4U85A

Human pin1 with cysteine sulfinic acid 113
Total Genus 46
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
46
sequence length
157
structure length
144
Chain Sequence
LPPGWEKAMSRSSGRVYYFNHITNASQWERPSEPARVRCSHLLVKHSQSRRPSSWRQEKITRTKEEALELINGYIQKIKSGEEDFESLASQFSDSSAKARGDLGAFSRGQMQKPFEDASFALRTGEMSGPVFTDSGIHIILRTE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Isomerase
molecule keywords Peptidyl-prolyl cis-trans isomerase NIMA-interacting 1
publication title Pin1 cysteine-113 oxidation inhibits its catalytic activity and cellular function in Alzheimer's disease.
pubmed doi rcsb
source organism Homo sapiens
total genus 46
structure length 144
sequence length 157
ec nomenclature ec 5.2.1.8: Peptidylprolyl isomerase.
pdb deposition date 2014-08-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00397 WW WW domain
A PF00639 Rotamase PPIC-type PPIASE domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.20.70.10 Mainly Beta Single Sheet Ubiquitin Ligase Nedd4; Chain: W; Ubiquitin Ligase Nedd4; Chain: W; 4u85A01
3.10.50.40 Alpha Beta Roll Chitinase A; domain 3 Chitinase A; domain 3 4u85A02
5HTGA 2MLXA 4DRPA 3GPKA 4JFJA 3IKDA 4W9PA 1YW5A 1ZK6A 1ROUA 1M5YA 3O5FA 3B7XA 2VCDA 1Q6UA 2F4EA 4DZ3A 3IKGA 4DRKA 2KXQA 1TK7A 2XP3A 4DZ2A 3KAHA 2YSHA 1J4RA 3O5OA 1FKIA 2E45A 3O5LA 1JNSA 2YSFA 2KR7A 5AHTA 1KT0A 3TDBA 4QIBA 1NSGA 2FKEA 1EG4A 1B6CA 2FAPA 1PBKA 4IQCA 2ZQTA 5GPGA 2DK1A 2MPHA 3NRKA 2M1IA 3L4HA 1W26A 3KZ7A 3LE4A 1I5HW 2LKNA 1FKSA 5CQ2A 3EY6A 3CNGA 1D7IA 4TW6A 2RUQA 5BXJA 2M08A 3O5PA 4JFMA 4BF8A 4DIPA 4J4OA 4LAVA 2ZR5A 2YSGA 1K9QA 3O5IA 2PPOA 3JYJA 3KADA 1BL4A 2DK7A 2L2SA 2YSBA 5HW7A 1FKDA 1A7XA 4O2TA 3O5KA 1J4IA 2RE3A 1FKHA 1WR7A 4DRHA 1ZCNA 4IQ2A 2KFWA 2KGJA 2DJYA 2XP7A 3UQAA 3UF8A 1Y0OA 3TC5A 2OFNA 1FKTA 4DH0A 1EYMA 3CGNA 3FAPA 2XP6A 4ODKA 4W9QA 4ITZA 4ODRA 2LJ4A 2LGOA 4U86A 2PV2A 4TX0A 4JFIA 3WH0A 3IHZA 2PPPA 1Q6IA 3O5GA 1FKGA 3O5DA 3PRBA 5DIUA 2XP5A 4DROA 2N87A 4DT4A 2KO7A 4TW8A 5DITA 5HW8A 4U85A 2RUDA 1EG3A 4C02B 1NMVA 2PV3A 4DRNA 5HW6A 2MF9A 3O5JA 2XP9A 2XPAA 2UZ5A 1FJDA 5HKGA 2RSEA 3KACA 2ZR6A 4E5RA 1Q1CA 1FKBA 4QT3A 2ZQVA 2AWGA 1Q6HA 4JFKA 2K8IA 4MSPA 3ODKA 1PINA 3UI6A 1NMWA 2KI3A 2Y78A 1K9RA 1FKKA 2MDIA 3PRDA 2DG9A 3OOBA 4R0XA 5DIVA 4DRMA 2VN1A 5HWBA 2Q5AA 1QZ2A 3JYMA 4DRIA 5J6EA 4GGQA 1JNTA 4G2PA 3O5MA 1T11A 3H9RB 2M8IA 3O5RA 2ZQSA 4U84A 2XPBA 4TNSA 4IPXA 2ITKA 2PPNA 3PA7A 2ZR4A 5D75A 1BKFA 3UQBA 5HT1A 3UI4A 3LUOA 3O5QA 2LAJA 1QPLA 5HWCA 2DWVA 2D9FA 1QPFA 3KCEA 4MGVA 3M85A 1WMVA 4REXA 2RQSA 1D7HA 2MLZA 2XP4A 1FAPA 1F8AB 2LPVA 2DMVA 1FKFA 1YATA 2M8JA 2MNTA 1FD9A 2MLYA 2KE0A 2EZ5W 3RFWA 2PV1A 4NNRA 4QT2A 1JVWA 1FKRA 4TYOA 4ODOA 1HXVA 3MDYB 2ZQUA 4LAXA 2IF4A 2BA1A 2M3OW 2JZVA 4JYSA 4GIVA 3KAGA 3UI5A 1KT1A 1J6YA 2JMFA 4J4NA 2JV4A 3I6CA 2ZAJA 3O5EA 1FKJA 4N19A 2PBCA 1D6OA 1O6WA 3TCZA 4LAWA 2YSIA 3KAFA 1U79A 4JFLA 3NTPA 5HUAA 3UQIA 2F2DA 3JXVA 4FN2A 2RUCA 4ODNA 3VAWA 4DRJA 4LAYA 1R9HA 1TCOC 3NI6A 3KABA 4ODPA 1L1PA 2DG3A 2JX8A 3M7NA 4ODLA 5I98A 2M2AA 1FKLA 1J4HA 2RURA 4G50A 3RGCA 1P5QA 3CGMA 2XP8A 2DG4A 2JXWA 4ODQA 1EQ3A 3IK8A 1JMQA 4ODMA 1F40A 5B8IC 2L4JA 1D7JA 4FAPA 1ROTA 4TW7A 4W9OA 4DRQA 3KAIA 1C9HA 2F21A 1N1AA
chains in the Genus database with same CATH superfamily
2DSWA 1WNOA 5HTGA 2MLXA 4DRPA 2A3BA 1TFVA 1NWUA 3GPKA 4JFJA 1W1TA 3IKDA 1WAWA 4W9PA 1YW5A 1RD6A 1ZK6A 1ROUA 1E6PA 1M5YA 3ALFA 3ARPA 2WM0A 4AY1A 3O5FA 2F23A 3B7XA 2VCDA 1Q6UA 2B5UB 2F4EA 1ZB5A 4DZ3A 1LG1A 3ARTA 3IKGA 4DRKA 1ITXA 2KXQA 2A3AA 3QOKA 1TK7A 2XP3A 4DZ2A 4XAKA 3KAHA 1CTNA 2YSHA 1J4RA 3O5OA 1JNDA 3CHFA 4A0TA 4HARA 3CHDA 1FKIA 2E45A 3WKZA 4ZPWR 5DEZA 2WADA 3O5LA 1JNSA 2YSFA 4MNKA 2KR7A 1X6LA 5AHTA 3B8SA 2DSUA 4DWSA 1KT0A 4WKAA 3TDBA 4QIBA 1W9UA 3FSCA 1NSGA 2FKEA 1EG4A 1B6CA 4W5UA 2FAPA 1PBKA 3ARYA 4IQCA 2G8ZA 4Z2HA 3RMEA 2ZQTA 4NSBA 4DWSD 1H0GA 2DT0A 5GPGA 2DK1A 2G41A 2MPHA 3NRKA 4Z2KA 2M1IA 3L4HA 1W26A 3KZ7A 1FFQA 3LE4A 1I5HW 2LKNA 1FKSA 3FS8A 5CQ2A 3EY6A 1LL7A 3CNGA 1D7IA 1E44A 1W9VA 4TW6A 2DSVA 2RUQA 3WD2A 4Q7NA 4Z2IA 5BXJA 2M08A 3O5PA 4JFMA 4BF8A 4DIPA 4Z2JA 4J4OA 4LAVA 4PTMA 4MPKA 4ZPTR 2ZR5A 2YSGA 1K9QA 3O5IA 2PPOA 3JYJA 1LL4A 3WD0A 3KADA 1BL4A 1GRJA 2DK7A 3ARQA 2L2SA 4MTVA 2YSBA 1D2KA 5E66A 3AQUA 1OWQA 2DT1A 4MNJA 5HW7A 1KFWA 5JH8A 1FKDA 2Y8NB 1A7XA 4O2TA 3CZ8A 5U47A 3O5KA 1J4IA 4A0UA 2RE3A 1FKHA 5HBFA 3ARUA 1VF8A 1WR7A 4DRHA 1ZCNA 4IQ2A 3GTYX 2KFWA 2KGJA 2DJYA 2XP7A 1E9LA 1HKIA 3UQAA 3UF8A 3AS2A 1Y0OA 3TC5A 1NH6A 2OFNA 1FKTA 4DH0A 1EYMA 3CGNA 3GU0A 3FAPA 4KQZA 2A3EA 1ZBCA 2XP6A 1ZBWA 4P8WA 4ODKA 3CH9A 4W9QA 4ITZA 4ODRA 2LJ4A 2LGOA 4WK9A 4U86A 3FXYA 1FFRA 2PV2A 3LKXB 4TX0A 4JFIA 3BXWA 2B31A 3WH0A 3IHZA 2PPPA 1Q6IA 1W9PA 1W1YA 4Z2LA 2P4VA 4NZCA 1IX5A 3O5GA 1FKGA 3O5DA 3PRBA 5DIUA 2XP5A 4DROA 2N87A 2OWOA 1FLCA 3EIPA 4DT4A 1ZU8A 2IUZA 2KO7A 4HBEA 4ZPVR 1TR8A 4TW8A 3RM8A 1X6NA 5DITA 5HW8A 4DWSC 4U85A 1GOIA 2ESCA 1EDQA 1NWRA 3AROA 2RUDA 1EG3A 4C02B 1HJVA 4R5EA 1NMVA 2PV3A 3AS1A 4DRNA 5HW6A 4WKFA 2PI6A 1HJWA 2MF9A 1SR0A 3O5JA 2XP9A 4P8UA 2XPAA 4ZS6A 2UZ5A 4ML4A 2DPEA 2WK2A 5E64A 1FJDA 1OGGA 5HKGA 4WKHA 4Q22A 5DF0A 2RSEA 3KACA 1NWTA 3BMBA 2ZR6A 4E5RA 1Q1CA 1FKBA 4QT3A 2ZQVA 2AWGA 1Q6HA 3AS0A 4JFKA 1XHGA 2K8IA 1XRVA 3ODKA 3LKXA 2AOSA 2DT2A 4MSPA 1PINA 3UI6A 1NMWA 2KI3A 2EULA 2Y78A 1K9RA 1FKKA 2MDIA 1E15A 3PRDA 2DG9A 1EIBA 4KR0B 3OOBA 4R0XA 5DIVA 3ARZA 2VN1A 4DRMA 5HWBA 2WAEA 2Q5AA 1QZ2A 3JYMA 4DRIA 5J6EA 2YAJB 4IT4A 2QF8A 3OA5A 4GGQA 1JNTA 4G2PA 3O5MA 1E6NA 1T11A 5DO2A 3H9RB 2M8IA 4P8XA 2PN0A 3O5RA 2ZQSA 3PR9A 4U84A 3CHCA 3WD4A 2XPBA 4IT6A 4TNSA 4IPXA 4URIA 2ITKA 4L3NA 2PPNA 3PA7A 2WLZA 2ZR4A 5D75A 1BKFA 1WB0A 3UQBA 2A3CA 5HT1A 5E65A 3UI4A 2YBTA 3LUOA 1RP5A 3O5QA 2LAJA 4P8VA 1QPLA 4WIWA 5HWCA 3WD3A 2DWVA 3PQHA 2D9FA 1QPFA 3ALGA 3KCEA 4MGVA 3MCBB 4MAVA 3M85A 1WMVA 1E6RA 2OLHA 4REXA 4MNLA 2RQSA 1D7HA 2MLZA 2XP4A 1ZBVA 3ARRA 2ETNA 1O6IA 1JCHB 1FAPA 1LQ0A 1F8AB 1HKJA 2LPVA 2DMVA 1FKFA 3B9AA 1YATA 2M8JA 2DT3A 3FY1A 5GPRA 2MNTA 3WD1A 1FD9A 2MLYA 1LL6A 1HKMA 2KE0A 2EZ5W 2FDMA 3RFWA 1W1PA 2O9OA 2PV1A 3ARVA 4NNRA 4QT2A 1JVWA 1LJYA 2WLYA 1FKRA 1LG2A 4TYOA 3FSBA 4ODOA 1HXVA 3MDYB 3RM9A 2ZQUA 4LAXA 1UR8A 1HKKA 3RM4A 4Z2GA 3ARSA 4LGXA 2IF4A 3B9DA 2BA1A 2M3OW 2JZVA 4S3JA 4JYSA 4GIVA 3MQHA 3KAGA 5GQBA 3UI5A 1KT1A 3WIJA 4S3KA 1ZL1A 2QRVA 1J6YA 4L72B 2JMFA 4J4NA 2JV4A 3I6CA 2ZAJA 1OGBA 3O5EA 3MCBA 1HJXA 1FKJA 3AS3A 4WJXA 4N19A 3MQGA 5E62A 2PBCA 1D6OA 1O6WA 4QZVB 3TCZA 2DSZA 3ARXA 3B9EA 4LAWA 1H0IA 3WQVA 2YSIA 3KAFA 1U79A 4JFLA 3NTPA 5HUAA 1JNEA 3UQIA 2F2DA 3JXVA 4FN2A 2RUCA 4ODNA 3VAWA 4DRJA 4LAYA 1R9HA 2O92A 3ARWA 4MNMA 1GPFA 3G6MA 1TCOC 1NWSA 3NI6A 3KABA 4ODPA 4UDMA 1L1PA 2DG3A 2JX8A 1EHNA 3M7NA 4HBOA 1GUVA 4ODLA 5E5WA 3WQWA 2YBUA 1ZBKA 3W4RA 5I98A 2M2AA 1FKLA 1J4HA 4GLXA 2RURA 4G50A 3RGCA 1P5QA 1E6ZA 3G6LA 3PRAA 3CGMA 2XP8A 1SYTA 2DG4A 2JXWA 3WL1A 1UR9A 4ODQA 1K9TA 1W1VA 1EQ3A 3WL0A 3IK8A 1JMQA 4ODMA 1F40A 5B8IC 3CHEA 4DWSB 2L4JA 1D7JA 4FAPA 1ROTA 4TW7A 4W9OA 4DRQA 3KAIA 1C9HA 2F21A 1N1AA
chains in the Genus database with same CATH topology
2DSWA 1WNOA 5HTGA 2MLXA 4DRPA 2A3BA 1TFVA 1NWUA 3GPKA 4JFJA 1W1TA 3IKDA 1WAWA 4W9PA 1YW5A 1RD6A 1ZK6A 1ROUA 1E6PA 1M5YA 3ALFA 3ARPA 2WM0A 4AY1A 3O5FA 3B7XA 2VCDA 1Q6UA 2F4EA 1ZB5A 4DZ3A 1LG1A 3ARTA 3IKGA 4DRKA 1ITXA 2KXQA 2A3AA 3QOKA 1TK7A 2XP3A 4DZ2A 4XAKA 3KAHA 1CTNA 2YSHA 1J4RA 3O5OA 1JNDA 3CHFA 4A0TA 4HARA 3CHDA 1FKIA 2E45A 3WKZA 4ZPWR 5DEZA 2WADA 3O5LA 1JNSA 2YSFA 4MNKA 2KR7A 1X6LA 5AHTA 3B8SA 2DSUA 4DWSA 1KT0A 4WKAA 3TDBA 4QIBA 1W9UA 3FSCA 1NSGA 2FKEA 1EG4A 1B6CA 4W5UA 2FAPA 1PBKA 3ARYA 4IQCA 2G8ZA 4Z2HA 3RMEA 2ZQTA 4NSBA 4DWSD 1H0GA 2DT0A 5GPGA 2DK1A 2G41A 2MPHA 3NRKA 4Z2KA 2M1IA 3L4HA 1W26A 3KZ7A 1FFQA 3LE4A 1I5HW 2LKNA 1FKSA 3FS8A 5CQ2A 3EY6A 1LL7A 3CNGA 1D7IA 1W9VA 4TW6A 2DSVA 2RUQA 3WD2A 4Q7NA 4Z2IA 5BXJA 2M08A 3O5PA 4JFMA 4BF8A 4DIPA 4Z2JA 4J4OA 4LAVA 4PTMA 4MPKA 4ZPTR 2ZR5A 2YSGA 1K9QA 3O5IA 2PPOA 3JYJA 1LL4A 3WD0A 3KADA 1BL4A 2DK7A 3ARQA 2L2SA 4MTVA 2YSBA 1D2KA 5E66A 3AQUA 1OWQA 2DT1A 4MNJA 5HW7A 1KFWA 5JH8A 1FKDA 2Y8NB 1A7XA 4O2TA 3CZ8A 5U47A 3O5KA 1J4IA 4A0UA 2RE3A 1FKHA 5HBFA 3ARUA 1VF8A 1WR7A 4DRHA 1ZCNA 4IQ2A 2KFWA 2KGJA 2DJYA 2XP7A 1E9LA 1HKIA 3UQAA 3UF8A 3AS2A 1Y0OA 3TC5A 1NH6A 2OFNA 1FKTA 4DH0A 1EYMA 3CGNA 3FAPA 4KQZA 2A3EA 1ZBCA 2XP6A 1ZBWA 4P8WA 4ODKA 3CH9A 4W9QA 4ITZA 4ODRA 2LJ4A 2LGOA 4WK9A 4U86A 3FXYA 1FFRA 2PV2A 3LKXB 4TX0A 4JFIA 3BXWA 2B31A 3WH0A 3IHZA 2PPPA 1Q6IA 1W9PA 1W1YA 4Z2LA 4NZCA 1IX5A 3O5GA 1FKGA 3O5DA 3PRBA 5DIUA 2XP5A 4DROA 2N87A 2OWOA 1FLCA 4DT4A 1ZU8A 2IUZA 2KO7A 4HBEA 4ZPVR 1TR8A 4TW8A 3RM8A 1X6NA 5DITA 5HW8A 4DWSC 4U85A 1GOIA 2ESCA 1EDQA 1NWRA 3AROA 2RUDA 1EG3A 4C02B 1HJVA 4R5EA 1NMVA 2PV3A 3AS1A 4DRNA 5HW6A 4WKFA 2PI6A 1HJWA 2MF9A 1SR0A 3O5JA 2XP9A 4P8UA 2XPAA 4ZS6A 2UZ5A 4ML4A 2DPEA 2WK2A 5E64A 1FJDA 1OGGA 5HKGA 4WKHA 4Q22A 5DF0A 2RSEA 3KACA 1NWTA 2ZR6A 4E5RA 1Q1CA 1FKBA 4QT3A 2ZQVA 2AWGA 1Q6HA 3AS0A 4JFKA 1XHGA 2K8IA 1XRVA 3ODKA 3LKXA 2AOSA 2DT2A 4MSPA 1PINA 3UI6A 1NMWA 2KI3A 2Y78A 1K9RA 1FKKA 2MDIA 1E15A 3PRDA 2DG9A 1EIBA 4KR0B 3OOBA 4R0XA 5DIVA 3ARZA 2VN1A 4DRMA 5HWBA 2WAEA 2Q5AA 1QZ2A 3JYMA 4DRIA 5J6EA 2YAJB 4IT4A 2QF8A 3OA5A 4GGQA 1JNTA 4G2PA 3O5MA 1E6NA 1T11A 5DO2A 3H9RB 2M8IA 4P8XA 3O5RA 2ZQSA 3PR9A 4U84A 3CHCA 3WD4A 2XPBA 4IT6A 4TNSA 4IPXA 4URIA 2ITKA 4L3NA 2PPNA 3PA7A 2WLZA 2ZR4A 5D75A 1BKFA 1WB0A 3UQBA 2A3CA 5HT1A 5E65A 3UI4A 2YBTA 3LUOA 1RP5A 3O5QA 2LAJA 4P8VA 1QPLA 4WIWA 5HWCA 3WD3A 2DWVA 3PQHA 2D9FA 1QPFA 3ALGA 3KCEA 4MGVA 3MCBB 4MAVA 3M85A 1WMVA 1E6RA 2OLHA 4REXA 4MNLA 2RQSA 1D7HA 2MLZA 2XP4A 1ZBVA 3ARRA 1O6IA 1FAPA 1LQ0A 1F8AB 1HKJA 2LPVA 2DMVA 1FKFA 3B9AA 1YATA 2M8JA 2DT3A 3FY1A 5GPRA 2MNTA 3WD1A 1FD9A 2MLYA 1LL6A 1HKMA 2KE0A 2EZ5W 2FDMA 3RFWA 1W1PA 2O9OA 2PV1A 3ARVA 4NNRA 4QT2A 1JVWA 1LJYA 2WLYA 1FKRA 1LG2A 4TYOA 3FSBA 4ODOA 1HXVA 3MDYB 3RM9A 2ZQUA 4LAXA 1UR8A 1HKKA 3RM4A 4Z2GA 3ARSA 4LGXA 2IF4A 3B9DA 2BA1A 2M3OW 2JZVA 4S3JA 4JYSA 4GIVA 3MQHA 3KAGA 5GQBA 3UI5A 1KT1A 3WIJA 4S3KA 1ZL1A 2QRVA 1J6YA 4L72B 2JMFA 4J4NA 2JV4A 3I6CA 2ZAJA 1OGBA 3O5EA 3MCBA 1HJXA 1FKJA 3AS3A 4WJXA 4N19A 3MQGA 5E62A 2PBCA 1D6OA 1O6WA 4QZVB 3TCZA 2DSZA 3ARXA 3B9EA 4LAWA 1H0IA 3WQVA 2YSIA 3KAFA 1U79A 4JFLA 3NTPA 5HUAA 1JNEA 3UQIA 2F2DA 3JXVA 4FN2A 2RUCA 4ODNA 3VAWA 4DRJA 4LAYA 1R9HA 2O92A 3ARWA 4MNMA 1GPFA 3G6MA 1TCOC 1NWSA 3NI6A 3KABA 4ODPA 1L1PA 2DG3A 2JX8A 1EHNA 3M7NA 4HBOA 1GUVA 4ODLA 5E5WA 3WQWA 2YBUA 1ZBKA 3W4RA 5I98A 2M2AA 1FKLA 1J4HA 4GLXA 2RURA 4G50A 3RGCA 1P5QA 1E6ZA 3G6LA 3PRAA 3CGMA 2XP8A 1SYTA 2DG4A 2JXWA 3WL1A 1UR9A 4ODQA 1K9TA 1W1VA 1EQ3A 3WL0A 3IK8A 1JMQA 4ODMA 1F40A 5B8IC 3CHEA 4DWSB 2L4JA 1D7JA 4FAPA 1ROTA 4TW7A 4W9OA 4DRQA 3KAIA 1C9HA 2F21A 1N1AA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5HTG A;  2MLX A;  4DRP A;  3GPK A;  4JFJ A;  3IKD A;  4W9P A;  1YW5 A;  1ZK6 A;  1ROU A;  1M5Y A;  3O5F A;  3B7X A;  2VCD A;  1Q6U A;  2F4E A;  4DZ3 A;  3IKG A;  4DRK A;  2KXQ A;  1TK7 A;  2XP3 A;  4DZ2 A;  3KAH A;  2YSH A;  1J4R A;  3O5O A;  1FKI A;  2E45 A;  3O5L A;  1JNS A;  2YSF A;  2KR7 A;  5AHT A;  1KT0 A;  3TDB A;  4QIB A;  1NSG A;  2FKE A;  1EG4 A;  1B6C A;  2FAP A;  1PBK A;  4IQC A;  2ZQT A;  5GPG A;  2DK1 A;  2MPH A;  3NRK A;  2M1I A;  3L4H A;  1W26 A;  3KZ7 A;  3LE4 A;  1I5H W;  2LKN A;  1FKS A;  5CQ2 A;  3EY6 A;  3CNG A;  1D7I A;  4TW6 A;  2RUQ A;  5BXJ A;  2M08 A;  3O5P A;  4JFM A;  4BF8 A;  4DIP A;  4J4O A;  4LAV A;  2ZR5 A;  2YSG A;  1K9Q A;  3O5I A;  2PPO A;  3JYJ A;  3KAD A;  1BL4 A;  2DK7 A;  2L2S A;  2YSB A;  5HW7 A;  1FKD A;  1A7X A;  4O2T A;  3O5K A;  1J4I A;  2RE3 A;  1FKH A;  1WR7 A;  4DRH A;  1ZCN A;  4IQ2 A;  2KFW A;  2KGJ A;  2DJY A;  2XP7 A;  3UQA A;  3UF8 A;  1Y0O A;  3TC5 A;  2OFN A;  1FKT A;  4DH0 A;  1EYM A;  3CGN A;  3FAP A;  2XP6 A;  4ODK A;  4W9Q A;  4ITZ A;  4ODR A;  2LJ4 A;  2LGO A;  4U86 A;  2PV2 A;  4TX0 A;  4JFI A;  3WH0 A;  3IHZ A;  2PPP A;  1Q6I A;  3O5G A;  1FKG A;  3O5D A;  3PRB A;  5DIU A;  2XP5 A;  4DRO A;  2N87 A;  4DT4 A;  2KO7 A;  4TW8 A;  5DIT A;  5HW8 A;  4U85 A;  2RUD A;  1EG3 A;  4C02 B;  1NMV A;  2PV3 A;  4DRN A;  5HW6 A;  2MF9 A;  3O5J A;  2XP9 A;  2XPA A;  2UZ5 A;  1FJD A;  5HKG A;  2RSE A;  3KAC A;  2ZR6 A;  4E5R A;  1Q1C A;  1FKB A;  4QT3 A;  2ZQV A;  2AWG A;  1Q6H A;  4JFK A;  2K8I A;  4MSP A;  3ODK A;  1PIN A;  3UI6 A;  1NMW A;  2KI3 A;  2Y78 A;  1K9R A;  1FKK A;  2MDI A;  3PRD A;  2DG9 A;  3OOB A;  4R0X A;  5DIV A;  4DRM A;  2VN1 A;  5HWB A;  2Q5A A;  1QZ2 A;  3JYM A;  4DRI A;  5J6E A;  4GGQ A;  1JNT A;  4G2P A;  3O5M A;  1T11 A;  3H9R B;  2M8I A;  3O5R A;  2ZQS A;  4U84 A;  2XPB A;  4TNS A;  4IPX A;  2ITK A;  2PPN A;  3PA7 A;  2ZR4 A;  5D75 A;  1BKF A;  3UQB A;  5HT1 A;  3UI4 A;  3LUO A;  3O5Q A;  2LAJ A;  1QPL A;  5HWC A;  2DWV A;  2D9F A;  1QPF A;  3KCE A;  4MGV A;  3M85 A;  1WMV A;  4REX A;  2RQS A;  1D7H A;  2MLZ A;  2XP4 A;  1FAP A;  1F8A B;  2LPV A;  2DMV A;  1FKF A;  1YAT A;  2M8J A;  2MNT A;  1FD9 A;  2MLY A;  2KE0 A;  2EZ5 W;  3RFW A;  2PV1 A;  4NNR A;  4QT2 A;  1JVW A;  1FKR A;  4TYO A;  4ODO A;  1HXV A;  3MDY B;  2ZQU A;  4LAX A;  2IF4 A;  2BA1 A;  2M3O W;  2JZV A;  4JYS A;  4GIV A;  3KAG A;  3UI5 A;  1KT1 A;  1J6Y A;  2JMF A;  4J4N A;  2JV4 A;  3I6C A;  2ZAJ A;  3O5E A;  1FKJ A;  4N19 A;  2PBC A;  1D6O A;  1O6W A;  3TCZ A;  4LAW A;  2YSI A;  3KAF A;  1U79 A;  4JFL A;  3NTP A;  5HUA A;  3UQI A;  2F2D A;  3JXV A;  4FN2 A;  2RUC A;  4ODN A;  3VAW A;  4DRJ A;  4LAY A;  1R9H A;  1TCO C;  3NI6 A;  3KAB A;  4ODP A;  1L1P A;  2DG3 A;  2JX8 A;  3M7N A;  4ODL A;  5I98 A;  2M2A A;  1FKL A;  1J4H A;  2RUR A;  4G50 A;  3RGC A;  1P5Q A;  3CGM A;  2XP8 A;  2DG4 A;  2JXW A;  4ODQ A;  1EQ3 A;  3IK8 A;  1JMQ A;  4ODM A;  1F40 A;  5B8I C;  2L4J A;  1D7J A;  4FAP A;  1ROT A;  4TW7 A;  4W9O A;  4DRQ A;  3KAI A;  1C9H A;  2F21 A;  1N1A A; 
#chains in the Genus database with same CATH topology
 2DSW A;  1WNO A;  5HTG A;  2MLX A;  4DRP A;  2A3B A;  1TFV A;  1NWU A;  3GPK A;  4JFJ A;  1W1T A;  3IKD A;  1WAW A;  4W9P A;  1YW5 A;  1RD6 A;  1ZK6 A;  1ROU A;  1E6P A;  1M5Y A;  3ALF A;  3ARP A;  2WM0 A;  4AY1 A;  3O5F A;  2F23 A;  3B7X A;  2VCD A;  1Q6U A;  2B5U B;  2F4E A;  1ZB5 A;  4DZ3 A;  1LG1 A;  3ART A;  3IKG A;  4DRK A;  1ITX A;  2KXQ A;  2A3A A;  3QOK A;  1TK7 A;  2XP3 A;  4DZ2 A;  4XAK A;  3KAH A;  1CTN A;  2YSH A;  1J4R A;  3O5O A;  1JND A;  3CHF A;  4A0T A;  4HAR A;  3CHD A;  1FKI A;  2E45 A;  3WKZ A;  4ZPW R;  5DEZ A;  2WAD A;  3O5L A;  1JNS A;  2YSF A;  4MNK A;  2KR7 A;  1X6L A;  5AHT A;  3B8S A;  2DSU A;  4DWS A;  1KT0 A;  4WKA A;  3TDB A;  4QIB A;  1W9U A;  3FSC A;  1NSG A;  2FKE A;  1EG4 A;  1B6C A;  4W5U A;  2FAP A;  1PBK A;  3ARY A;  4IQC A;  2G8Z A;  4Z2H A;  3RME A;  2ZQT A;  4NSB A;  4DWS D;  1H0G A;  2DT0 A;  5GPG A;  2DK1 A;  2G41 A;  2MPH A;  3NRK A;  4Z2K A;  2M1I A;  3L4H A;  1W26 A;  3KZ7 A;  1FFQ A;  3LE4 A;  1I5H W;  2LKN A;  1FKS A;  3FS8 A;  5CQ2 A;  3EY6 A;  1LL7 A;  3CNG A;  1D7I A;  1E44 A;  1W9V A;  4TW6 A;  2DSV A;  2RUQ A;  3WD2 A;  4Q7N A;  4Z2I A;  5BXJ A;  2M08 A;  3O5P A;  4JFM A;  4BF8 A;  4DIP A;  4Z2J A;  4J4O A;  4LAV A;  4PTM A;  4MPK A;  4ZPT R;  2ZR5 A;  2YSG A;  1K9Q A;  3O5I A;  2PPO A;  3JYJ A;  1LL4 A;  3WD0 A;  3KAD A;  1BL4 A;  1GRJ A;  2DK7 A;  3ARQ A;  2L2S A;  4MTV A;  2YSB A;  1D2K A;  5E66 A;  3AQU A;  1OWQ A;  2DT1 A;  4MNJ A;  5HW7 A;  1KFW A;  5JH8 A;  1FKD A;  2Y8N B;  1A7X A;  4O2T A;  3CZ8 A;  5U47 A;  3O5K A;  1J4I A;  4A0U A;  2RE3 A;  1FKH A;  5HBF A;  3ARU A;  1VF8 A;  1WR7 A;  4DRH A;  1ZCN A;  4IQ2 A;  3GTY X;  2KFW A;  2KGJ A;  2DJY A;  2XP7 A;  1E9L A;  1HKI A;  3UQA A;  3UF8 A;  3AS2 A;  1Y0O A;  3TC5 A;  1NH6 A;  2OFN A;  1FKT A;  4DH0 A;  1EYM A;  3CGN A;  3GU0 A;  3FAP A;  4KQZ A;  2A3E A;  1ZBC A;  2XP6 A;  1ZBW A;  4P8W A;  4ODK A;  3CH9 A;  4W9Q A;  4ITZ A;  4ODR A;  2LJ4 A;  2LGO A;  4WK9 A;  4U86 A;  3FXY A;  1FFR A;  2PV2 A;  3LKX B;  4TX0 A;  4JFI A;  3BXW A;  2B31 A;  3WH0 A;  3IHZ A;  2PPP A;  1Q6I A;  1W9P A;  1W1Y A;  4Z2L A;  2P4V A;  4NZC A;  1IX5 A;  3O5G A;  1FKG A;  3O5D A;  3PRB A;  5DIU A;  2XP5 A;  4DRO A;  2N87 A;  2OWO A;  1FLC A;  3EIP A;  4DT4 A;  1ZU8 A;  2IUZ A;  2KO7 A;  4HBE A;  4ZPV R;  1TR8 A;  4TW8 A;  3RM8 A;  1X6N A;  5DIT A;  5HW8 A;  4DWS C;  4U85 A;  1GOI A;  2ESC A;  1EDQ A;  1NWR A;  3ARO A;  2RUD A;  1EG3 A;  4C02 B;  1HJV A;  4R5E A;  1NMV A;  2PV3 A;  3AS1 A;  4DRN A;  5HW6 A;  4WKF A;  2PI6 A;  1HJW A;  2MF9 A;  1SR0 A;  3O5J A;  2XP9 A;  4P8U A;  2XPA A;  4ZS6 A;  2UZ5 A;  4ML4 A;  2DPE A;  2WK2 A;  5E64 A;  1FJD A;  1OGG A;  5HKG A;  4WKH A;  4Q22 A;  5DF0 A;  2RSE A;  3KAC A;  1NWT A;  3BMB A;  2ZR6 A;  4E5R A;  1Q1C A;  1FKB A;  4QT3 A;  2ZQV A;  2AWG A;  1Q6H A;  3AS0 A;  4JFK A;  1XHG A;  2K8I A;  1XRV A;  3ODK A;  3LKX A;  2AOS A;  2DT2 A;  4MSP A;  1PIN A;  3UI6 A;  1NMW A;  2KI3 A;  2EUL A;  2Y78 A;  1K9R A;  1FKK A;  2MDI A;  1E15 A;  3PRD A;  2DG9 A;  1EIB A;  4KR0 B;  3OOB A;  4R0X A;  5DIV A;  3ARZ A;  2VN1 A;  4DRM A;  5HWB A;  2WAE A;  2Q5A A;  1QZ2 A;  3JYM A;  4DRI A;  5J6E A;  2YAJ B;  4IT4 A;  2QF8 A;  3OA5 A;  4GGQ A;  1JNT A;  4G2P A;  3O5M A;  1E6N A;  1T11 A;  5DO2 A;  3H9R B;  2M8I A;  4P8X A;  2PN0 A;  3O5R A;  2ZQS A;  3PR9 A;  4U84 A;  3CHC A;  3WD4 A;  2XPB A;  4IT6 A;  4TNS A;  4IPX A;  4URI A;  2ITK A;  4L3N A;  2PPN A;  3PA7 A;  2WLZ A;  2ZR4 A;  5D75 A;  1BKF A;  1WB0 A;  3UQB A;  2A3C A;  5HT1 A;  5E65 A;  3UI4 A;  2YBT A;  3LUO A;  1RP5 A;  3O5Q A;  2LAJ A;  4P8V A;  1QPL A;  4WIW A;  5HWC A;  3WD3 A;  2DWV A;  3PQH A;  2D9F A;  1QPF A;  3ALG A;  3KCE A;  4MGV A;  3MCB B;  4MAV A;  3M85 A;  1WMV A;  1E6R A;  2OLH A;  4REX A;  4MNL A;  2RQS A;  1D7H A;  2MLZ A;  2XP4 A;  1ZBV A;  3ARR A;  2ETN A;  1O6I A;  1JCH B;  1FAP A;  1LQ0 A;  1F8A B;  1HKJ A;  2LPV A;  2DMV A;  1FKF A;  3B9A A;  1YAT A;  2M8J A;  2DT3 A;  3FY1 A;  5GPR A;  2MNT A;  3WD1 A;  1FD9 A;  2MLY A;  1LL6 A;  1HKM A;  2KE0 A;  2EZ5 W;  2FDM A;  3RFW A;  1W1P A;  2O9O A;  2PV1 A;  3ARV A;  4NNR A;  4QT2 A;  1JVW A;  1LJY A;  2WLY A;  1FKR A;  1LG2 A;  4TYO A;  3FSB A;  4ODO A;  1HXV A;  3MDY B;  3RM9 A;  2ZQU A;  4LAX A;  1UR8 A;  1HKK A;  3RM4 A;  4Z2G A;  3ARS A;  4LGX A;  2IF4 A;  3B9D A;  2BA1 A;  2M3O W;  2JZV A;  4S3J A;  4JYS A;  4GIV A;  3MQH A;  3KAG A;  5GQB A;  3UI5 A;  1KT1 A;  3WIJ A;  4S3K A;  1ZL1 A;  2QRV A;  1J6Y A;  4L72 B;  2JMF A;  4J4N A;  2JV4 A;  3I6C A;  2ZAJ A;  1OGB A;  3O5E A;  3MCB A;  1HJX A;  1FKJ A;  3AS3 A;  4WJX A;  4N19 A;  3MQG A;  5E62 A;  2PBC A;  1D6O A;  1O6W A;  4QZV B;  3TCZ A;  2DSZ A;  3ARX A;  3B9E A;  4LAW A;  1H0I A;  3WQV A;  2YSI A;  3KAF A;  1U79 A;  4JFL A;  3NTP A;  5HUA A;  1JNE A;  3UQI A;  2F2D A;  3JXV A;  4FN2 A;  2RUC A;  4ODN A;  3VAW A;  4DRJ A;  4LAY A;  1R9H A;  2O92 A;  3ARW A;  4MNM A;  1GPF A;  3G6M A;  1TCO C;  1NWS A;  3NI6 A;  3KAB A;  4ODP A;  4UDM A;  1L1P A;  2DG3 A;  2JX8 A;  1EHN A;  3M7N A;  4HBO A;  1GUV A;  4ODL A;  5E5W A;  3WQW A;  2YBU A;  1ZBK A;  3W4R A;  5I98 A;  2M2A A;  1FKL A;  1J4H A;  4GLX A;  2RUR A;  4G50 A;  3RGC A;  1P5Q A;  1E6Z A;  3G6L A;  3PRA A;  3CGM A;  2XP8 A;  1SYT A;  2DG4 A;  2JXW A;  3WL1 A;  1UR9 A;  4ODQ A;  1K9T A;  1W1V A;  1EQ3 A;  3WL0 A;  3IK8 A;  1JMQ A;  4ODM A;  1F40 A;  5B8I C;  3CHE A;  4DWS B;  2L4J A;  1D7J A;  4FAP A;  1ROT A;  4TW7 A;  4W9O A;  4DRQ A;  3KAI A;  1C9H A;  2F21 A;  1N1A A; 
#chains in the Genus database with same CATH homology
 2DSW A;  1WNO A;  5HTG A;  2MLX A;  4DRP A;  2A3B A;  1TFV A;  1NWU A;  3GPK A;  4JFJ A;  1W1T A;  3IKD A;  1WAW A;  4W9P A;  1YW5 A;  1RD6 A;  1ZK6 A;  1ROU A;  1E6P A;  1M5Y A;  3ALF A;  3ARP A;  2WM0 A;  4AY1 A;  3O5F A;  3B7X A;  2VCD A;  1Q6U A;  2F4E A;  1ZB5 A;  4DZ3 A;  1LG1 A;  3ART A;  3IKG A;  4DRK A;  1ITX A;  2KXQ A;  2A3A A;  3QOK A;  1TK7 A;  2XP3 A;  4DZ2 A;  4XAK A;  3KAH A;  1CTN A;  2YSH A;  1J4R A;  3O5O A;  1JND A;  3CHF A;  4A0T A;  4HAR A;  3CHD A;  1FKI A;  2E45 A;  3WKZ A;  4ZPW R;  5DEZ A;  2WAD A;  3O5L A;  1JNS A;  2YSF A;  4MNK A;  2KR7 A;  1X6L A;  5AHT A;  3B8S A;  2DSU A;  4DWS A;  1KT0 A;  4WKA A;  3TDB A;  4QIB A;  1W9U A;  3FSC A;  1NSG A;  2FKE A;  1EG4 A;  1B6C A;  4W5U A;  2FAP A;  1PBK A;  3ARY A;  4IQC A;  2G8Z A;  4Z2H A;  3RME A;  2ZQT A;  4NSB A;  4DWS D;  1H0G A;  2DT0 A;  5GPG A;  2DK1 A;  2G41 A;  2MPH A;  3NRK A;  4Z2K A;  2M1I A;  3L4H A;  1W26 A;  3KZ7 A;  1FFQ A;  3LE4 A;  1I5H W;  2LKN A;  1FKS A;  3FS8 A;  5CQ2 A;  3EY6 A;  1LL7 A;  3CNG A;  1D7I A;  1W9V A;  4TW6 A;  2DSV A;  2RUQ A;  3WD2 A;  4Q7N A;  4Z2I A;  5BXJ A;  2M08 A;  3O5P A;  4JFM A;  4BF8 A;  4DIP A;  4Z2J A;  4J4O A;  4LAV A;  4PTM A;  4MPK A;  4ZPT R;  2ZR5 A;  2YSG A;  1K9Q A;  3O5I A;  2PPO A;  3JYJ A;  1LL4 A;  3WD0 A;  3KAD A;  1BL4 A;  2DK7 A;  3ARQ A;  2L2S A;  4MTV A;  2YSB A;  1D2K A;  5E66 A;  3AQU A;  1OWQ A;  2DT1 A;  4MNJ A;  5HW7 A;  1KFW A;  5JH8 A;  1FKD A;  2Y8N B;  1A7X A;  4O2T A;  3CZ8 A;  5U47 A;  3O5K A;  1J4I A;  4A0U A;  2RE3 A;  1FKH A;  5HBF A;  3ARU A;  1VF8 A;  1WR7 A;  4DRH A;  1ZCN A;  4IQ2 A;  2KFW A;  2KGJ A;  2DJY A;  2XP7 A;  1E9L A;  1HKI A;  3UQA A;  3UF8 A;  3AS2 A;  1Y0O A;  3TC5 A;  1NH6 A;  2OFN A;  1FKT A;  4DH0 A;  1EYM A;  3CGN A;  3FAP A;  4KQZ A;  2A3E A;  1ZBC A;  2XP6 A;  1ZBW A;  4P8W A;  4ODK A;  3CH9 A;  4W9Q A;  4ITZ A;  4ODR A;  2LJ4 A;  2LGO A;  4WK9 A;  4U86 A;  3FXY A;  1FFR A;  2PV2 A;  3LKX B;  4TX0 A;  4JFI A;  3BXW A;  2B31 A;  3WH0 A;  3IHZ A;  2PPP A;  1Q6I A;  1W9P A;  1W1Y A;  4Z2L A;  4NZC A;  1IX5 A;  3O5G A;  1FKG A;  3O5D A;  3PRB A;  5DIU A;  2XP5 A;  4DRO A;  2N87 A;  2OWO A;  1FLC A;  4DT4 A;  1ZU8 A;  2IUZ A;  2KO7 A;  4HBE A;  4ZPV R;  1TR8 A;  4TW8 A;  3RM8 A;  1X6N A;  5DIT A;  5HW8 A;  4DWS C;  4U85 A;  1GOI A;  2ESC A;  1EDQ A;  1NWR A;  3ARO A;  2RUD A;  1EG3 A;  4C02 B;  1HJV A;  4R5E A;  1NMV A;  2PV3 A;  3AS1 A;  4DRN A;  5HW6 A;  4WKF A;  2PI6 A;  1HJW A;  2MF9 A;  1SR0 A;  3O5J A;  2XP9 A;  4P8U A;  2XPA A;  4ZS6 A;  2UZ5 A;  4ML4 A;  2DPE A;  2WK2 A;  5E64 A;  1FJD A;  1OGG A;  5HKG A;  4WKH A;  4Q22 A;  5DF0 A;  2RSE A;  3KAC A;  1NWT A;  2ZR6 A;  4E5R A;  1Q1C A;  1FKB A;  4QT3 A;  2ZQV A;  2AWG A;  1Q6H A;  3AS0 A;  4JFK A;  1XHG A;  2K8I A;  1XRV A;  3ODK A;  3LKX A;  2AOS A;  2DT2 A;  4MSP A;  1PIN A;  3UI6 A;  1NMW A;  2KI3 A;  2Y78 A;  1K9R A;  1FKK A;  2MDI A;  1E15 A;  3PRD A;  2DG9 A;  1EIB A;  4KR0 B;  3OOB A;  4R0X A;  5DIV A;  3ARZ A;  2VN1 A;  4DRM A;  5HWB A;  2WAE A;  2Q5A A;  1QZ2 A;  3JYM A;  4DRI A;  5J6E A;  2YAJ B;  4IT4 A;  2QF8 A;  3OA5 A;  4GGQ A;  1JNT A;  4G2P A;  3O5M A;  1E6N A;  1T11 A;  5DO2 A;  3H9R B;  2M8I A;  4P8X A;  3O5R A;  2ZQS A;  3PR9 A;  4U84 A;  3CHC A;  3WD4 A;  2XPB A;  4IT6 A;  4TNS A;  4IPX A;  4URI A;  2ITK A;  4L3N A;  2PPN A;  3PA7 A;  2WLZ A;  2ZR4 A;  5D75 A;  1BKF A;  1WB0 A;  3UQB A;  2A3C A;  5HT1 A;  5E65 A;  3UI4 A;  2YBT A;  3LUO A;  1RP5 A;  3O5Q A;  2LAJ A;  4P8V A;  1QPL A;  4WIW A;  5HWC A;  3WD3 A;  2DWV A;  3PQH A;  2D9F A;  1QPF A;  3ALG A;  3KCE A;  4MGV A;  3MCB B;  4MAV A;  3M85 A;  1WMV A;  1E6R A;  2OLH A;  4REX A;  4MNL A;  2RQS A;  1D7H A;  2MLZ A;  2XP4 A;  1ZBV A;  3ARR A;  1O6I A;  1FAP A;  1LQ0 A;  1F8A B;  1HKJ A;  2LPV A;  2DMV A;  1FKF A;  3B9A A;  1YAT A;  2M8J A;  2DT3 A;  3FY1 A;  5GPR A;  2MNT A;  3WD1 A;  1FD9 A;  2MLY A;  1LL6 A;  1HKM A;  2KE0 A;  2EZ5 W;  2FDM A;  3RFW A;  1W1P A;  2O9O A;  2PV1 A;  3ARV A;  4NNR A;  4QT2 A;  1JVW A;  1LJY A;  2WLY A;  1FKR A;  1LG2 A;  4TYO A;  3FSB A;  4ODO A;  1HXV A;  3MDY B;  3RM9 A;  2ZQU A;  4LAX A;  1UR8 A;  1HKK A;  3RM4 A;  4Z2G A;  3ARS A;  4LGX A;  2IF4 A;  3B9D A;  2BA1 A;  2M3O W;  2JZV A;  4S3J A;  4JYS A;  4GIV A;  3MQH A;  3KAG A;  5GQB A;  3UI5 A;  1KT1 A;  3WIJ A;  4S3K A;  1ZL1 A;  2QRV A;  1J6Y A;  4L72 B;  2JMF A;  4J4N A;  2JV4 A;  3I6C A;  2ZAJ A;  1OGB A;  3O5E A;  3MCB A;  1HJX A;  1FKJ A;  3AS3 A;  4WJX A;  4N19 A;  3MQG A;  5E62 A;  2PBC A;  1D6O A;  1O6W A;  4QZV B;  3TCZ A;  2DSZ A;  3ARX A;  3B9E A;  4LAW A;  1H0I A;  3WQV A;  2YSI A;  3KAF A;  1U79 A;  4JFL A;  3NTP A;  5HUA A;  1JNE A;  3UQI A;  2F2D A;  3JXV A;  4FN2 A;  2RUC A;  4ODN A;  3VAW A;  4DRJ A;  4LAY A;  1R9H A;  2O92 A;  3ARW A;  4MNM A;  1GPF A;  3G6M A;  1TCO C;  1NWS A;  3NI6 A;  3KAB A;  4ODP A;  1L1P A;  2DG3 A;  2JX8 A;  1EHN A;  3M7N A;  4HBO A;  1GUV A;  4ODL A;  5E5W A;  3WQW A;  2YBU A;  1ZBK A;  3W4R A;  5I98 A;  2M2A A;  1FKL A;  1J4H A;  4GLX A;  2RUR A;  4G50 A;  3RGC A;  1P5Q A;  1E6Z A;  3G6L A;  3PRA A;  3CGM A;  2XP8 A;  1SYT A;  2DG4 A;  2JXW A;  3WL1 A;  1UR9 A;  4ODQ A;  1K9T A;  1W1V A;  1EQ3 A;  3WL0 A;  3IK8 A;  1JMQ A;  4ODM A;  1F40 A;  5B8I C;  3CHE A;  4DWS B;  2L4J A;  1D7J A;  4FAP A;  1ROT A;  4TW7 A;  4W9O A;  4DRQ A;  3KAI A;  1C9H A;  2F21 A;  1N1A A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...