4U85A

Human pin1 with cysteine sulfinic acid 113
Total Genus 46
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
46
sequence length
157
structure length
144
Chain Sequence
LPPGWEKAMSRSSGRVYYFNHITNASQWERPSEPARVRCSHLLVKHSQSRRPSSWRQEKITRTKEEALELINGYIQKIKSGEEDFESLASQFSDSSAKARGDLGAFSRGQMQKPFEDASFALRTGEMSGPVFTDSGIHIILRTE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Pin1 cysteine-113 oxidation inhibits its catalytic activity and cellular function in Alzheimer's disease.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Isomerase
molecule keywords Peptidyl-prolyl cis-trans isomerase NIMA-interacting 1
total genus 46
structure length 144
sequence length 157
ec nomenclature ec 5.2.1.8: Peptidylprolyl isomerase.
pdb deposition date 2014-08-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00397 WW WW domain
A PF00639 Rotamase PPIC-type PPIASE domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.20.70.10 Mainly Beta Single Sheet Ubiquitin Ligase Nedd4; Chain: W; Ubiquitin Ligase Nedd4; Chain: W; 4u85A01
3.10.50.40 Alpha Beta Roll Chitinase A; domain 3 Chitinase A; domain 3 4u85A02
4DRJA 2DG4A 1EYMA 3NTPA 2ZR5A 3M7NA 2MLZA 3KAIA 3TDBA 1P5QA 4W9QA 5HW7A 1WMVA 1Q1CA 2DG3A 5AHTA 1U79A 2PPNA 4LAVA 3O5OA 1YW5A 4QIBA 1D7IA 2ZQSA 3TC5A 3I6CA 4W9PA 4BF8A 3NI6A 2OFNA 4DRKA 1FKRA 1R9HA 1NMVA 3PA7A 4ODRA 1D6OA 3JYJA 4TX0A 1FAPA 3TCZA 3UQIA 2VCDA 2MPHA 3UI6A 2RURA 4ODOA 3JYMA 5I98A 2MDIA 2MLXA 1D7JA 1QZ2A 2L2SA 4IPXA 3RFWA 2E45A 1JNTA 4R0XA 2LGOA 1YATA 4U86A 4TW6A 1K9RA 2XP7A 3H9RB 2KR7A 2JXWA 1J6YA 1W26A 3KAHA 1PBKA 5HWCA 2KGJA 4LAYA 1EQ3A 2RUDA 1F40A 2LJ4A 3KACA 2DWVA 1FKBA 2UZ5A 5DITA 2JMFA 3JXVA 3O5IA 4N19A 3O5EA 1D7HA 4JFMA 4JYSA 1WR7A 5HW6A 2PV1A 2FAPA 4NNRA 4QT2A 3O5DA 2DMVA 2M8JA 2AWGA 1Q6UA 1ZK6A 1A7XA 1BL4A 2M08A 2ZQTA 4DRHA 2PBCA 4ITZA 4MSPA 2YSHA 4ODLA 1FKTA 3UQBA 4TW8A 1K9QA 1FD9A 1T11A 3ODKA 1NSGA 4DRQA 2DK1A 2PV2A 2MNTA 3KAGA 3IKGA 3UF8A 4DT4A 5J6EA 1Y0OA 4ODQA 1PINA 2K8IA 4JFLA 5DIVA 3WH0A 3KAFA 3O5LA 4DRIA 3UQAA 3CGNA 2M1IA 3CNGA 1FKKA 2DK7A 2EZ5W 3B7XA 1FKIA 2JV4A 4J4OA 2YSGA 2XPAA 3KADA 2D9FA 1FKSA 1C9HA 4ODKA 3LUOA 2Q5AA 2ZAJA 1Q6HA 3O5FA 4ODNA 4DRNA 2M8IA 2JZVA 2F4EA 2M2AA 3IHZA 1KT0A 4TYOA 4ODPA 2MLYA 4C02B 2ZR4A 1JVWA 2PV3A 4G2PA 2ITKA 1BKFA 2BA1A 2LKNA 4MGVA 3M85A 3MDYB 3KCEA 4JFIA 2ZQVA 1J4RA 1FKHA 1FKDA 3PRDA 1FKLA 3EY6A 4TW7A 5HKGA 4DRPA 1L1PA 2L4JA 3UI5A 5D75A 2XP6A 2IF4A 3O5KA 4DZ2A 4REXA 2JX8A 3KABA 3GPKA 2KO7A 2RSEA 4E5RA 1J4IA 2KXQA 2XP3A 1FKGA 3O5JA 4TNSA 1Q6IA 1FKJA 4DZ3A 5HUAA 1ROUA 1M5YA 1TCOC 4O2TA 3NRKA 3PRBA 2YSFA 1NMWA 4JFJA 2LAJA 1F8AB 1N1AA 4IQ2A 4U85A 2DG9A 2RUQA 2XP8A 2DJYA 2M3OW 4GIVA 4IQCA 4DH0A 1FJDA 4FAPA 1I5HW 2F2DA 4U84A 1JMQA 2RUCA 4FN2A 4J4NA 4LAWA 5HWBA 2XP4A 1O6WA 2XPBA 1JNSA 1B6CA 2LPVA 1J4HA 4DIPA 4JFKA 3IKDA 4DRMA 1FKFA 2PPOA 4DROA 1HXVA 5HW8A 2KFWA 2RE3A 2YSBA 4LAXA 3VAWA 3O5RA 2YSIA 1EG3A 1QPLA 2KI3A 3O5GA 3IK8A 5DIUA 1EG4A 2VN1A 3OOBA 2XP9A 5B8IC 2ZR6A 3L4HA 1QPFA 2KE0A 5BXJA 2RQSA 2PPPA 1KT1A 4GGQA 1ROTA 2MF9A 1ZCNA 3O5PA 2FKEA 4G50A 5GPGA 4ODMA 4W9OA 3KZ7A 2ZQUA 2N87A 3CGMA 3O5QA 4QT3A 5HT1A 3RGCA 3LE4A 2F21A 2Y78A 3UI4A 5HTGA 5CQ2A 3O5MA 2XP5A 1TK7A 3FAPA
chains in the Genus database with same CATH superfamily
3KAIA 4KQZA 4W9QA 2G8ZA 1Q1CA 2DG3A 1HJVA 2PN0A 4BF8A 1O6IA 4DRKA 1SYTA 5DF0A 1OGBA 3ARYA 4TX0A 2VCDA 3UI6A 2WLZA 2DPEA 4GLXA 1D7JA 1UR9A 2E45A 4R0XA 2Y8NB 1FLCA 1YATA 2B5UB 2KR7A 3H9RB 1E6ZA 1H0GA 1OGGA 1PBKA 2FDMA 4LAYA 2RUDA 5DITA 1FKBA 3O5IA 3O5EA 5HW6A 2OWOA 1W1TA 2AWGA 4DWSB 3MQGA 1A7XA 1BL4A 1ITXA 2OLHA 4MSPA 1HKIA 1FD9A 1NSGA 3WD1A 2DSZA 3UF8A 4P8UA 4ML4A 4JFLA 3WH0A 3KAFA 3GTYX 1ZBCA 1FKKA 2EZ5W 3B7XA 3CH9A 1FKIA 2D9FA 1FKSA 1ZBWA 3LUOA 5GQBA 3B9DA 4MPKA 2MLYA 3WIJA 1JVWA 4G2PA 2BA1A 3M85A 4IT4A 1FKDA 4TW7A 3EY6A 1W9UA 2DSWA 3AROA 2XP6A 3O5KA 4DZ2A 3KABA 3GPKA 1X6LA 2QRVA 1FKJA 1ROUA 3AS3A 4QZVB 3CHEA 4U85A 1NH6A 1EIBA 3CZ8A 2RUQA 4NZCA 1FJDA 4FAPA 1E6NA 1X6NA 2RUCA 1B6CA 4DIPA 1J4HA 4PTMA 4JFKA 4DROA 5GPRA 5HW8A 2KFWA 3OA5A 1LL4A 1GUVA 2WADA 3O5RA 2YSIA 3CHFA 5B8IC 2ZR6A 2KE0A 2PPPA 4GGQA 1NWRA 1ROTA 2MF9A 1ZCNA 2FKEA 2YBUA 3ALGA 2DT0A 4MAVA 2F21A 2LAJA 1EHNA 2DG4A 1EYMA 3NTPA 2ZR5A 3M7NA 1H0IA 2MLZA 5HW7A 1P5QA 2G41A 1WMVA 2YBTA 3FY1A 3TC5A 3B9AA 2DSVA 2OFNA 3PA7A 1GOIA 1HJXA 4A0TA 3JYJA 3TCZA 1XHGA 1WB0A 3JYMA 2MLXA 4IPXA 4L3NA 4KR0B 1ZB5A 4U86A 1W26A 5HWCA 1KFWA 2KGJA 1JCHB 2DWVA 2JMFA 3FXYA 4JYSA 1WR7A 3EIPA 2FAPA 3O5DA 2DSUA 3FSCA 4S3KA 2M08A 4DRHA 5E62A 2PBCA 3PQHA 3MCBA 4ODLA 5DEZA 2P4VA 4Z2GA 1T11A 4DRQA 2QF8A 2MNTA 3KAGA 4HBOA 3AQUA 5J6EA 5DIVA 1LL6A 1W1YA 1E44A 3W4RA 4WK9A 2M1IA 1TFVA 1LG1A 2JV4A 1ZL1A 1W9PA 4DWSD 1C9HA 4ZS6A 3O5FA 4ODNA 2M8IA 4UDMA 3IHZA 4ODPA 2ZR4A 5E66A 3WD0A 4P8WA 4WIWA 3WL0A 1FKHA 3PRDA 4Q22A 2L4JA 5D75A 4MTVA 4DWSC 3QOKA 5U47A 2KO7A 4LGXA 3RM4A 2KXQA 2AOSA 3WD3A 4DZ3A 3AS2A 1TCOC 4HBEA 4NSBA 1NWTA 4DWSA 2YSFA 1F8AB 4A0UA 2M3OW 4U84A 1JMQA 4FN2A 2PI6A 4LAWA 1O6WA 1UR8A 2XPBA 1ZBVA 2A3BA 2IUZA 2RE3A 3VAWA 3FSBA 1QPLA 2VN1A 2XP9A 1NWSA 3WD4A 1HKJA 1LQ0A 2DT1A 1KT1A 5JH8A 4URIA 3O5QA 4QT3A 3LE4A 3WQVA 2Y78A 3MCBB 3FAPA 4DRJA 1EQ3A 3FS8A 4WJXA 5AHTA 4MNKA 5E5WA 1U79A 2PPNA 4LAVA 3O5OA 1YW5A 3ARZA 1FKRA 4HARA 4ODRA 1D6OA 3UQIA 1FAPA 2WAEA 2MPHA 2RURA 1TR8A 3ARPA 3ARUA 5I98A 2B31A 2MDIA 3ARQA 3RFWA 3B9EA 1D2KA 3ARVA 1K9RA 2WLYA 4AY1A 2LJ4A 1SR0A 2DT2A 2UZ5A 1WAWA 1K9TA 1D7HA 2A3EA 4JFMA 4Q7NA 4QT2A 2M8JA 3ARXA 1LJYA 1ZK6A 1JNDA 2ZQTA 3ALFA 2F23A 1FKTA 1K9QA 3G6LA 1GPFA 2DK1A 3IKGA 2A3CA 4ODQA 4ZPTR 2DT3A 3UQAA 3CGNA 4P8XA 3CNGA 1ZBKA 2DK7A 4L72B 4J4OA 2XPAA 3KADA 4ODKA 4DRNA 2Q5AA 2ZAJA 4S3JA 2JZVA 2F4EA 4TYOA 4C02B 4ZPVR 2ITKA 2LKNA 3MDYB 3KCEA 1J4RA 1FKLA 3WQWA 5HKGA 4DRPA 1L1PA 1RD6A 3CHDA 3UI5A 1ZU8A 4REXA 2JX8A 2RSEA 4IT6A 4E5RA 1J4IA 4XAKA 2XP3A 1HJWA 3O5JA 3RM8A 3NRKA 1N1AA 2DG9A 2ETNA 2XP8A 2DJYA 4GIVA 4IQCA 1I5HW 1CTNA 1HKKA 1W9VA 4J4NA 1JNSA 2WK2A 3IKDA 4MNMA 2PPOA 1W1VA 1E15A 1HXVA 2YSBA 4P8VA 3WKZA 3O5GA 1EG3A 2KI3A 5E65A 3OOBA 4W5UA 4Z2LA 3L4HA 1QPFA 4ZPWR 2RQSA 3MQHA 2WM0A 1IX5A 5GPGA 4W9OA 4WKFA 3RGCA 5HT1A 5HTGA 3O5MA 2LGOA 2XP5A 1TK7A 3PRAA 3TDBA 3PR9A 1D7IA 4QIBA 3GU0A 2ZQSA 3I6CA 4W9PA 1E9LA 3NI6A 1LG2A 1GRJA 1R9HA 1NMVA 1LL7A 4ODOA 3G6MA 1QZ2A 2L2SA 4Z2JA 1JNTA 4TW6A 2XP7A 2JXWA 1J6YA 3KAHA 1FFRA 3WD2A 1F40A 3KACA 4Z2HA 3JXVA 5DO2A 4N19A 2PV1A 4NNRA 4WKHA 3ARTA 2DMVA 1Q6UA 3RM9A 2O92A 4ITZA 2YSHA 1HKMA 2YAJB 3UQBA 2A3AA 4TW8A 3ODKA 3LKXA 2O9OA 2PV2A 3ARWA 4DT4A 1JNEA 1Y0OA 4DRIA 1PINA 2K8IA 3O5LA 3BMBA 2ESCA 5E64A 2YSGA 1FFQA 1W1PA 1Q6HA 1E6RA 1RP5A 2M2AA 1KT0A 4MNJA 2PV3A 3LKXB 1NWUA 1BKFA 4MGVA 3ARSA 4JFIA 2ZQVA 1WNOA 2IF4A 5HBFA 1E6PA 1FKGA 4TNSA 1Q6IA 5HUAA 3B8SA 1M5YA 3ARRA 4O2TA 3BXWA 4Z2IA 3PRBA 3CHCA 4JFJA 4Z2KA 4IQ2A 1XRVA 4DH0A 1OWQA 2F2DA 5HWBA 2XP4A 2LPVA 4DRMA 3WL1A 1FKFA 1VF8A 2EULA 4LAXA 3AS1A 5DIUA 3IK8A 1EG4A 5BXJA 4WKAA 3O5PA 4G50A 4R5EA 1EDQA 4MNLA 4ODMA 3RMEA 3KZ7A 2ZQUA 2N87A 3CGMA 3UI4A 3AS0A 5CQ2A 1NMWA
chains in the Genus database with same CATH topology
3KAIA 4KQZA 4W9QA 2G8ZA 1Q1CA 2DG3A 1HJVA 4BF8A 1O6IA 4DRKA 1SYTA 5DF0A 3ARYA 1OGBA 4TX0A 2VCDA 3UI6A 2WLZA 2DPEA 4GLXA 1D7JA 1UR9A 2E45A 4R0XA 2Y8NB 1FLCA 1YATA 3H9RB 2KR7A 1E6ZA 1H0GA 1OGGA 1PBKA 2FDMA 4LAYA 2RUDA 5DITA 1FKBA 3O5IA 3O5EA 5HW6A 2OWOA 1W1TA 2AWGA 4DWSB 3MQGA 1A7XA 1BL4A 1ITXA 2OLHA 4MSPA 1HKIA 1FD9A 1NSGA 3WD1A 2DSZA 3UF8A 4P8UA 4ML4A 4JFLA 3WH0A 3KAFA 1ZBCA 1FKKA 2EZ5W 3B7XA 3CH9A 1FKIA 2D9FA 1FKSA 1ZBWA 3LUOA 5GQBA 3B9DA 4MPKA 2MLYA 3WIJA 1JVWA 4G2PA 2BA1A 3M85A 4IT4A 1FKDA 4TW7A 3EY6A 1W9UA 2DSWA 3AROA 2XP6A 3O5KA 4DZ2A 3KABA 3GPKA 1X6LA 2QRVA 1FKJA 1ROUA 3AS3A 4QZVB 3CHEA 4U85A 1NH6A 1EIBA 3CZ8A 2RUQA 4NZCA 1FJDA 4FAPA 1E6NA 1X6NA 2RUCA 1B6CA 4DIPA 1J4HA 4PTMA 4JFKA 4DROA 5GPRA 5HW8A 2KFWA 3OA5A 1LL4A 1GUVA 2WADA 3O5RA 2YSIA 3CHFA 5B8IC 2ZR6A 2KE0A 2PPPA 4GGQA 1NWRA 1ROTA 2MF9A 1ZCNA 2FKEA 2YBUA 3ALGA 2DT0A 4MAVA 2F21A 2LAJA 1EHNA 2DG4A 1EYMA 3NTPA 2ZR5A 3M7NA 1H0IA 2MLZA 5HW7A 1P5QA 2G41A 1WMVA 2YBTA 3FY1A 3TC5A 3B9AA 2DSVA 2OFNA 3PA7A 1GOIA 1HJXA 4A0TA 3JYJA 3TCZA 1XHGA 1WB0A 3JYMA 2MLXA 4IPXA 4L3NA 4KR0B 1ZB5A 4U86A 1W26A 5HWCA 1KFWA 2KGJA 2DWVA 2JMFA 3FXYA 4JYSA 1WR7A 2FAPA 3O5DA 2DSUA 3FSCA 4S3KA 2M08A 4DRHA 5E62A 2PBCA 3PQHA 3MCBA 4ODLA 5DEZA 4Z2GA 1T11A 4DRQA 2QF8A 2MNTA 3KAGA 4HBOA 3AQUA 5J6EA 5DIVA 1LL6A 1W1YA 3W4RA 4WK9A 2M1IA 1TFVA 1LG1A 2JV4A 1ZL1A 1W9PA 4DWSD 1C9HA 4ZS6A 3O5FA 4ODNA 2M8IA 3IHZA 4ODPA 2ZR4A 5E66A 3WD0A 4P8WA 4WIWA 3WL0A 1FKHA 3PRDA 4Q22A 2L4JA 5D75A 4MTVA 4DWSC 3QOKA 5U47A 2KO7A 4LGXA 3RM4A 2KXQA 2AOSA 3WD3A 4DZ3A 3AS2A 1TCOC 4HBEA 4NSBA 1NWTA 4DWSA 2YSFA 1F8AB 4A0UA 2M3OW 4U84A 1JMQA 4FN2A 2PI6A 4LAWA 1O6WA 1UR8A 2XPBA 1ZBVA 2A3BA 2IUZA 2RE3A 3VAWA 3FSBA 1QPLA 2VN1A 2XP9A 1NWSA 3WD4A 1HKJA 1LQ0A 2DT1A 1KT1A 5JH8A 4URIA 3O5QA 4QT3A 3LE4A 3WQVA 2Y78A 3MCBB 3FAPA 4DRJA 1EQ3A 3FS8A 4WJXA 5AHTA 4MNKA 5E5WA 1U79A 2PPNA 4LAVA 3O5OA 1YW5A 3ARZA 1FKRA 4HARA 4ODRA 1D6OA 3UQIA 1FAPA 2WAEA 2MPHA 2RURA 1TR8A 3ARPA 3ARUA 5I98A 2B31A 2MDIA 3ARQA 3RFWA 3B9EA 1D2KA 3ARVA 1K9RA 2WLYA 4AY1A 2LJ4A 1SR0A 2DT2A 2UZ5A 1WAWA 1K9TA 1D7HA 2A3EA 4JFMA 4Q7NA 4QT2A 2M8JA 3ARXA 1LJYA 1ZK6A 1JNDA 2ZQTA 3ALFA 1FKTA 1K9QA 3G6LA 1GPFA 2DK1A 3IKGA 2A3CA 4ODQA 4ZPTR 2DT3A 3UQAA 3CGNA 4P8XA 3CNGA 1ZBKA 2DK7A 4L72B 4J4OA 2XPAA 3KADA 4ODKA 4DRNA 2Q5AA 2ZAJA 4S3JA 2JZVA 2F4EA 4TYOA 4C02B 4ZPVR 2ITKA 2LKNA 3MDYB 3KCEA 1J4RA 1FKLA 3WQWA 5HKGA 4DRPA 1L1PA 1RD6A 3CHDA 3UI5A 1ZU8A 4REXA 2JX8A 2RSEA 4IT6A 4E5RA 1J4IA 4XAKA 2XP3A 1HJWA 3O5JA 3RM8A 3NRKA 1N1AA 2DG9A 2XP8A 2DJYA 4GIVA 4IQCA 1I5HW 1CTNA 1HKKA 1W9VA 4J4NA 1JNSA 2WK2A 3IKDA 4MNMA 2PPOA 1W1VA 1E15A 1HXVA 2YSBA 4P8VA 3WKZA 3O5GA 1EG3A 2KI3A 5E65A 3OOBA 4W5UA 4Z2LA 3L4HA 1QPFA 4ZPWR 2RQSA 3MQHA 2WM0A 1IX5A 5GPGA 4W9OA 4WKFA 3RGCA 5HT1A 5HTGA 3O5MA 2LGOA 2XP5A 1TK7A 3PRAA 3TDBA 3PR9A 1D7IA 4QIBA 2ZQSA 3I6CA 4W9PA 1E9LA 3NI6A 1LG2A 1R9HA 1NMVA 1LL7A 4ODOA 3G6MA 1QZ2A 2L2SA 4Z2JA 1JNTA 4TW6A 2XP7A 2JXWA 1J6YA 3KAHA 1FFRA 3WD2A 1F40A 3KACA 4Z2HA 3JXVA 5DO2A 4N19A 2PV1A 4NNRA 4WKHA 3ARTA 2DMVA 1Q6UA 3RM9A 2O92A 4ITZA 2YSHA 1HKMA 2YAJB 3UQBA 2A3AA 4TW8A 3ODKA 3LKXA 2O9OA 2PV2A 3ARWA 4DT4A 1JNEA 1Y0OA 4DRIA 1PINA 2K8IA 3O5LA 2ESCA 5E64A 2YSGA 1FFQA 1W1PA 1Q6HA 1E6RA 1RP5A 2M2AA 1KT0A 4MNJA 2PV3A 3LKXB 1NWUA 1BKFA 4MGVA 3ARSA 4JFIA 2ZQVA 1WNOA 2IF4A 5HBFA 1E6PA 1FKGA 4TNSA 1Q6IA 5HUAA 3B8SA 1M5YA 3ARRA 4O2TA 3BXWA 4Z2IA 3PRBA 3CHCA 4JFJA 4Z2KA 4IQ2A 1XRVA 4DH0A 1OWQA 2F2DA 5HWBA 2XP4A 2LPVA 4DRMA 3WL1A 1FKFA 1VF8A 4LAXA 3AS1A 5DIUA 3IK8A 1EG4A 5BXJA 4WKAA 3O5PA 4G50A 4R5EA 1EDQA 4MNLA 4ODMA 3RMEA 3KZ7A 2ZQUA 2N87A 3CGMA 3UI4A 3AS0A 5CQ2A 1NMWA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4DRJ A;  2DG4 A;  1EYM A;  3NTP A;  2ZR5 A;  3M7N A;  2MLZ A;  3KAI A;  3TDB A;  1P5Q A;  4W9Q A;  5HW7 A;  1WMV A;  1Q1C A;  2DG3 A;  5AHT A;  1U79 A;  2PPN A;  4LAV A;  3O5O A;  1YW5 A;  4QIB A;  1D7I A;  2ZQS A;  3TC5 A;  3I6C A;  4W9P A;  4BF8 A;  3NI6 A;  2OFN A;  4DRK A;  1FKR A;  1R9H A;  1NMV A;  3PA7 A;  4ODR A;  1D6O A;  3JYJ A;  4TX0 A;  1FAP A;  3TCZ A;  3UQI A;  2VCD A;  2MPH A;  3UI6 A;  2RUR A;  4ODO A;  3JYM A;  5I98 A;  2MDI A;  2MLX A;  1D7J A;  1QZ2 A;  2L2S A;  4IPX A;  3RFW A;  2E45 A;  1JNT A;  4R0X A;  2LGO A;  1YAT A;  4U86 A;  4TW6 A;  1K9R A;  2XP7 A;  3H9R B;  2KR7 A;  2JXW A;  1J6Y A;  1W26 A;  3KAH A;  1PBK A;  5HWC A;  2KGJ A;  4LAY A;  1EQ3 A;  2RUD A;  1F40 A;  2LJ4 A;  3KAC A;  2DWV A;  1FKB A;  2UZ5 A;  5DIT A;  2JMF A;  3JXV A;  3O5I A;  4N19 A;  3O5E A;  1D7H A;  4JFM A;  4JYS A;  1WR7 A;  5HW6 A;  2PV1 A;  2FAP A;  4NNR A;  4QT2 A;  3O5D A;  2DMV A;  2M8J A;  2AWG A;  1Q6U A;  1ZK6 A;  1A7X A;  1BL4 A;  2M08 A;  2ZQT A;  4DRH A;  2PBC A;  4ITZ A;  4MSP A;  2YSH A;  4ODL A;  1FKT A;  3UQB A;  4TW8 A;  1K9Q A;  1FD9 A;  1T11 A;  3ODK A;  1NSG A;  4DRQ A;  2DK1 A;  2PV2 A;  2MNT A;  3KAG A;  3IKG A;  3UF8 A;  4DT4 A;  5J6E A;  1Y0O A;  4ODQ A;  1PIN A;  2K8I A;  4JFL A;  5DIV A;  3WH0 A;  3KAF A;  3O5L A;  4DRI A;  3UQA A;  3CGN A;  2M1I A;  3CNG A;  1FKK A;  2DK7 A;  2EZ5 W;  3B7X A;  1FKI A;  2JV4 A;  4J4O A;  2YSG A;  2XPA A;  3KAD A;  2D9F A;  1FKS A;  1C9H A;  4ODK A;  3LUO A;  2Q5A A;  2ZAJ A;  1Q6H A;  3O5F A;  4ODN A;  4DRN A;  2M8I A;  2JZV A;  2F4E A;  2M2A A;  3IHZ A;  1KT0 A;  4TYO A;  4ODP A;  2MLY A;  4C02 B;  2ZR4 A;  1JVW A;  2PV3 A;  4G2P A;  2ITK A;  1BKF A;  2BA1 A;  2LKN A;  4MGV A;  3M85 A;  3MDY B;  3KCE A;  4JFI A;  2ZQV A;  1J4R A;  1FKH A;  1FKD A;  3PRD A;  1FKL A;  3EY6 A;  4TW7 A;  5HKG A;  4DRP A;  1L1P A;  2L4J A;  3UI5 A;  5D75 A;  2XP6 A;  2IF4 A;  3O5K A;  4DZ2 A;  4REX A;  2JX8 A;  3KAB A;  3GPK A;  2KO7 A;  2RSE A;  4E5R A;  1J4I A;  2KXQ A;  2XP3 A;  1FKG A;  3O5J A;  4TNS A;  1Q6I A;  1FKJ A;  4DZ3 A;  5HUA A;  1ROU A;  1M5Y A;  1TCO C;  4O2T A;  3NRK A;  3PRB A;  2YSF A;  1NMW A;  4JFJ A;  2LAJ A;  1F8A B;  1N1A A;  4IQ2 A;  4U85 A;  2DG9 A;  2RUQ A;  2XP8 A;  2DJY A;  2M3O W;  4GIV A;  4IQC A;  4DH0 A;  1FJD A;  4FAP A;  1I5H W;  2F2D A;  4U84 A;  1JMQ A;  2RUC A;  4FN2 A;  4J4N A;  4LAW A;  5HWB A;  2XP4 A;  1O6W A;  2XPB A;  1JNS A;  1B6C A;  2LPV A;  1J4H A;  4DIP A;  4JFK A;  3IKD A;  4DRM A;  1FKF A;  2PPO A;  4DRO A;  1HXV A;  5HW8 A;  2KFW A;  2RE3 A;  2YSB A;  4LAX A;  3VAW A;  3O5R A;  2YSI A;  1EG3 A;  1QPL A;  2KI3 A;  3O5G A;  3IK8 A;  5DIU A;  1EG4 A;  2VN1 A;  3OOB A;  2XP9 A;  5B8I C;  2ZR6 A;  3L4H A;  1QPF A;  2KE0 A;  5BXJ A;  2RQS A;  2PPP A;  1KT1 A;  4GGQ A;  1ROT A;  2MF9 A;  1ZCN A;  3O5P A;  2FKE A;  4G50 A;  5GPG A;  4ODM A;  4W9O A;  3KZ7 A;  2ZQU A;  2N87 A;  3CGM A;  3O5Q A;  4QT3 A;  5HT1 A;  3RGC A;  3LE4 A;  2F21 A;  2Y78 A;  3UI4 A;  5HTG A;  5CQ2 A;  3O5M A;  2XP5 A;  1TK7 A;  3FAP A; 
#chains in the Genus database with same CATH topology
 3KAI A;  4KQZ A;  4W9Q A;  2G8Z A;  1Q1C A;  2DG3 A;  1HJV A;  2PN0 A;  4BF8 A;  1O6I A;  4DRK A;  1SYT A;  5DF0 A;  1OGB A;  3ARY A;  4TX0 A;  2VCD A;  3UI6 A;  2WLZ A;  2DPE A;  4GLX A;  1D7J A;  1UR9 A;  2E45 A;  4R0X A;  2Y8N B;  1FLC A;  1YAT A;  2B5U B;  2KR7 A;  3H9R B;  1E6Z A;  1H0G A;  1OGG A;  1PBK A;  2FDM A;  4LAY A;  2RUD A;  5DIT A;  1FKB A;  3O5I A;  3O5E A;  5HW6 A;  2OWO A;  1W1T A;  2AWG A;  4DWS B;  3MQG A;  1A7X A;  1BL4 A;  1ITX A;  2OLH A;  4MSP A;  1HKI A;  1FD9 A;  1NSG A;  3WD1 A;  2DSZ A;  3UF8 A;  4P8U A;  4ML4 A;  4JFL A;  3WH0 A;  3KAF A;  3GTY X;  1ZBC A;  1FKK A;  2EZ5 W;  3B7X A;  3CH9 A;  1FKI A;  2D9F A;  1FKS A;  1ZBW A;  3LUO A;  5GQB A;  3B9D A;  4MPK A;  2MLY A;  3WIJ A;  1JVW A;  4G2P A;  2BA1 A;  3M85 A;  4IT4 A;  1FKD A;  4TW7 A;  3EY6 A;  1W9U A;  2DSW A;  3ARO A;  2XP6 A;  3O5K A;  4DZ2 A;  3KAB A;  3GPK A;  1X6L A;  2QRV A;  1FKJ A;  1ROU A;  3AS3 A;  4QZV B;  3CHE A;  4U85 A;  1NH6 A;  1EIB A;  3CZ8 A;  2RUQ A;  4NZC A;  1FJD A;  4FAP A;  1E6N A;  1X6N A;  2RUC A;  1B6C A;  4DIP A;  1J4H A;  4PTM A;  4JFK A;  4DRO A;  5GPR A;  5HW8 A;  2KFW A;  3OA5 A;  1LL4 A;  1GUV A;  2WAD A;  3O5R A;  2YSI A;  3CHF A;  5B8I C;  2ZR6 A;  2KE0 A;  2PPP A;  4GGQ A;  1NWR A;  1ROT A;  2MF9 A;  1ZCN A;  2FKE A;  2YBU A;  3ALG A;  2DT0 A;  4MAV A;  2F21 A;  2LAJ A;  1EHN A;  2DG4 A;  1EYM A;  3NTP A;  2ZR5 A;  3M7N A;  1H0I A;  2MLZ A;  5HW7 A;  1P5Q A;  2G41 A;  1WMV A;  2YBT A;  3FY1 A;  3TC5 A;  3B9A A;  2DSV A;  2OFN A;  3PA7 A;  1GOI A;  1HJX A;  4A0T A;  3JYJ A;  3TCZ A;  1XHG A;  1WB0 A;  3JYM A;  2MLX A;  4IPX A;  4L3N A;  4KR0 B;  1ZB5 A;  4U86 A;  1W26 A;  5HWC A;  1KFW A;  2KGJ A;  1JCH B;  2DWV A;  2JMF A;  3FXY A;  4JYS A;  1WR7 A;  3EIP A;  2FAP A;  3O5D A;  2DSU A;  3FSC A;  4S3K A;  2M08 A;  4DRH A;  5E62 A;  2PBC A;  3PQH A;  3MCB A;  4ODL A;  5DEZ A;  2P4V A;  4Z2G A;  1T11 A;  4DRQ A;  2QF8 A;  2MNT A;  3KAG A;  4HBO A;  3AQU A;  5J6E A;  5DIV A;  1LL6 A;  1W1Y A;  1E44 A;  3W4R A;  4WK9 A;  2M1I A;  1TFV A;  1LG1 A;  2JV4 A;  1ZL1 A;  1W9P A;  4DWS D;  1C9H A;  4ZS6 A;  3O5F A;  4ODN A;  2M8I A;  4UDM A;  3IHZ A;  4ODP A;  2ZR4 A;  5E66 A;  3WD0 A;  4P8W A;  4WIW A;  3WL0 A;  1FKH A;  3PRD A;  4Q22 A;  2L4J A;  5D75 A;  4MTV A;  4DWS C;  3QOK A;  5U47 A;  2KO7 A;  4LGX A;  3RM4 A;  2KXQ A;  2AOS A;  3WD3 A;  4DZ3 A;  3AS2 A;  1TCO C;  4HBE A;  4NSB A;  1NWT A;  4DWS A;  2YSF A;  1F8A B;  4A0U A;  2M3O W;  4U84 A;  1JMQ A;  4FN2 A;  2PI6 A;  4LAW A;  1O6W A;  1UR8 A;  2XPB A;  1ZBV A;  2A3B A;  2IUZ A;  2RE3 A;  3VAW A;  3FSB A;  1QPL A;  2VN1 A;  2XP9 A;  1NWS A;  3WD4 A;  1HKJ A;  1LQ0 A;  2DT1 A;  1KT1 A;  5JH8 A;  4URI A;  3O5Q A;  4QT3 A;  3LE4 A;  3WQV A;  2Y78 A;  3MCB B;  3FAP A;  4DRJ A;  1EQ3 A;  3FS8 A;  4WJX A;  5AHT A;  4MNK A;  5E5W A;  1U79 A;  2PPN A;  4LAV A;  3O5O A;  1YW5 A;  3ARZ A;  1FKR A;  4HAR A;  4ODR A;  1D6O A;  3UQI A;  1FAP A;  2WAE A;  2MPH A;  2RUR A;  1TR8 A;  3ARP A;  3ARU A;  5I98 A;  2B31 A;  2MDI A;  3ARQ A;  3RFW A;  3B9E A;  1D2K A;  3ARV A;  1K9R A;  2WLY A;  4AY1 A;  2LJ4 A;  1SR0 A;  2DT2 A;  2UZ5 A;  1WAW A;  1K9T A;  1D7H A;  2A3E A;  4JFM A;  4Q7N A;  4QT2 A;  2M8J A;  3ARX A;  1LJY A;  1ZK6 A;  1JND A;  2ZQT A;  3ALF A;  2F23 A;  1FKT A;  1K9Q A;  3G6L A;  1GPF A;  2DK1 A;  3IKG A;  2A3C A;  4ODQ A;  4ZPT R;  2DT3 A;  3UQA A;  3CGN A;  4P8X A;  3CNG A;  1ZBK A;  2DK7 A;  4L72 B;  4J4O A;  2XPA A;  3KAD A;  4ODK A;  4DRN A;  2Q5A A;  2ZAJ A;  4S3J A;  2JZV A;  2F4E A;  4TYO A;  4C02 B;  4ZPV R;  2ITK A;  2LKN A;  3MDY B;  3KCE A;  1J4R A;  1FKL A;  3WQW A;  5HKG A;  4DRP A;  1L1P A;  1RD6 A;  3CHD A;  3UI5 A;  1ZU8 A;  4REX A;  2JX8 A;  2RSE A;  4IT6 A;  4E5R A;  1J4I A;  4XAK A;  2XP3 A;  1HJW A;  3O5J A;  3RM8 A;  3NRK A;  1N1A A;  2DG9 A;  2ETN A;  2XP8 A;  2DJY A;  4GIV A;  4IQC A;  1I5H W;  1CTN A;  1HKK A;  1W9V A;  4J4N A;  1JNS A;  2WK2 A;  3IKD A;  4MNM A;  2PPO A;  1W1V A;  1E15 A;  1HXV A;  2YSB A;  4P8V A;  3WKZ A;  3O5G A;  1EG3 A;  2KI3 A;  5E65 A;  3OOB A;  4W5U A;  4Z2L A;  3L4H A;  1QPF A;  4ZPW R;  2RQS A;  3MQH A;  2WM0 A;  1IX5 A;  5GPG A;  4W9O A;  4WKF A;  3RGC A;  5HT1 A;  5HTG A;  3O5M A;  2LGO A;  2XP5 A;  1TK7 A;  3PRA A;  3TDB A;  3PR9 A;  1D7I A;  4QIB A;  3GU0 A;  2ZQS A;  3I6C A;  4W9P A;  1E9L A;  3NI6 A;  1LG2 A;  1GRJ A;  1R9H A;  1NMV A;  1LL7 A;  4ODO A;  3G6M A;  1QZ2 A;  2L2S A;  4Z2J A;  1JNT A;  4TW6 A;  2XP7 A;  2JXW A;  1J6Y A;  3KAH A;  1FFR A;  3WD2 A;  1F40 A;  3KAC A;  4Z2H A;  3JXV A;  5DO2 A;  4N19 A;  2PV1 A;  4NNR A;  4WKH A;  3ART A;  2DMV A;  1Q6U A;  3RM9 A;  2O92 A;  4ITZ A;  2YSH A;  1HKM A;  2YAJ B;  3UQB A;  2A3A A;  4TW8 A;  3ODK A;  3LKX A;  2O9O A;  2PV2 A;  3ARW A;  4DT4 A;  1JNE A;  1Y0O A;  4DRI A;  1PIN A;  2K8I A;  3O5L A;  3BMB A;  2ESC A;  5E64 A;  2YSG A;  1FFQ A;  1W1P A;  1Q6H A;  1E6R A;  1RP5 A;  2M2A A;  1KT0 A;  4MNJ A;  2PV3 A;  3LKX B;  1NWU A;  1BKF A;  4MGV A;  3ARS A;  4JFI A;  2ZQV A;  1WNO A;  2IF4 A;  5HBF A;  1E6P A;  1FKG A;  4TNS A;  1Q6I A;  5HUA A;  3B8S A;  1M5Y A;  3ARR A;  4O2T A;  3BXW A;  4Z2I A;  3PRB A;  3CHC A;  4JFJ A;  4Z2K A;  4IQ2 A;  1XRV A;  4DH0 A;  1OWQ A;  2F2D A;  5HWB A;  2XP4 A;  2LPV A;  4DRM A;  3WL1 A;  1FKF A;  1VF8 A;  2EUL A;  4LAX A;  3AS1 A;  5DIU A;  3IK8 A;  1EG4 A;  5BXJ A;  4WKA A;  3O5P A;  4G50 A;  4R5E A;  1EDQ A;  4MNL A;  4ODM A;  3RME A;  3KZ7 A;  2ZQU A;  2N87 A;  3CGM A;  3UI4 A;  3AS0 A;  5CQ2 A;  1NMW A; 
#chains in the Genus database with same CATH homology
 3KAI A;  4KQZ A;  4W9Q A;  2G8Z A;  1Q1C A;  2DG3 A;  1HJV A;  4BF8 A;  1O6I A;  4DRK A;  1SYT A;  5DF0 A;  3ARY A;  1OGB A;  4TX0 A;  2VCD A;  3UI6 A;  2WLZ A;  2DPE A;  4GLX A;  1D7J A;  1UR9 A;  2E45 A;  4R0X A;  2Y8N B;  1FLC A;  1YAT A;  3H9R B;  2KR7 A;  1E6Z A;  1H0G A;  1OGG A;  1PBK A;  2FDM A;  4LAY A;  2RUD A;  5DIT A;  1FKB A;  3O5I A;  3O5E A;  5HW6 A;  2OWO A;  1W1T A;  2AWG A;  4DWS B;  3MQG A;  1A7X A;  1BL4 A;  1ITX A;  2OLH A;  4MSP A;  1HKI A;  1FD9 A;  1NSG A;  3WD1 A;  2DSZ A;  3UF8 A;  4P8U A;  4ML4 A;  4JFL A;  3WH0 A;  3KAF A;  1ZBC A;  1FKK A;  2EZ5 W;  3B7X A;  3CH9 A;  1FKI A;  2D9F A;  1FKS A;  1ZBW A;  3LUO A;  5GQB A;  3B9D A;  4MPK A;  2MLY A;  3WIJ A;  1JVW A;  4G2P A;  2BA1 A;  3M85 A;  4IT4 A;  1FKD A;  4TW7 A;  3EY6 A;  1W9U A;  2DSW A;  3ARO A;  2XP6 A;  3O5K A;  4DZ2 A;  3KAB A;  3GPK A;  1X6L A;  2QRV A;  1FKJ A;  1ROU A;  3AS3 A;  4QZV B;  3CHE A;  4U85 A;  1NH6 A;  1EIB A;  3CZ8 A;  2RUQ A;  4NZC A;  1FJD A;  4FAP A;  1E6N A;  1X6N A;  2RUC A;  1B6C A;  4DIP A;  1J4H A;  4PTM A;  4JFK A;  4DRO A;  5GPR A;  5HW8 A;  2KFW A;  3OA5 A;  1LL4 A;  1GUV A;  2WAD A;  3O5R A;  2YSI A;  3CHF A;  5B8I C;  2ZR6 A;  2KE0 A;  2PPP A;  4GGQ A;  1NWR A;  1ROT A;  2MF9 A;  1ZCN A;  2FKE A;  2YBU A;  3ALG A;  2DT0 A;  4MAV A;  2F21 A;  2LAJ A;  1EHN A;  2DG4 A;  1EYM A;  3NTP A;  2ZR5 A;  3M7N A;  1H0I A;  2MLZ A;  5HW7 A;  1P5Q A;  2G41 A;  1WMV A;  2YBT A;  3FY1 A;  3TC5 A;  3B9A A;  2DSV A;  2OFN A;  3PA7 A;  1GOI A;  1HJX A;  4A0T A;  3JYJ A;  3TCZ A;  1XHG A;  1WB0 A;  3JYM A;  2MLX A;  4IPX A;  4L3N A;  4KR0 B;  1ZB5 A;  4U86 A;  1W26 A;  5HWC A;  1KFW A;  2KGJ A;  2DWV A;  2JMF A;  3FXY A;  4JYS A;  1WR7 A;  2FAP A;  3O5D A;  2DSU A;  3FSC A;  4S3K A;  2M08 A;  4DRH A;  5E62 A;  2PBC A;  3PQH A;  3MCB A;  4ODL A;  5DEZ A;  4Z2G A;  1T11 A;  4DRQ A;  2QF8 A;  2MNT A;  3KAG A;  4HBO A;  3AQU A;  5J6E A;  5DIV A;  1LL6 A;  1W1Y A;  3W4R A;  4WK9 A;  2M1I A;  1TFV A;  1LG1 A;  2JV4 A;  1ZL1 A;  1W9P A;  4DWS D;  1C9H A;  4ZS6 A;  3O5F A;  4ODN A;  2M8I A;  3IHZ A;  4ODP A;  2ZR4 A;  5E66 A;  3WD0 A;  4P8W A;  4WIW A;  3WL0 A;  1FKH A;  3PRD A;  4Q22 A;  2L4J A;  5D75 A;  4MTV A;  4DWS C;  3QOK A;  5U47 A;  2KO7 A;  4LGX A;  3RM4 A;  2KXQ A;  2AOS A;  3WD3 A;  4DZ3 A;  3AS2 A;  1TCO C;  4HBE A;  4NSB A;  1NWT A;  4DWS A;  2YSF A;  1F8A B;  4A0U A;  2M3O W;  4U84 A;  1JMQ A;  4FN2 A;  2PI6 A;  4LAW A;  1O6W A;  1UR8 A;  2XPB A;  1ZBV A;  2A3B A;  2IUZ A;  2RE3 A;  3VAW A;  3FSB A;  1QPL A;  2VN1 A;  2XP9 A;  1NWS A;  3WD4 A;  1HKJ A;  1LQ0 A;  2DT1 A;  1KT1 A;  5JH8 A;  4URI A;  3O5Q A;  4QT3 A;  3LE4 A;  3WQV A;  2Y78 A;  3MCB B;  3FAP A;  4DRJ A;  1EQ3 A;  3FS8 A;  4WJX A;  5AHT A;  4MNK A;  5E5W A;  1U79 A;  2PPN A;  4LAV A;  3O5O A;  1YW5 A;  3ARZ A;  1FKR A;  4HAR A;  4ODR A;  1D6O A;  3UQI A;  1FAP A;  2WAE A;  2MPH A;  2RUR A;  1TR8 A;  3ARP A;  3ARU A;  5I98 A;  2B31 A;  2MDI A;  3ARQ A;  3RFW A;  3B9E A;  1D2K A;  3ARV A;  1K9R A;  2WLY A;  4AY1 A;  2LJ4 A;  1SR0 A;  2DT2 A;  2UZ5 A;  1WAW A;  1K9T A;  1D7H A;  2A3E A;  4JFM A;  4Q7N A;  4QT2 A;  2M8J A;  3ARX A;  1LJY A;  1ZK6 A;  1JND A;  2ZQT A;  3ALF A;  1FKT A;  1K9Q A;  3G6L A;  1GPF A;  2DK1 A;  3IKG A;  2A3C A;  4ODQ A;  4ZPT R;  2DT3 A;  3UQA A;  3CGN A;  4P8X A;  3CNG A;  1ZBK A;  2DK7 A;  4L72 B;  4J4O A;  2XPA A;  3KAD A;  4ODK A;  4DRN A;  2Q5A A;  2ZAJ A;  4S3J A;  2JZV A;  2F4E A;  4TYO A;  4C02 B;  4ZPV R;  2ITK A;  2LKN A;  3MDY B;  3KCE A;  1J4R A;  1FKL A;  3WQW A;  5HKG A;  4DRP A;  1L1P A;  1RD6 A;  3CHD A;  3UI5 A;  1ZU8 A;  4REX A;  2JX8 A;  2RSE A;  4IT6 A;  4E5R A;  1J4I A;  4XAK A;  2XP3 A;  1HJW A;  3O5J A;  3RM8 A;  3NRK A;  1N1A A;  2DG9 A;  2XP8 A;  2DJY A;  4GIV A;  4IQC A;  1I5H W;  1CTN A;  1HKK A;  1W9V A;  4J4N A;  1JNS A;  2WK2 A;  3IKD A;  4MNM A;  2PPO A;  1W1V A;  1E15 A;  1HXV A;  2YSB A;  4P8V A;  3WKZ A;  3O5G A;  1EG3 A;  2KI3 A;  5E65 A;  3OOB A;  4W5U A;  4Z2L A;  3L4H A;  1QPF A;  4ZPW R;  2RQS A;  3MQH A;  2WM0 A;  1IX5 A;  5GPG A;  4W9O A;  4WKF A;  3RGC A;  5HT1 A;  5HTG A;  3O5M A;  2LGO A;  2XP5 A;  1TK7 A;  3PRA A;  3TDB A;  3PR9 A;  1D7I A;  4QIB A;  2ZQS A;  3I6C A;  4W9P A;  1E9L A;  3NI6 A;  1LG2 A;  1R9H A;  1NMV A;  1LL7 A;  4ODO A;  3G6M A;  1QZ2 A;  2L2S A;  4Z2J A;  1JNT A;  4TW6 A;  2XP7 A;  2JXW A;  1J6Y A;  3KAH A;  1FFR A;  3WD2 A;  1F40 A;  3KAC A;  4Z2H A;  3JXV A;  5DO2 A;  4N19 A;  2PV1 A;  4NNR A;  4WKH A;  3ART A;  2DMV A;  1Q6U A;  3RM9 A;  2O92 A;  4ITZ A;  2YSH A;  1HKM A;  2YAJ B;  3UQB A;  2A3A A;  4TW8 A;  3ODK A;  3LKX A;  2O9O A;  2PV2 A;  3ARW A;  4DT4 A;  1JNE A;  1Y0O A;  4DRI A;  1PIN A;  2K8I A;  3O5L A;  2ESC A;  5E64 A;  2YSG A;  1FFQ A;  1W1P A;  1Q6H A;  1E6R A;  1RP5 A;  2M2A A;  1KT0 A;  4MNJ A;  2PV3 A;  3LKX B;  1NWU A;  1BKF A;  4MGV A;  3ARS A;  4JFI A;  2ZQV A;  1WNO A;  2IF4 A;  5HBF A;  1E6P A;  1FKG A;  4TNS A;  1Q6I A;  5HUA A;  3B8S A;  1M5Y A;  3ARR A;  4O2T A;  3BXW A;  4Z2I A;  3PRB A;  3CHC A;  4JFJ A;  4Z2K A;  4IQ2 A;  1XRV A;  4DH0 A;  1OWQ A;  2F2D A;  5HWB A;  2XP4 A;  2LPV A;  4DRM A;  3WL1 A;  1FKF A;  1VF8 A;  4LAX A;  3AS1 A;  5DIU A;  3IK8 A;  1EG4 A;  5BXJ A;  4WKA A;  3O5P A;  4G50 A;  4R5E A;  1EDQ A;  4MNL A;  4ODM A;  3RME A;  3KZ7 A;  2ZQU A;  2N87 A;  3CGM A;  3UI4 A;  3AS0 A;  5CQ2 A;  1NMW A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...