4U85A

Human pin1 with cysteine sulfinic acid 113
Total Genus 46
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
46
sequence length
157
structure length
144
Chain Sequence
LPPGWEKAMSRSSGRVYYFNHITNASQWERPSEPARVRCSHLLVKHSQSRRPSSWRQEKITRTKEEALELINGYIQKIKSGEEDFESLASQFSDSSAKARGDLGAFSRGQMQKPFEDASFALRTGEMSGPVFTDSGIHIILRTE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Peptidyl-prolyl cis-trans isomerase NIMA-interacting 1
publication title Pin1 cysteine-113 oxidation inhibits its catalytic activity and cellular function in Alzheimer's disease.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Isomerase
total genus 46
structure length 144
sequence length 157
ec nomenclature ec 5.2.1.8: Peptidylprolyl isomerase.
pdb deposition date 2014-08-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00397 WW WW domain
A PF00639 Rotamase PPIC-type PPIASE domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.20.70.10 Mainly Beta Single Sheet Ubiquitin Ligase Nedd4; Chain: W; Ubiquitin Ligase Nedd4; Chain: W; 4u85A01
3.10.50.40 Alpha Beta Roll Chitinase A; domain 3 Chitinase A; domain 3 4u85A02
1FKLA 3CGMA 2L2SA 2PPPA 2ZAJA 3RFWA 2F4EA 3O5KA 1T11A 3RGCA 5BXJA 3KAIA 4ODMA 2MF9A 2KR7A 2LJ4A 2DG3A 2KFWA 4U85A 2RURA 3PRDA 1ROTA 4W9QA 2LKNA 3KZ7A 4IPXA 4IQ2A 3O5GA 3FAPA 2ZR6A 2RUCA 2LPVA 4TYOA 2DG4A 2BA1A 2KGJA 2AWGA 4TW7A 2DMVA 2MPHA 1NMWA 2DK7A 4ODQA 5AHTA 2FAPA 2EZ5W 4ODLA 4LAXA 1FKTA 4MSPA 2M08A 4QT3A 4TX0A 1FKBA 4C02B 2KO7A 2MLZA 2MDIA 5HKGA 1TK7A 1NMVA 1FAPA 1EG4A 1QPLA 2JZVA 5HW6A 2PV3A 4ODPA 1J6YA 5DIUA 5GPGA 4J4OA 5HT1A 3TDBA 1HXVA 1FKSA 4O2TA 1FJDA 1D7IA 4GGQA 2VN1A 1J4RA 4ODKA 1PBKA 2RUQA 1D7HA 4DZ3A 5HTGA 3O5DA 3UQBA 2XP3A 1EG3A 4DRQA 4GIVA 1ZCNA 3KCEA 4MGVA 2PPOA 4DH0A 2ZQVA 2DG9A 4DZ2A 3O5FA 4BF8A 2F21A 2YSIA 2VCDA 1FKRA 3UF8A 1F40A 2Q5AA 3O5PA 3KACA 4DIPA 2IF4A 3UI6A 1FKJA 4JFKA 1Q6IA 1TCOC 1QZ2A 2ITKA 3ODKA 4LAWA 4FN2A 2XP9A 4DRNA 5HW7A 4G50A 1Q6UA 2PBCA 2KI3A 3TC5A 1Q6HA 3UI5A 2ZR5A 4JFJA 2RE3A 3PA7A 3JYMA 3IKGA 1JNTA 3M85A 3LE4A 4DRJA 5HWCA 1I5HW 5B8IC 3EY6A 2D9FA 2PV2A 4LAYA 4DT4A 4JFLA 2KXQA 4JFMA 4NNRA 2L4JA 3MDYB 1B6CA 4N19A 1NSGA 3B7XA 4ODOA 4ITZA 5CQ2A 4DRKA 1FKIA 3GPKA 4W9OA 4DRMA 3UQAA 1L1PA 1W26A 5D75A 5I98A 2E45A 2ZR4A 4ODRA 2RQSA 3KADA 1YW5A 3JYJA 3PRBA 1FKDA 4DRHA 1JMQA 2JMFA 1D6OA 1ZK6A 5HW8A 2K8IA 4DRIA 4E5RA 1C9HA 5DIVA 1K9QA 2YSGA 1ROUA 1P5QA 2M8JA 1FKKA 2DJYA 3KAGA 2Y78A 4IQCA 1KT0A 2YSHA 4W9PA 3KAHA 2LGOA 1BKFA 1JNSA 3JXVA 3O5QA 3UI4A 2XP8A 1Y0OA 1WR7A 2YSBA 3IHZA 3VAWA 3IK8A 2JX8A 4U86A 3NRKA 3OOBA 1FKGA 1J4IA 3M7NA 4DRPA 1PINA 1YATA 5DITA 3IKDA 4U84A 3O5OA 1FD9A 5HWBA 1FKFA 2ZQTA 4ODNA 1M5YA 2F2DA 3LUOA 2N87A 2DWVA 2XP4A 3I6CA 2JXWA 2XPAA 1F8AB 1WMVA 2PPNA 2UZ5A 2RSEA 2XP6A 1JVWA 4R0XA 2MLXA 2XPBA 4G2PA 3WH0A 1FKHA 2MLYA 3O5JA 3KAFA 1BL4A 2M2AA 1R9HA 3L4HA 3NTPA 5J6EA 5HUAA 2MNTA 2XP5A 4JYSA 1KT1A 2M3OW 2FKEA 4DROA 2PV1A 3O5LA 2M8IA 4LAVA 4TW8A 3UQIA 2KE0A 3CGNA 1EQ3A 4TNSA 1K9RA 3O5MA 3CNGA 4JFIA 2M1IA 2ZQUA 4QIBA 3O5EA 4J4NA 3TCZA 2RUDA 3H9RB 2YSFA 2LAJA 1J4HA 1A7XA 2ZQSA 2DK1A 2XP7A 1U79A 1D7JA 1N1AA 4TW6A 2OFNA 1O6WA 2JV4A 3O5IA 4QT2A 1QPFA 3O5RA 1Q1CA 3NI6A 4REXA 1EYMA 3KABA 4FAPA
chains in the Genus database with same CATH superfamily
2A3EA 1FKLA 1W9VA 2A3CA 3FXYA 3CGMA 2DSUA 1UR8A 4GLXA 2IUZA 2L2SA 2PPPA 2ZAJA 3RFWA 3GU0A 2F4EA 3EIPA 3O5KA 1T11A 2PI6A 3RGCA 2O92A 5BXJA 3KAIA 2WM0A 4ODMA 1O6IA 1X6LA 2MF9A 2KR7A 2LJ4A 2DG3A 2KFWA 1WNOA 4U85A 3ARWA 4IT6A 2ESCA 2RURA 3PRDA 4DWSC 1ROTA 4W9QA 2DSWA 2LKNA 4Z2GA 3KZ7A 5E62A 4IPXA 4IQ2A 3O5GA 3FAPA 5DEZA 2ZR6A 2RUCA 2LPVA 3MCBB 3ARTA 3ALFA 4TYOA 2DG4A 2BA1A 1UR9A 2KGJA 2AWGA 4TW7A 1IX5A 4Z2JA 1TR8A 2DMVA 2MPHA 1LL4A 1NMWA 1HKJA 2DK7A 4ODQA 2OLHA 5AHTA 4L3NA 2FAPA 3AROA 4MNMA 1X6NA 2EZ5W 2YBTA 4ODLA 3RM9A 4LAXA 1JNEA 1LG2A 1FKTA 4MSPA 2M08A 4QT3A 4UDMA 1W9PA 4TX0A 2DT3A 4KQZA 1FKBA 4C02B 5E65A 2KO7A 3LKXA 2MLZA 2MDIA 5HKGA 3WD2A 4LGXA 1TK7A 1NMVA 1FAPA 1EG4A 4NSBA 5GQBA 1QPLA 2JZVA 3ARPA 5DF0A 4AY1A 2PV3A 4ODPA 5HW6A 1J6YA 5DIUA 5GPGA 4J4OA 5HT1A 3TDBA 1HXVA 3CHCA 1FKSA 4O2TA 1FJDA 1D7IA 4GGQA 1NWTA 1GPFA 1HJVA 2VN1A 1J4RA 4ODKA 3CH9A 1E6RA 3RM4A 4MNKA 1PBKA 2RUQA 1D7HA 4A0UA 4DZ3A 5HTGA 2B31A 3CHFA 3O5DA 3WL1A 4DWSA 2ETNA 3UQBA 3PR9A 3ARRA 2XP3A 1RP5A 1EG3A 3B9EA 1HJWA 4DRQA 4GIVA 1ZCNA 1W1TA 3KCEA 4MGVA 4P8UA 4WIWA 2PPOA 1JNDA 4DH0A 2ZQVA 2DG9A 4P8VA 4DZ2A 3O5FA 4BF8A 2F21A 3B9DA 2YSIA 2VCDA 1FKRA 3UF8A 1H0GA 3RMEA 1LQ0A 3B9AA 1F40A 2Q5AA 3O5PA 2OWOA 3KACA 1XHGA 4WK9A 5U47A 2EULA 1NWRA 4DIPA 2IF4A 3MQHA 3UI6A 3CHEA 1FKJA 4JFKA 1Q6IA 5DO2A 1NH6A 1TCOC 4A0TA 3WQWA 1QZ2A 2ITKA 3ODKA 1ITXA 3PRAA 4LAWA 4FN2A 4Q7NA 2XP9A 4DRNA 2G8ZA 5HW7A 4G50A 1E6NA 1Q6UA 4MPKA 2O9OA 2PBCA 3AS3A 3ALGA 5E64A 4IT4A 4R5EA 2KI3A 1WAWA 1ZB5A 3TC5A 1E15A 1Q6HA 3UI5A 2ZR5A 3ARQA 4HARA 3FY1A 4JFJA 2RE3A 3PA7A 3JYMA 1SYTA 1WB0A 3IKGA 1JNTA 3M85A 3LE4A 1GOIA 4W5UA 4DRJA 5HWCA 1I5HW 1W1VA 5B8IC 3EY6A 2PN0A 2D9FA 2PV2A 4LAYA 4DT4A 1NWSA 4JFLA 2KXQA 1KFWA 3BMBA 4JFMA 5HBFA 4HBEA 3LKXB 4NNRA 2L4JA 1ZBCA 3MDYB 1B6CA 4N19A 1NSGA 4P8XA 1NWUA 3B7XA 3G6LA 4ODOA 3WKZA 4ITZA 5CQ2A 4S3KA 4DRKA 1LL7A 1FKIA 3GPKA 3ARSA 1EIBA 4KR0B 4W9OA 4DRMA 1OGBA 3UQAA 2QRVA 1L1PA 1W26A 5D75A 5I98A 2E45A 2ZR4A 4WJXA 4ODRA 2RQSA 3KADA 1YW5A 1W9UA 3JYJA 3PRBA 1FKDA 4DRHA 4Z2IA 1JMQA 2JMFA 1E6PA 1D6OA 1ZK6A 5HW8A 2K8IA 3CZ8A 4DRIA 3AS1A 3W4RA 2WADA 1E6ZA 2F23A 2G41A 4DWSB 4DWSD 4HBOA 4E5RA 2DSZA 1C9HA 1HJXA 5DIVA 3WL0A 1K9QA 3AS0A 2YSGA 4ZS6A 3QOKA 1ROUA 1P5QA 3RM8A 2M8JA 1FKKA 2DJYA 3KAGA 2Y78A 4IQCA 1KT0A 2YSHA 4MAVA 3AS2A 4W9PA 3KAHA 2LGOA 1GUVA 1BKFA 1JNSA 2WLZA 3JXVA 4Q22A 1XRVA 2QF8A 3O5QA 3UI4A 2XP8A 1Y0OA 2B5UB 1E9LA 1WR7A 2DT0A 2YSBA 3IHZA 3VAWA 2AOSA 3IK8A 5JH8A 2JX8A 1D2KA 4U86A 1EDQA 1ZBWA 3OOBA 1FKGA 3NRKA 4PTMA 1GRJA 1J4IA 2A3AA 3M7NA 4DRPA 1PINA 4MNJA 4WKHA 1YATA 5DITA 2P4VA 3IKDA 4MNLA 4U84A 1LJYA 3O5OA 1FD9A 5GPRA 5HWBA 3ARXA 1FKFA 2ZQTA 1HKKA 1SR0A 3OA5A 4ODNA 1ZL1A 3G6MA 1M5YA 1W1PA 1H0IA 2Y8NB 2F2DA 4S3JA 5E66A 3LUOA 2N87A 3WD1A 2DWVA 2XP4A 4Z2KA 3I6CA 4ZPTR 3WIJA 2JXWA 2DPEA 5E5WA 2XPAA 1E44A 1F8AB 1ZU8A 1WMVA 2PPNA 2A3BA 3B8SA 3AQUA 2UZ5A 2WK2A 3FSCA 1FLCA 4Z2HA 2RSEA 3CHDA 2XP6A 1JVWA 1HKIA 4R0XA 2MLXA 2XPBA 3MQGA 4XAKA 4G2PA 3WH0A 1FKHA 2YAJB 2MLYA 3MCBA 4ZPVR 3ARZA 3O5JA 3KAFA 3WD0A 1BL4A 3FSBA 2M2AA 1R9HA 1FFQA 4WKFA 3L4HA 3NTPA 2WAEA 5J6EA 5HUAA 1JCHB 3ARUA 2MNTA 1EHNA 2XP5A 3FS8A 4JYSA 1KT1A 2M3OW 2FDMA 2FKEA 4URIA 3PQHA 4L72B 4DROA 2PV1A 3O5LA 2M8IA 4LAVA 1RD6A 4TW8A 3UQIA 2KE0A 1K9TA 1TFVA 3CGNA 1LG1A 1EQ3A 4TNSA 1K9RA 3O5MA 3CNGA 4JFIA 2DT2A 3WQVA 2M1IA 1FFRA 3GTYX 3ARVA 2ZQUA 4QIBA 1VF8A 3O5EA 1HKMA 4ML4A 4J4NA 4MTVA 2YBUA 3TCZA 2RUDA 3H9RB 4QZVB 1OWQA 2WLYA 2YSFA 1OGGA 2LAJA 1J4HA 1A7XA 2ZQSA 4Z2LA 2DK1A 4WKAA 1W1YA 2XP7A 2DT1A 1U79A 1D7JA 1N1AA 4NZCA 4TW6A 3ARYA 1ZBVA 2OFNA 3WD4A 1O6WA 3WD3A 2JV4A 3O5IA 4QT2A 1CTNA 4ZPWR 4P8WA 1QPFA 1LL6A 1Q1CA 3O5RA 3NI6A 4REXA 2DSVA 1EYMA 3KABA 3BXWA 4FAPA 1ZBKA
chains in the Genus database with same CATH topology
2A3EA 1FKLA 1W9VA 2A3CA 3FXYA 3CGMA 2DSUA 1UR8A 4GLXA 2IUZA 2L2SA 2PPPA 2ZAJA 3RFWA 2F4EA 3O5KA 1T11A 2PI6A 3RGCA 2O92A 5BXJA 3KAIA 2WM0A 4ODMA 1O6IA 1X6LA 2MF9A 2KR7A 2LJ4A 2DG3A 2KFWA 1WNOA 4U85A 3ARWA 4IT6A 2ESCA 2RURA 3PRDA 4DWSC 1ROTA 4W9QA 2DSWA 2LKNA 4Z2GA 3KZ7A 5E62A 4IPXA 4IQ2A 3O5GA 3FAPA 5DEZA 2ZR6A 2RUCA 2LPVA 3MCBB 3ARTA 3ALFA 4TYOA 2DG4A 2BA1A 1UR9A 2KGJA 2AWGA 4TW7A 1IX5A 4Z2JA 1TR8A 2DMVA 2MPHA 1LL4A 1NMWA 1HKJA 2DK7A 4ODQA 2OLHA 5AHTA 4L3NA 2FAPA 3AROA 4MNMA 1X6NA 2EZ5W 2YBTA 4ODLA 3RM9A 4LAXA 1JNEA 1LG2A 1FKTA 4MSPA 2M08A 4QT3A 1W9PA 4TX0A 2DT3A 4KQZA 1FKBA 4C02B 5E65A 2KO7A 3LKXA 2MLZA 2MDIA 5HKGA 3WD2A 4LGXA 1TK7A 1NMVA 1FAPA 1EG4A 4NSBA 5GQBA 1QPLA 2JZVA 3ARPA 5DF0A 4AY1A 2PV3A 4ODPA 5HW6A 1J6YA 5DIUA 5GPGA 4J4OA 5HT1A 3TDBA 1HXVA 3CHCA 1FKSA 4O2TA 1FJDA 1D7IA 4GGQA 1NWTA 1GPFA 1HJVA 2VN1A 1J4RA 4ODKA 3CH9A 1E6RA 3RM4A 4MNKA 1PBKA 2RUQA 1D7HA 4A0UA 4DZ3A 5HTGA 2B31A 3CHFA 3O5DA 3WL1A 4DWSA 3UQBA 3PR9A 3ARRA 2XP3A 1RP5A 1EG3A 3B9EA 1HJWA 4DRQA 4GIVA 1ZCNA 1W1TA 3KCEA 4MGVA 4P8UA 4WIWA 2PPOA 1JNDA 4DH0A 2ZQVA 2DG9A 4P8VA 4DZ2A 3O5FA 4BF8A 2F21A 3B9DA 2YSIA 2VCDA 1FKRA 3UF8A 1H0GA 3RMEA 1LQ0A 3B9AA 1F40A 2Q5AA 3O5PA 2OWOA 3KACA 1XHGA 4WK9A 5U47A 1NWRA 4DIPA 2IF4A 3MQHA 3UI6A 3CHEA 1FKJA 4JFKA 1Q6IA 5DO2A 1NH6A 1TCOC 4A0TA 3WQWA 1QZ2A 2ITKA 3ODKA 1ITXA 3PRAA 4LAWA 4FN2A 4Q7NA 2XP9A 4DRNA 2G8ZA 5HW7A 4G50A 1E6NA 1Q6UA 4MPKA 2O9OA 2PBCA 3AS3A 3ALGA 5E64A 4IT4A 4R5EA 2KI3A 1WAWA 1ZB5A 3TC5A 1E15A 1Q6HA 3UI5A 2ZR5A 3ARQA 4HARA 3FY1A 4JFJA 2RE3A 3PA7A 3JYMA 1SYTA 1WB0A 3IKGA 1JNTA 3M85A 3LE4A 1GOIA 4W5UA 4DRJA 5HWCA 1I5HW 1W1VA 5B8IC 3EY6A 2D9FA 2PV2A 4LAYA 4DT4A 1NWSA 4JFLA 2KXQA 1KFWA 4JFMA 5HBFA 4HBEA 3LKXB 4NNRA 2L4JA 1ZBCA 3MDYB 1B6CA 4N19A 1NSGA 4P8XA 1NWUA 3B7XA 3G6LA 4ODOA 3WKZA 4ITZA 5CQ2A 4S3KA 4DRKA 1LL7A 1FKIA 3GPKA 3ARSA 1EIBA 4KR0B 4W9OA 4DRMA 1OGBA 3UQAA 2QRVA 1L1PA 1W26A 5D75A 5I98A 2E45A 2ZR4A 4WJXA 4ODRA 2RQSA 3KADA 1YW5A 1W9UA 3JYJA 3PRBA 1FKDA 4DRHA 4Z2IA 1JMQA 2JMFA 1E6PA 1D6OA 1ZK6A 5HW8A 2K8IA 3CZ8A 4DRIA 3AS1A 3W4RA 2WADA 1E6ZA 2G41A 4DWSB 4DWSD 4HBOA 4E5RA 2DSZA 1C9HA 1HJXA 5DIVA 3WL0A 1K9QA 3AS0A 2YSGA 4ZS6A 3QOKA 1ROUA 1P5QA 3RM8A 2M8JA 1FKKA 2DJYA 3KAGA 2Y78A 4IQCA 1KT0A 2YSHA 4MAVA 3AS2A 4W9PA 3KAHA 2LGOA 1GUVA 1BKFA 1JNSA 2WLZA 3JXVA 4Q22A 1XRVA 2QF8A 3O5QA 3UI4A 2XP8A 1Y0OA 1E9LA 1WR7A 2DT0A 2YSBA 3IHZA 3VAWA 2AOSA 3IK8A 5JH8A 2JX8A 1D2KA 4U86A 1EDQA 1ZBWA 3OOBA 1FKGA 3NRKA 4PTMA 1J4IA 2A3AA 3M7NA 4DRPA 1PINA 4MNJA 4WKHA 1YATA 5DITA 3IKDA 4MNLA 4U84A 1LJYA 3O5OA 1FD9A 5GPRA 5HWBA 3ARXA 1FKFA 2ZQTA 1HKKA 1SR0A 3OA5A 4ODNA 1ZL1A 3G6MA 1M5YA 1W1PA 1H0IA 2Y8NB 2F2DA 4S3JA 5E66A 3LUOA 2N87A 3WD1A 2DWVA 2XP4A 4Z2KA 3I6CA 4ZPTR 3WIJA 2JXWA 2DPEA 5E5WA 2XPAA 1F8AB 1ZU8A 1WMVA 2PPNA 2A3BA 3B8SA 3AQUA 2UZ5A 2WK2A 3FSCA 1FLCA 4Z2HA 2RSEA 3CHDA 2XP6A 1JVWA 1HKIA 4R0XA 2MLXA 2XPBA 3MQGA 4XAKA 4G2PA 3WH0A 1FKHA 2YAJB 2MLYA 3MCBA 4ZPVR 3ARZA 3O5JA 3KAFA 3WD0A 1BL4A 3FSBA 2M2AA 1R9HA 1FFQA 4WKFA 3L4HA 3NTPA 2WAEA 5J6EA 5HUAA 3ARUA 2MNTA 1EHNA 2XP5A 3FS8A 4JYSA 1KT1A 2M3OW 2FDMA 2FKEA 4URIA 3PQHA 4L72B 4DROA 2PV1A 3O5LA 2M8IA 4LAVA 1RD6A 4TW8A 3UQIA 2KE0A 1K9TA 1TFVA 3CGNA 1LG1A 1EQ3A 4TNSA 1K9RA 3O5MA 3CNGA 4JFIA 2DT2A 3WQVA 2M1IA 1FFRA 3ARVA 2ZQUA 4QIBA 1VF8A 3O5EA 1HKMA 4ML4A 4J4NA 4MTVA 2YBUA 3TCZA 2RUDA 3H9RB 4QZVB 1OWQA 2WLYA 2YSFA 1OGGA 2LAJA 1J4HA 1A7XA 2ZQSA 4Z2LA 2DK1A 4WKAA 1W1YA 2XP7A 2DT1A 1U79A 1D7JA 1N1AA 4NZCA 4TW6A 3ARYA 1ZBVA 2OFNA 3WD4A 1O6WA 3WD3A 2JV4A 3O5IA 4QT2A 1CTNA 4ZPWR 4P8WA 1QPFA 1LL6A 1Q1CA 3O5RA 3NI6A 4REXA 2DSVA 1EYMA 3KABA 3BXWA 4FAPA 1ZBKA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1FKL A;  3CGM A;  2L2S A;  2PPP A;  2ZAJ A;  3RFW A;  2F4E A;  3O5K A;  1T11 A;  3RGC A;  5BXJ A;  3KAI A;  4ODM A;  2MF9 A;  2KR7 A;  2LJ4 A;  2DG3 A;  2KFW A;  4U85 A;  2RUR A;  3PRD A;  1ROT A;  4W9Q A;  2LKN A;  3KZ7 A;  4IPX A;  4IQ2 A;  3O5G A;  3FAP A;  2ZR6 A;  2RUC A;  2LPV A;  4TYO A;  2DG4 A;  2BA1 A;  2KGJ A;  2AWG A;  4TW7 A;  2DMV A;  2MPH A;  1NMW A;  2DK7 A;  4ODQ A;  5AHT A;  2FAP A;  2EZ5 W;  4ODL A;  4LAX A;  1FKT A;  4MSP A;  2M08 A;  4QT3 A;  4TX0 A;  1FKB A;  4C02 B;  2KO7 A;  2MLZ A;  2MDI A;  5HKG A;  1TK7 A;  1NMV A;  1FAP A;  1EG4 A;  1QPL A;  2JZV A;  5HW6 A;  2PV3 A;  4ODP A;  1J6Y A;  5DIU A;  5GPG A;  4J4O A;  5HT1 A;  3TDB A;  1HXV A;  1FKS A;  4O2T A;  1FJD A;  1D7I A;  4GGQ A;  2VN1 A;  1J4R A;  4ODK A;  1PBK A;  2RUQ A;  1D7H A;  4DZ3 A;  5HTG A;  3O5D A;  3UQB A;  2XP3 A;  1EG3 A;  4DRQ A;  4GIV A;  1ZCN A;  3KCE A;  4MGV A;  2PPO A;  4DH0 A;  2ZQV A;  2DG9 A;  4DZ2 A;  3O5F A;  4BF8 A;  2F21 A;  2YSI A;  2VCD A;  1FKR A;  3UF8 A;  1F40 A;  2Q5A A;  3O5P A;  3KAC A;  4DIP A;  2IF4 A;  3UI6 A;  1FKJ A;  4JFK A;  1Q6I A;  1TCO C;  1QZ2 A;  2ITK A;  3ODK A;  4LAW A;  4FN2 A;  2XP9 A;  4DRN A;  5HW7 A;  4G50 A;  1Q6U A;  2PBC A;  2KI3 A;  3TC5 A;  1Q6H A;  3UI5 A;  2ZR5 A;  4JFJ A;  2RE3 A;  3PA7 A;  3JYM A;  3IKG A;  1JNT A;  3M85 A;  3LE4 A;  4DRJ A;  5HWC A;  1I5H W;  5B8I C;  3EY6 A;  2D9F A;  2PV2 A;  4LAY A;  4DT4 A;  4JFL A;  2KXQ A;  4JFM A;  4NNR A;  2L4J A;  3MDY B;  1B6C A;  4N19 A;  1NSG A;  3B7X A;  4ODO A;  4ITZ A;  5CQ2 A;  4DRK A;  1FKI A;  3GPK A;  4W9O A;  4DRM A;  3UQA A;  1L1P A;  1W26 A;  5D75 A;  5I98 A;  2E45 A;  2ZR4 A;  4ODR A;  2RQS A;  3KAD A;  1YW5 A;  3JYJ A;  3PRB A;  1FKD A;  4DRH A;  1JMQ A;  2JMF A;  1D6O A;  1ZK6 A;  5HW8 A;  2K8I A;  4DRI A;  4E5R A;  1C9H A;  5DIV A;  1K9Q A;  2YSG A;  1ROU A;  1P5Q A;  2M8J A;  1FKK A;  2DJY A;  3KAG A;  2Y78 A;  4IQC A;  1KT0 A;  2YSH A;  4W9P A;  3KAH A;  2LGO A;  1BKF A;  1JNS A;  3JXV A;  3O5Q A;  3UI4 A;  2XP8 A;  1Y0O A;  1WR7 A;  2YSB A;  3IHZ A;  3VAW A;  3IK8 A;  2JX8 A;  4U86 A;  3NRK A;  3OOB A;  1FKG A;  1J4I A;  3M7N A;  4DRP A;  1PIN A;  1YAT A;  5DIT A;  3IKD A;  4U84 A;  3O5O A;  1FD9 A;  5HWB A;  1FKF A;  2ZQT A;  4ODN A;  1M5Y A;  2F2D A;  3LUO A;  2N87 A;  2DWV A;  2XP4 A;  3I6C A;  2JXW A;  2XPA A;  1F8A B;  1WMV A;  2PPN A;  2UZ5 A;  2RSE A;  2XP6 A;  1JVW A;  4R0X A;  2MLX A;  2XPB A;  4G2P A;  3WH0 A;  1FKH A;  2MLY A;  3O5J A;  3KAF A;  1BL4 A;  2M2A A;  1R9H A;  3L4H A;  3NTP A;  5J6E A;  5HUA A;  2MNT A;  2XP5 A;  4JYS A;  1KT1 A;  2M3O W;  2FKE A;  4DRO A;  2PV1 A;  3O5L A;  2M8I A;  4LAV A;  4TW8 A;  3UQI A;  2KE0 A;  3CGN A;  1EQ3 A;  4TNS A;  1K9R A;  3O5M A;  3CNG A;  4JFI A;  2M1I A;  2ZQU A;  4QIB A;  3O5E A;  4J4N A;  3TCZ A;  2RUD A;  3H9R B;  2YSF A;  2LAJ A;  1J4H A;  1A7X A;  2ZQS A;  2DK1 A;  2XP7 A;  1U79 A;  1D7J A;  1N1A A;  4TW6 A;  2OFN A;  1O6W A;  2JV4 A;  3O5I A;  4QT2 A;  1QPF A;  3O5R A;  1Q1C A;  3NI6 A;  4REX A;  1EYM A;  3KAB A;  4FAP A; 
#chains in the Genus database with same CATH topology
 2A3E A;  1FKL A;  1W9V A;  2A3C A;  3FXY A;  3CGM A;  2DSU A;  1UR8 A;  4GLX A;  2IUZ A;  2L2S A;  2PPP A;  2ZAJ A;  3RFW A;  3GU0 A;  2F4E A;  3EIP A;  3O5K A;  1T11 A;  2PI6 A;  3RGC A;  2O92 A;  5BXJ A;  3KAI A;  2WM0 A;  4ODM A;  1O6I A;  1X6L A;  2MF9 A;  2KR7 A;  2LJ4 A;  2DG3 A;  2KFW A;  1WNO A;  4U85 A;  3ARW A;  4IT6 A;  2ESC A;  2RUR A;  3PRD A;  4DWS C;  1ROT A;  4W9Q A;  2DSW A;  2LKN A;  4Z2G A;  3KZ7 A;  5E62 A;  4IPX A;  4IQ2 A;  3O5G A;  3FAP A;  5DEZ A;  2ZR6 A;  2RUC A;  2LPV A;  3MCB B;  3ART A;  3ALF A;  4TYO A;  2DG4 A;  2BA1 A;  1UR9 A;  2KGJ A;  2AWG A;  4TW7 A;  1IX5 A;  4Z2J A;  1TR8 A;  2DMV A;  2MPH A;  1LL4 A;  1NMW A;  1HKJ A;  2DK7 A;  4ODQ A;  2OLH A;  5AHT A;  4L3N A;  2FAP A;  3ARO A;  4MNM A;  1X6N A;  2EZ5 W;  2YBT A;  4ODL A;  3RM9 A;  4LAX A;  1JNE A;  1LG2 A;  1FKT A;  4MSP A;  2M08 A;  4QT3 A;  4UDM A;  1W9P A;  4TX0 A;  2DT3 A;  4KQZ A;  1FKB A;  4C02 B;  5E65 A;  2KO7 A;  3LKX A;  2MLZ A;  2MDI A;  5HKG A;  3WD2 A;  4LGX A;  1TK7 A;  1NMV A;  1FAP A;  1EG4 A;  4NSB A;  5GQB A;  1QPL A;  2JZV A;  3ARP A;  5DF0 A;  4AY1 A;  2PV3 A;  4ODP A;  5HW6 A;  1J6Y A;  5DIU A;  5GPG A;  4J4O A;  5HT1 A;  3TDB A;  1HXV A;  3CHC A;  1FKS A;  4O2T A;  1FJD A;  1D7I A;  4GGQ A;  1NWT A;  1GPF A;  1HJV A;  2VN1 A;  1J4R A;  4ODK A;  3CH9 A;  1E6R A;  3RM4 A;  4MNK A;  1PBK A;  2RUQ A;  1D7H A;  4A0U A;  4DZ3 A;  5HTG A;  2B31 A;  3CHF A;  3O5D A;  3WL1 A;  4DWS A;  2ETN A;  3UQB A;  3PR9 A;  3ARR A;  2XP3 A;  1RP5 A;  1EG3 A;  3B9E A;  1HJW A;  4DRQ A;  4GIV A;  1ZCN A;  1W1T A;  3KCE A;  4MGV A;  4P8U A;  4WIW A;  2PPO A;  1JND A;  4DH0 A;  2ZQV A;  2DG9 A;  4P8V A;  4DZ2 A;  3O5F A;  4BF8 A;  2F21 A;  3B9D A;  2YSI A;  2VCD A;  1FKR A;  3UF8 A;  1H0G A;  3RME A;  1LQ0 A;  3B9A A;  1F40 A;  2Q5A A;  3O5P A;  2OWO A;  3KAC A;  1XHG A;  4WK9 A;  5U47 A;  2EUL A;  1NWR A;  4DIP A;  2IF4 A;  3MQH A;  3UI6 A;  3CHE A;  1FKJ A;  4JFK A;  1Q6I A;  5DO2 A;  1NH6 A;  1TCO C;  4A0T A;  3WQW A;  1QZ2 A;  2ITK A;  3ODK A;  1ITX A;  3PRA A;  4LAW A;  4FN2 A;  4Q7N A;  2XP9 A;  4DRN A;  2G8Z A;  5HW7 A;  4G50 A;  1E6N A;  1Q6U A;  4MPK A;  2O9O A;  2PBC A;  3AS3 A;  3ALG A;  5E64 A;  4IT4 A;  4R5E A;  2KI3 A;  1WAW A;  1ZB5 A;  3TC5 A;  1E15 A;  1Q6H A;  3UI5 A;  2ZR5 A;  3ARQ A;  4HAR A;  3FY1 A;  4JFJ A;  2RE3 A;  3PA7 A;  3JYM A;  1SYT A;  1WB0 A;  3IKG A;  1JNT A;  3M85 A;  3LE4 A;  1GOI A;  4W5U A;  4DRJ A;  5HWC A;  1I5H W;  1W1V A;  5B8I C;  3EY6 A;  2PN0 A;  2D9F A;  2PV2 A;  4LAY A;  4DT4 A;  1NWS A;  4JFL A;  2KXQ A;  1KFW A;  3BMB A;  4JFM A;  5HBF A;  4HBE A;  3LKX B;  4NNR A;  2L4J A;  1ZBC A;  3MDY B;  1B6C A;  4N19 A;  1NSG A;  4P8X A;  1NWU A;  3B7X A;  3G6L A;  4ODO A;  3WKZ A;  4ITZ A;  5CQ2 A;  4S3K A;  4DRK A;  1LL7 A;  1FKI A;  3GPK A;  3ARS A;  1EIB A;  4KR0 B;  4W9O A;  4DRM A;  1OGB A;  3UQA A;  2QRV A;  1L1P A;  1W26 A;  5D75 A;  5I98 A;  2E45 A;  2ZR4 A;  4WJX A;  4ODR A;  2RQS A;  3KAD A;  1YW5 A;  1W9U A;  3JYJ A;  3PRB A;  1FKD A;  4DRH A;  4Z2I A;  1JMQ A;  2JMF A;  1E6P A;  1D6O A;  1ZK6 A;  5HW8 A;  2K8I A;  3CZ8 A;  4DRI A;  3AS1 A;  3W4R A;  2WAD A;  1E6Z A;  2F23 A;  2G41 A;  4DWS B;  4DWS D;  4HBO A;  4E5R A;  2DSZ A;  1C9H A;  1HJX A;  5DIV A;  3WL0 A;  1K9Q A;  3AS0 A;  2YSG A;  4ZS6 A;  3QOK A;  1ROU A;  1P5Q A;  3RM8 A;  2M8J A;  1FKK A;  2DJY A;  3KAG A;  2Y78 A;  4IQC A;  1KT0 A;  2YSH A;  4MAV A;  3AS2 A;  4W9P A;  3KAH A;  2LGO A;  1GUV A;  1BKF A;  1JNS A;  2WLZ A;  3JXV A;  4Q22 A;  1XRV A;  2QF8 A;  3O5Q A;  3UI4 A;  2XP8 A;  1Y0O A;  2B5U B;  1E9L A;  1WR7 A;  2DT0 A;  2YSB A;  3IHZ A;  3VAW A;  2AOS A;  3IK8 A;  5JH8 A;  2JX8 A;  1D2K A;  4U86 A;  1EDQ A;  1ZBW A;  3OOB A;  1FKG A;  3NRK A;  4PTM A;  1GRJ A;  1J4I A;  2A3A A;  3M7N A;  4DRP A;  1PIN A;  4MNJ A;  4WKH A;  1YAT A;  5DIT A;  2P4V A;  3IKD A;  4MNL A;  4U84 A;  1LJY A;  3O5O A;  1FD9 A;  5GPR A;  5HWB A;  3ARX A;  1FKF A;  2ZQT A;  1HKK A;  1SR0 A;  3OA5 A;  4ODN A;  1ZL1 A;  3G6M A;  1M5Y A;  1W1P A;  1H0I A;  2Y8N B;  2F2D A;  4S3J A;  5E66 A;  3LUO A;  2N87 A;  3WD1 A;  2DWV A;  2XP4 A;  4Z2K A;  3I6C A;  4ZPT R;  3WIJ A;  2JXW A;  2DPE A;  5E5W A;  2XPA A;  1E44 A;  1F8A B;  1ZU8 A;  1WMV A;  2PPN A;  2A3B A;  3B8S A;  3AQU A;  2UZ5 A;  2WK2 A;  3FSC A;  1FLC A;  4Z2H A;  2RSE A;  3CHD A;  2XP6 A;  1JVW A;  1HKI A;  4R0X A;  2MLX A;  2XPB A;  3MQG A;  4XAK A;  4G2P A;  3WH0 A;  1FKH A;  2YAJ B;  2MLY A;  3MCB A;  4ZPV R;  3ARZ A;  3O5J A;  3KAF A;  3WD0 A;  1BL4 A;  3FSB A;  2M2A A;  1R9H A;  1FFQ A;  4WKF A;  3L4H A;  3NTP A;  2WAE A;  5J6E A;  5HUA A;  1JCH B;  3ARU A;  2MNT A;  1EHN A;  2XP5 A;  3FS8 A;  4JYS A;  1KT1 A;  2M3O W;  2FDM A;  2FKE A;  4URI A;  3PQH A;  4L72 B;  4DRO A;  2PV1 A;  3O5L A;  2M8I A;  4LAV A;  1RD6 A;  4TW8 A;  3UQI A;  2KE0 A;  1K9T A;  1TFV A;  3CGN A;  1LG1 A;  1EQ3 A;  4TNS A;  1K9R A;  3O5M A;  3CNG A;  4JFI A;  2DT2 A;  3WQV A;  2M1I A;  1FFR A;  3GTY X;  3ARV A;  2ZQU A;  4QIB A;  1VF8 A;  3O5E A;  1HKM A;  4ML4 A;  4J4N A;  4MTV A;  2YBU A;  3TCZ A;  2RUD A;  3H9R B;  4QZV B;  1OWQ A;  2WLY A;  2YSF A;  1OGG A;  2LAJ A;  1J4H A;  1A7X A;  2ZQS A;  4Z2L A;  2DK1 A;  4WKA A;  1W1Y A;  2XP7 A;  2DT1 A;  1U79 A;  1D7J A;  1N1A A;  4NZC A;  4TW6 A;  3ARY A;  1ZBV A;  2OFN A;  3WD4 A;  1O6W A;  3WD3 A;  2JV4 A;  3O5I A;  4QT2 A;  1CTN A;  4ZPW R;  4P8W A;  1QPF A;  1LL6 A;  1Q1C A;  3O5R A;  3NI6 A;  4REX A;  2DSV A;  1EYM A;  3KAB A;  3BXW A;  4FAP A;  1ZBK A; 
#chains in the Genus database with same CATH homology
 2A3E A;  1FKL A;  1W9V A;  2A3C A;  3FXY A;  3CGM A;  2DSU A;  1UR8 A;  4GLX A;  2IUZ A;  2L2S A;  2PPP A;  2ZAJ A;  3RFW A;  2F4E A;  3O5K A;  1T11 A;  2PI6 A;  3RGC A;  2O92 A;  5BXJ A;  3KAI A;  2WM0 A;  4ODM A;  1O6I A;  1X6L A;  2MF9 A;  2KR7 A;  2LJ4 A;  2DG3 A;  2KFW A;  1WNO A;  4U85 A;  3ARW A;  4IT6 A;  2ESC A;  2RUR A;  3PRD A;  4DWS C;  1ROT A;  4W9Q A;  2DSW A;  2LKN A;  4Z2G A;  3KZ7 A;  5E62 A;  4IPX A;  4IQ2 A;  3O5G A;  3FAP A;  5DEZ A;  2ZR6 A;  2RUC A;  2LPV A;  3MCB B;  3ART A;  3ALF A;  4TYO A;  2DG4 A;  2BA1 A;  1UR9 A;  2KGJ A;  2AWG A;  4TW7 A;  1IX5 A;  4Z2J A;  1TR8 A;  2DMV A;  2MPH A;  1LL4 A;  1NMW A;  1HKJ A;  2DK7 A;  4ODQ A;  2OLH A;  5AHT A;  4L3N A;  2FAP A;  3ARO A;  4MNM A;  1X6N A;  2EZ5 W;  2YBT A;  4ODL A;  3RM9 A;  4LAX A;  1JNE A;  1LG2 A;  1FKT A;  4MSP A;  2M08 A;  4QT3 A;  1W9P A;  4TX0 A;  2DT3 A;  4KQZ A;  1FKB A;  4C02 B;  5E65 A;  2KO7 A;  3LKX A;  2MLZ A;  2MDI A;  5HKG A;  3WD2 A;  4LGX A;  1TK7 A;  1NMV A;  1FAP A;  1EG4 A;  4NSB A;  5GQB A;  1QPL A;  2JZV A;  3ARP A;  5DF0 A;  4AY1 A;  2PV3 A;  4ODP A;  5HW6 A;  1J6Y A;  5DIU A;  5GPG A;  4J4O A;  5HT1 A;  3TDB A;  1HXV A;  3CHC A;  1FKS A;  4O2T A;  1FJD A;  1D7I A;  4GGQ A;  1NWT A;  1GPF A;  1HJV A;  2VN1 A;  1J4R A;  4ODK A;  3CH9 A;  1E6R A;  3RM4 A;  4MNK A;  1PBK A;  2RUQ A;  1D7H A;  4A0U A;  4DZ3 A;  5HTG A;  2B31 A;  3CHF A;  3O5D A;  3WL1 A;  4DWS A;  3UQB A;  3PR9 A;  3ARR A;  2XP3 A;  1RP5 A;  1EG3 A;  3B9E A;  1HJW A;  4DRQ A;  4GIV A;  1ZCN A;  1W1T A;  3KCE A;  4MGV A;  4P8U A;  4WIW A;  2PPO A;  1JND A;  4DH0 A;  2ZQV A;  2DG9 A;  4P8V A;  4DZ2 A;  3O5F A;  4BF8 A;  2F21 A;  3B9D A;  2YSI A;  2VCD A;  1FKR A;  3UF8 A;  1H0G A;  3RME A;  1LQ0 A;  3B9A A;  1F40 A;  2Q5A A;  3O5P A;  2OWO A;  3KAC A;  1XHG A;  4WK9 A;  5U47 A;  1NWR A;  4DIP A;  2IF4 A;  3MQH A;  3UI6 A;  3CHE A;  1FKJ A;  4JFK A;  1Q6I A;  5DO2 A;  1NH6 A;  1TCO C;  4A0T A;  3WQW A;  1QZ2 A;  2ITK A;  3ODK A;  1ITX A;  3PRA A;  4LAW A;  4FN2 A;  4Q7N A;  2XP9 A;  4DRN A;  2G8Z A;  5HW7 A;  4G50 A;  1E6N A;  1Q6U A;  4MPK A;  2O9O A;  2PBC A;  3AS3 A;  3ALG A;  5E64 A;  4IT4 A;  4R5E A;  2KI3 A;  1WAW A;  1ZB5 A;  3TC5 A;  1E15 A;  1Q6H A;  3UI5 A;  2ZR5 A;  3ARQ A;  4HAR A;  3FY1 A;  4JFJ A;  2RE3 A;  3PA7 A;  3JYM A;  1SYT A;  1WB0 A;  3IKG A;  1JNT A;  3M85 A;  3LE4 A;  1GOI A;  4W5U A;  4DRJ A;  5HWC A;  1I5H W;  1W1V A;  5B8I C;  3EY6 A;  2D9F A;  2PV2 A;  4LAY A;  4DT4 A;  1NWS A;  4JFL A;  2KXQ A;  1KFW A;  4JFM A;  5HBF A;  4HBE A;  3LKX B;  4NNR A;  2L4J A;  1ZBC A;  3MDY B;  1B6C A;  4N19 A;  1NSG A;  4P8X A;  1NWU A;  3B7X A;  3G6L A;  4ODO A;  3WKZ A;  4ITZ A;  5CQ2 A;  4S3K A;  4DRK A;  1LL7 A;  1FKI A;  3GPK A;  3ARS A;  1EIB A;  4KR0 B;  4W9O A;  4DRM A;  1OGB A;  3UQA A;  2QRV A;  1L1P A;  1W26 A;  5D75 A;  5I98 A;  2E45 A;  2ZR4 A;  4WJX A;  4ODR A;  2RQS A;  3KAD A;  1YW5 A;  1W9U A;  3JYJ A;  3PRB A;  1FKD A;  4DRH A;  4Z2I A;  1JMQ A;  2JMF A;  1E6P A;  1D6O A;  1ZK6 A;  5HW8 A;  2K8I A;  3CZ8 A;  4DRI A;  3AS1 A;  3W4R A;  2WAD A;  1E6Z A;  2G41 A;  4DWS B;  4DWS D;  4HBO A;  4E5R A;  2DSZ A;  1C9H A;  1HJX A;  5DIV A;  3WL0 A;  1K9Q A;  3AS0 A;  2YSG A;  4ZS6 A;  3QOK A;  1ROU A;  1P5Q A;  3RM8 A;  2M8J A;  1FKK A;  2DJY A;  3KAG A;  2Y78 A;  4IQC A;  1KT0 A;  2YSH A;  4MAV A;  3AS2 A;  4W9P A;  3KAH A;  2LGO A;  1GUV A;  1BKF A;  1JNS A;  2WLZ A;  3JXV A;  4Q22 A;  1XRV A;  2QF8 A;  3O5Q A;  3UI4 A;  2XP8 A;  1Y0O A;  1E9L A;  1WR7 A;  2DT0 A;  2YSB A;  3IHZ A;  3VAW A;  2AOS A;  3IK8 A;  5JH8 A;  2JX8 A;  1D2K A;  4U86 A;  1EDQ A;  1ZBW A;  3OOB A;  1FKG A;  3NRK A;  4PTM A;  1J4I A;  2A3A A;  3M7N A;  4DRP A;  1PIN A;  4MNJ A;  4WKH A;  1YAT A;  5DIT A;  3IKD A;  4MNL A;  4U84 A;  1LJY A;  3O5O A;  1FD9 A;  5GPR A;  5HWB A;  3ARX A;  1FKF A;  2ZQT A;  1HKK A;  1SR0 A;  3OA5 A;  4ODN A;  1ZL1 A;  3G6M A;  1M5Y A;  1W1P A;  1H0I A;  2Y8N B;  2F2D A;  4S3J A;  5E66 A;  3LUO A;  2N87 A;  3WD1 A;  2DWV A;  2XP4 A;  4Z2K A;  3I6C A;  4ZPT R;  3WIJ A;  2JXW A;  2DPE A;  5E5W A;  2XPA A;  1F8A B;  1ZU8 A;  1WMV A;  2PPN A;  2A3B A;  3B8S A;  3AQU A;  2UZ5 A;  2WK2 A;  3FSC A;  1FLC A;  4Z2H A;  2RSE A;  3CHD A;  2XP6 A;  1JVW A;  1HKI A;  4R0X A;  2MLX A;  2XPB A;  3MQG A;  4XAK A;  4G2P A;  3WH0 A;  1FKH A;  2YAJ B;  2MLY A;  3MCB A;  4ZPV R;  3ARZ A;  3O5J A;  3KAF A;  3WD0 A;  1BL4 A;  3FSB A;  2M2A A;  1R9H A;  1FFQ A;  4WKF A;  3L4H A;  3NTP A;  2WAE A;  5J6E A;  5HUA A;  3ARU A;  2MNT A;  1EHN A;  2XP5 A;  3FS8 A;  4JYS A;  1KT1 A;  2M3O W;  2FDM A;  2FKE A;  4URI A;  3PQH A;  4L72 B;  4DRO A;  2PV1 A;  3O5L A;  2M8I A;  4LAV A;  1RD6 A;  4TW8 A;  3UQI A;  2KE0 A;  1K9T A;  1TFV A;  3CGN A;  1LG1 A;  1EQ3 A;  4TNS A;  1K9R A;  3O5M A;  3CNG A;  4JFI A;  2DT2 A;  3WQV A;  2M1I A;  1FFR A;  3ARV A;  2ZQU A;  4QIB A;  1VF8 A;  3O5E A;  1HKM A;  4ML4 A;  4J4N A;  4MTV A;  2YBU A;  3TCZ A;  2RUD A;  3H9R B;  4QZV B;  1OWQ A;  2WLY A;  2YSF A;  1OGG A;  2LAJ A;  1J4H A;  1A7X A;  2ZQS A;  4Z2L A;  2DK1 A;  4WKA A;  1W1Y A;  2XP7 A;  2DT1 A;  1U79 A;  1D7J A;  1N1A A;  4NZC A;  4TW6 A;  3ARY A;  1ZBV A;  2OFN A;  3WD4 A;  1O6W A;  3WD3 A;  2JV4 A;  3O5I A;  4QT2 A;  1CTN A;  4ZPW R;  4P8W A;  1QPF A;  1LL6 A;  1Q1C A;  3O5R A;  3NI6 A;  4REX A;  2DSV A;  1EYM A;  3KAB A;  3BXW A;  4FAP A;  1ZBK A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...