQVA 3MCBB 5AHTA 5E65A 3LKXA 2ZQUA 3KAFA 2E45A 2ZR6A 2BA1A 3KCEA 4A0TA 1F8AB 2DJYA 3TDBA 2XP6A 2ZQTA 1M1HA 3MQGA 4A0UA 3TC5A 2DK1A 4REXA 1M1GA 3FSCA 3KAGA 3M85A 2MDIA 1NPRA 2ITKA 3L4HA 1O6WA 2DWVA 3MQHA 2M8JA 1EG3A 3KABA 2DK7A 2RE3A 2YQ2A 2DMVA 2ZR5A 1NPPA 3LD7A 3LE4A 2Q5AA 2Y8NB 5C8BB 2YSGA 2YSFA 2JMFA 2ZAJA 2OWOA 2XP3A 1WR7A 1TK7A 2EZ5W 2YSHA 2XP9A 3LKXB 5U47A 1K9RA 3MCBA 2YSIA 2KXQA 3WITA 1ZCNA 2GDUA 1R7AA 4OBIA 2XP4A 5E62A 2JX8A 4QIBA 2M3OW 3M7NA 1K9QA 2ZQSA 3KAHA 3PQHA 2XP8A 2ZR4A 2JXWA 1TR8A 4ESNA 5CQ2A 1I5HW 2XP5A 1NMVA 3KADA 3OOBA 4GLXA 2JV4A 2XPAA 1WMVA 3CNGA 1YW5A 1EG4A 1JMQA 1FLCA 4U86A 3WH0A 2GDVA 3KAIA 3TCZA 2F21A 2L4JA 2WAEA 1PINA 2QRVA 2LAJA 2XPBA 3FSBA 3NTPA 2XP7A 2WADA 4U85A 3FS8A 2YSBA 2YAJB
chains in the Genus database with same CATH topology
1RP5A 3ODKA 5E64A 5E5WA 5E66A 2M8IA 4E5RA 4U84A 2ZQVA 3MCBB 5AHTA 5E65A 3LKXA 2ZQUA 3KAFA 2E45A 2ZR6A 2BA1A 3KCEA 4A0TA 1F8AB 2DJYA 3TDBA 2XP6A 2ZQTA 3MQGA 4A0UA 3TC5A 2DK1A 4REXA 3FSCA 3KAGA 3M85A 2MDIA 2ITKA 3L4HA 1O6WA 2DWVA 3MQHA 2M8JA 1EG3A 3KABA 2DK7A 2RE3A 2YQ2A 2DMVA 2ZR5A 3LE4A 2Q5AA 2Y8NB 2YSGA 2YSFA 2JMFA 2ZAJA 2OWOA 2XP3A 1WR7A 1TK7A 2EZ5W 2YSHA 2XP9A 3LKXB 5U47A 1K9RA 3MCBA 2YSIA 2KXQA 3WITA 1ZCNA 2XP4A 5E62A 2JX8A 4QIBA 2M3OW 3M7NA 1K9QA 2ZQSA 3KAHA 3PQHA 2XP8A 2ZR4A 2JXWA 1TR8A 5CQ2A 1I5HW 2XP5A 1NMVA 3KADA 3OOBA 4GLXA 2JV4A 2XPAA 1WMVA 3CNGA 1YW5A 1EG4A 1JMQA 1FLCA 4U86A 3WH0A 3KAIA 3TCZA 2F21A 2L4JA 2WAEA 1PINA 2QRVA 2LAJA 2XPBA 3FSBA 3NTPA 2XP7A 2WADA 4U85A 3FS8A 2YSBA 2YAJB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4A0T A;  4A0U A; 
#chains in the Genus database with same CATH topology
 1RP5 A;  3ODK A;  5E64 A;  2KPP A;  5E5W A;  5E66 A;  2M8I A;  4E5R A;  4U84 A;  2ZQV A;  3MCB B;  5AHT A;  5E65 A;  3LKX A;  2ZQU A;  3KAF A;  2E45 A;  2ZR6 A;  2BA1 A;  3KCE A;  4A0T A;  1F8A B;  2DJY A;  3TDB A;  2XP6 A;  2ZQT A;  1M1H A;  3MQG A;  4A0U A;  3TC5 A;  2DK1 A;  4REX A;  1M1G A;  3FSC A;  3KAG A;  3M85 A;  2MDI A;  1NPR A;  2ITK A;  3L4H A;  1O6W A;  2DWV A;  3MQH A;  2M8J A;  1EG3 A;  3KAB A;  2DK7 A;  2RE3 A;  2YQ2 A;  2DMV A;  2ZR5 A;  1NPP A;  3LD7 A;  3LE4 A;  2Q5A A;  2Y8N B;  5C8B B;  2YSG A;  2YSF A;  2JMF A;  2ZAJ A;  2OWO A;  2XP3 A;  1WR7 A;  1TK7 A;  2EZ5 W;  2YSH A;  2XP9 A;  3LKX B;  5U47 A;  1K9R A;  3MCB A;  2YSI A;  2KXQ A;  3WIT A;  1ZCN A;  2GDU A;  1R7A A;  4OBI A;  2XP4 A;  5E62 A;  2JX8 A;  4QIB A;  2M3O W;  3M7N A;  1K9Q A;  2ZQS A;  3KAH A;  3PQH A;  2XP8 A;  2ZR4 A;  2JXW A;  1TR8 A;  4ESN A;  5CQ2 A;  1I5H W;  2XP5 A;  1NMV A;  3KAD A;  3OOB A;  4GLX A;  2JV4 A;  2XPA A;  1WMV A;  3CNG A;  1YW5 A;  1EG4 A;  1JMQ A;  1FLC A;  4U86 A;  3WH0 A;  2GDV A;  3KAI A;  3TCZ A;  2F21 A;  2L4J A;  2WAE A;  1PIN A;  2QRV A;  2LAJ A;  2XPB A;  3FSB A;  3NTP A;  2XP7 A;  2WAD A;  4U85 A;  3FS8 A;  2YSB A;  2YAJ B; 
#chains in the Genus database with same CATH homology
 1RP5 A;  3ODK A;  5E64 A;  5E5W A;  5E66 A;  2M8I A;  4E5R A;  4U84 A;  2ZQV A;  3MCB B;  5AHT A;  5E65 A;  3LKX A;  2ZQU A;  3KAF A;  2E45 A;  2ZR6 A;  2BA1 A;  3KCE A;  4A0T A;  1F8A B;  2DJY A;  3TDB A;  2XP6 A;  2ZQT A;  3MQG A;  4A0U A;  3TC5 A;  2DK1 A;  4REX A;  3FSC A;  3KAG A;  3M85 A;  2MDI A;  2ITK A;  3L4H A;  1O6W A;  2DWV A;  3MQH A;  2M8J A;  1EG3 A;  3KAB A;  2DK7 A;  2RE3 A;  2YQ2 A;  2DMV A;  2ZR5 A;  3LE4 A;  2Q5A A;  2Y8N B;  2YSG A;  2YSF A;  2JMF A;  2ZAJ A;  2OWO A;  2XP3 A;  1WR7 A;  1TK7 A;  2EZ5 W;  2YSH A;  2XP9 A;  3LKX B;  5U47 A;  1K9R A;  3MCB A;  2YSI A;  2KXQ A;  3WIT A;  1ZCN A;  2XP4 A;  5E62 A;  2JX8 A;  4QIB A;  2M3O W;  3M7N A;  1K9Q A;  2ZQS A;  3KAH A;  3PQH A;  2XP8 A;  2ZR4 A;  2JXW A;  1TR8 A;  5CQ2 A;  1I5H W;  2XP5 A;  1NMV A;  3KAD A;  3OOB A;  4GLX A;  2JV4 A;  2XPA A;  1WMV A;  3CNG A;  1YW5 A;  1EG4 A;  1JMQ A;  1FLC A;  4U86 A;  3WH0 A;  3KAI A;  3TCZ A;  2F21 A;  2L4J A;  2WAE A;  1PIN A;  2QRV A;  2LAJ A;  2XPB A;  3FSB A;  3NTP A;  2XP7 A;  2WAD A;  4U85 A;  3FS8 A;  2YSB A;  2YAJ B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...