4U85A

Human pin1 with cysteine sulfinic acid 113
Total Genus 46
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
46
sequence length
157
structure length
144
Chain Sequence
b'LPPGWEKAMSRSSGRVYYFNHITNASQWERPSEPARVRCSHLLVKHSQSRRPSSWRQEKITRTKEEALELINGYIQKIKSGEEDFESLASQFSDSSAKARGDLGAFSRGQMQKPFEDASFALRTGEMSGPVFTDSGIHIILRTE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Peptidyl-prolyl cis-trans isomerase NIMA-interacting 1
publication title Pin1 cysteine-113 oxidation inhibits its catalytic activity and cellular function in Alzheimer's disease.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Isomerase
total genus 46
structure length 144
sequence length 157
ec nomenclature ec 5.2.1.8: Peptidylprolyl isomerase.
pdb deposition date 2014-08-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00397 WW WW domain
A PF00639 Rotamase PPIC-type PPIASE domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.20.70.10 Mainly Beta Single Sheet Ubiquitin Ligase Nedd4; Chain: W; Ubiquitin Ligase Nedd4; Chain: W; 4u85A01
3.10.50.40 Alpha Beta Roll Chitinase A; domain 3 Chitinase A; domain 3 4u85A02
2DK7A 1Q6IA 3O5RA 4TNSA 2PBCA 2VCDA 1ZK6A 4G2PA 3JXVA 4DRKA 3O5MA 2FAPA 1Y0OA 2KGJA 3KZ7A 2XP7A 3LUOA 4DRPA 2KE0A 3KAIA 4ITZA 1EG3A 2XPAA 3M7NA 4JFJA 4DZ2A 2KR7A 1FKDA 2AWGA 1FKGA 4DRJA 3ODKA 2YSHA 1J6YA 5HT1A 4J4NA 1F8AB 1TCOC 1L1PA 2YSBA 4ODOA 1JVWA 4QT2A 2ZQUA 4QIBA 3KADA 2ITKA 2RSEA 4U85A 3I6CA 2EZ5W 2Q5AA 1KT1A 3IHZA 4O2TA 3KABA 4IQ2A 2KXQA 3IKGA 4FAPA 3JYJA 3KCEA 3TCZA 2PPPA 3UQAA 1T11A 1EG4A 2F2DA 1YATA 4C02B 2IF4A 1J4IA 2PPOA 1Q6HA 1FJDA 1R9HA 2DWVA 2M8JA 3OOBA 1JMQA 4ODMA 1FKLA 4DH0A 3UI6A 2M1IA 4DZ3A 2KFWA 2OFNA 1HXVA 5I98A 5DIUA 1J4RA 2XP3A 4ODNA 3O5KA 1WR7A 5B8IC 1FKJA 4LAYA 1BL4A 3JYMA 2LGOA 3CGNA 1JNSA 5BXJA 2JV4A 2XP6A 4REXA 4MSPA 1U79A 4TW6A 5HUAA 3NRKA 3MDYB 1ROUA 2YSIA 3CGMA 4DIPA 1K9QA 1EQ3A 4DROA 5HWCA 2DJYA 3UI5A 2LPVA 3RGCA 2LAJA 5DITA 3O5QA 1D7JA 1WMVA 4DRHA 4FN2A 3PA7A 4MGVA 2M2AA 2JZVA 3VAWA 1P5QA 3RFWA 1A7XA 4DRIA 2DG4A 3O5PA 3B7XA 2JX8A 2ZR5A 4DT4A 5HW6A 2XP4A 4TW7A 2PV2A 4LAWA 1JNTA 2XP8A 5HTGA 4ODKA 2MF9A 1PINA 4JFIA 3KAHA 2DK1A 2KO7A 4IQCA 2PV3A 3KACA 3LE4A 2MLYA 3PRDA 4ODLA 1QZ2A 4U86A 4DRNA 3O5DA 3KAFA 2L4JA 4TX0A 3EY6A 1F40A 4NNRA 3O5GA 2RQSA 3UF8A 2MLXA 1PBKA 2ZQSA 3IK8A 2M08A 2LJ4A 4U84A 1ZCNA 1KT0A 4TYOA 5GPGA 3M85A 4TW8A 1M5YA 4JFLA 4W9PA 3IKDA 4LAVA 1YW5A 1NMVA 3L4HA 5AHTA 1EYMA 2YSFA 2XP5A 3O5JA 5HKGA 1FD9A 3UQBA 1FKHA 1FKKA 1FKFA 1NSGA 2D9FA 2DG9A 3FAPA 1BKFA 4GIVA 3O5EA 4R0XA 4DRQA 4IPXA 4DRMA 3O5LA 2MDIA 5HW7A 2RUCA 2RUDA 4LAXA 2UZ5A 2Y78A 3TC5A 1B6CA 2K8IA 2JXWA 4E5RA 2ZQTA 2PV1A 4JFMA 1J4HA 3TDBA 4ODQA 2RUQA 2BA1A 3PRBA 5J6EA 2KI3A 2PPNA 2XP9A 2YSGA 4JFKA 3UQIA 4W9QA 3H9RB 4G50A 3O5FA 1D7IA 1ROTA 2MPHA 2XPBA 2VN1A 2ZQVA 1K9RA 5DIVA 1TK7A 1Q1CA 2DMVA 2MLZA 4ODPA 4GGQA 2JMFA 3NI6A 2ZR6A 1FKTA 2LKNA 2DG3A 3WH0A 3UI4A 1I5HW 1FKRA 5D75A 4N19A 2F4EA 1FKSA 1FKIA 3CNGA 4ODRA 4QT3A 1D7HA 1Q6UA 4BF8A 2RURA 4J4OA 3O5OA 3NTPA 4JYSA 5HW8A 2N87A 2RE3A 4W9OA 3KAGA 1D6OA 2FKEA 1N1AA 1FKBA 1QPFA 1O6WA 1NMWA 2ZR4A 2L2SA 2MNTA 5CQ2A 5HWBA 2M3OW 3O5IA 1C9HA 2ZAJA 2E45A 3GPKA 1W26A 2M8IA 1FAPA 2F21A 1QPLA
chains in the Genus database with same CATH superfamily
4LGXA 2DK7A 1OWQA 1Q6IA 4KR0B 4WJXA 3O5RA 4TNSA 4P8WA 2PBCA 2VCDA 1LG1A 1ZK6A 4G2PA 3EIPA 3JXVA 4DRKA 3O5MA 4WKFA 2FAPA 1Y0OA 2KGJA 3KZ7A 2XP7A 4Z2GA 3LUOA 1JNDA 4DRPA 2P4VA 2KE0A 3KAIA 4ITZA 1EG3A 2G41A 3CHEA 1E6RA 3ARQA 2XPAA 3M7NA 4JFJA 1GUVA 4DZ2A 2KR7A 1H0IA 1FKDA 2A3CA 2AWGA 4MNLA 1FKGA 3WQWA 4DRJA 3ODKA 2YSHA 4MNMA 1J6YA 5HT1A 4J4NA 3RM9A 1F8AB 1TCOC 2ESCA 1L1PA 2YSBA 5E65A 1CTNA 4ODOA 3B9AA 3ALFA 4QZVB 5E66A 1JVWA 4QT2A 1SR0A 4MAVA 3CHDA 2ETNA 2ZQUA 1ZBVA 1W1VA 4QIBA 3KADA 4WKHA 2ITKA 2RSEA 4U85A 3I6CA 2EZ5W 2Q5AA 1KT1A 3IHZA 4PTMA 1HKKA 4O2TA 1LJYA 3KABA 4IQ2A 3G6LA 5DF0A 2KXQA 3IKGA 4FAPA 2A3AA 2AOSA 3JYJA 2B31A 3KCEA 3TCZA 1LL4A 2PPPA 3UQAA 1ZBCA 1T11A 1EG4A 4Z2HA 2F2DA 1YATA 2IF4A 4C02B 1J4IA 2PPOA 1EHNA 1ZL1A 1Q6HA 2WK2A 1FJDA 3ARPA 1R9HA 3G6MA 2DWVA 2M8JA 3OOBA 2WLYA 1JMQA 2DT1A 4ODMA 1JCHB 1FKLA 3FXYA 1NWSA 1E6NA 2A3EA 1UR9A 2F23A 4DH0A 2G8ZA 3UI6A 2M1IA 4DZ3A 2KFWA 2OFNA 4WKAA 2PN0A 1HXVA 5I98A 5DIUA 1J4RA 2O9OA 2XP3A 4P8VA 4ODNA 2A3BA 3O5KA 1WR7A 5B8IC 1NWUA 1D2KA 4Q22A 5E5WA 1FKJA 1E6PA 4LAYA 1BL4A 5GPRA 2DPEA 3JYMA 3ALGA 3CHCA 1WAWA 2LGOA 3PR9A 3CGNA 1JNSA 4DWSA 4R5EA 5BXJA 2JV4A 2XP6A 4MNJA 4MNKA 4REXA 4MSPA 1U79A 4TW6A 5HUAA 3NRKA 3MDYB 1ROUA 2YSIA 1TFVA 3CGMA 4MPKA 4DIPA 1K9QA 3FY1A 1EQ3A 4DROA 3ARXA 2DJYA 3UI5A 5HWCA 2LPVA 3RGCA 2LAJA 4A0TA 3B8SA 5DITA 3O5QA 1W9UA 1D7JA 1WMVA 4DRHA 4FN2A 3PA7A 4MGVA 1HJXA 1XRVA 2M2AA 2JZVA 3MQHA 3VAWA 1P5QA 1HJVA 3RFWA 3W4RA 1A7XA 5HBFA 4DRIA 2DG4A 1TR8A 3B7XA 3O5PA 1JNEA 1LL7A 2JX8A 2ZR5A 4DT4A 1EDQA 5HW6A 2XP4A 1ZBWA 2WM0A 3ARRA 4TW7A 2PV2A 4LAWA 1JNTA 4L72B 2XP8A 1GPFA 1FFQA 5HTGA 4ODKA 2MF9A 4A0UA 4UDMA 5DEZA 1PINA 2IUZA 3KAHA 1E15A 2DK1A 3ARUA 4JFIA 2KO7A 2OLHA 4IQCA 3ARSA 2PV3A 1RP5A 1W9VA 3WL0A 5DO2A 1EIBA 3KACA 3LE4A 2DSVA 2MLYA 3PRDA 4ODLA 1GRJA 1K9TA 2EULA 1QZ2A 4U86A 1E9LA 3AS1A 3FS8A 1UR8A 4DRNA 4Q7NA 3RM4A 2WLZA 3O5DA 3KAFA 2L4JA 1ZB5A 2Y8NB 3EY6A 4TX0A 1F40A 2YAJB 4NNRA 1LG2A 2DT2A 3O5GA 2RQSA 2QF8A 3CZ8A 3UF8A 1XHGA 1GOIA 1PBKA 2MLXA 3ARTA 4XAKA 2DT3A 3AS3A 4ML4A 2ZQSA 3ARVA 3IK8A 2M08A 2LJ4A 4U84A 3GTYX 1ZCNA 1KT0A 1ZBKA 4TYOA 5GPGA 3FSBA 3M85A 3PQHA 4TW8A 3WD0A 1M5YA 1NH6A 4JFLA 4W9PA 3IKDA 4S3KA 4LAVA 1YW5A 1H0GA 1O6IA 1ITXA 1NMVA 3L4HA 5AHTA 3WIJA 1RD6A 1EYMA 4ZPVR 2YSFA 4DWSC 5JH8A 2YBTA 4GLXA 4Z2IA 2DSUA 2FDMA 2XP5A 4P8UA 1ZU8A 3O5JA 1OGGA 5HKGA 1FD9A 2B5UB 3UQBA 3CHFA 1FKHA 1W1TA 3AQUA 1FKKA 1HKMA 1FKFA 4MTVA 4P8XA 3AS2A 1VF8A 4URIA 3WKZA 1NSGA 2D9FA 2DG9A 3OA5A 4DWSB 4NSBA 1FLCA 3FAPA 1OGBA 2O92A 4IT4A 4Z2KA 1BKFA 4GIVA 3QOKA 3O5EA 4R0XA 4DRQA 5GQBA 4IPXA 3B9DA 4DRMA 3O5LA 2MDIA 5HW7A 3GU0A 2RUCA 2RUDA 4LAXA 2UZ5A 1SYTA 2Y78A 2WADA 4AY1A 2YBUA 3TC5A 1B6CA 2K8IA 2WAEA 2JXWA 4E5RA 2ZQTA 2PV1A 4JFMA 1J4HA 3TDBA 4ODQA 3LKXA 2RUQA 3FSCA 2BA1A 3PRBA 5J6EA 2KI3A 4W5UA 4WIWA 2PPNA 2XP9A 2YSGA 4JFKA 3UQIA 4W9QA 1X6NA 3H9RB 4G50A 3O5FA 1D7IA 1ROTA 2MPHA 2XPBA 1KFWA 2ZQVA 3LKXB 2DSZA 2VN1A 3AROA 1W1YA 3ARZA 1HKIA 3BMBA 3WD2A 1K9RA 5DIVA 2DSWA 4DWSD 1TK7A 1Q1CA 2DMVA 1W1PA 1X6LA 2OWOA 1HKJA 3CH9A 2MLZA 4ODPA 4ZS6A 4GGQA 4HBOA 2JMFA 3RM8A 3NI6A 2ZR6A 5U47A 1FKTA 3MCBA 2LKNA 2DG3A 3WH0A 1LL6A 3UI4A 4Z2LA 1I5HW 1FKRA 3RMEA 5D75A 4N19A 2F4EA 1FKSA 2QRVA 3MCBB 1FKIA 3CNGA 4ODRA 4QT3A 1D7HA 3AS0A 4NZCA 1Q6UA 5E64A 2DT0A 1E44A 3MQGA 2RURA 4J4OA 4BF8A 5E62A 3O5OA 3NTPA 4JYSA 5HW8A 2N87A 2RE3A 4ZPTR 4W9OA 3WD3A 1IX5A 1FFRA 4IT6A 3WL1A 3KAGA 1W9PA 2PI6A 4Z2JA 3PRAA 3ARYA 1D6OA 2FKEA 3BXWA 4KQZA 1HJWA 3WQVA 1N1AA 1FKBA 3WD4A 3ARWA 1QPFA 1O6WA 1NMWA 1LQ0A 4WK9A 1NWRA 2ZR4A 2L2SA 1E6ZA 1NWTA 2MNTA 5CQ2A 4HARA 5HWBA 3WD1A 2M3OW 4S3JA 3O5IA 1C9HA 2ZAJA 2E45A 3GPKA 1W26A 3B9EA 2M8IA 1FAPA 4L3NA 1WNOA 2F21A 4HBEA 1QPLA 4ZPWR 1WB0A
chains in the Genus database with same CATH topology
4LGXA 2DK7A 1OWQA 1Q6IA 4KR0B 4WJXA 3O5RA 4TNSA 4P8WA 2PBCA 2VCDA 1LG1A 1ZK6A 4G2PA 3JXVA 4DRKA 3O5MA 4WKFA 2FAPA 1Y0OA 2KGJA 3KZ7A 2XP7A 4Z2GA 3LUOA 1JNDA 4DRPA 2KE0A 3KAIA 4ITZA 1EG3A 2G41A 3CHEA 1E6RA 3ARQA 2XPAA 3M7NA 4JFJA 1GUVA 4DZ2A 2KR7A 1H0IA 1FKDA 2A3CA 2AWGA 4MNLA 1FKGA 3WQWA 4DRJA 3ODKA 2YSHA 4MNMA 1J6YA 5HT1A 4J4NA 3RM9A 1F8AB 1TCOC 2ESCA 1L1PA 2YSBA 5E65A 1CTNA 4ODOA 3B9AA 3ALFA 4QZVB 5E66A 1JVWA 4QT2A 1SR0A 4MAVA 3CHDA 2ZQUA 1ZBVA 1W1VA 4QIBA 3KADA 4WKHA 2ITKA 2RSEA 4U85A 3I6CA 2EZ5W 2Q5AA 1KT1A 3IHZA 4PTMA 1HKKA 4O2TA 1LJYA 3KABA 4IQ2A 3G6LA 5DF0A 2KXQA 3IKGA 4FAPA 2A3AA 2AOSA 3JYJA 2B31A 3KCEA 3TCZA 1LL4A 2PPPA 3UQAA 1ZBCA 1T11A 1EG4A 4Z2HA 2F2DA 1YATA 2IF4A 4C02B 1J4IA 2PPOA 1EHNA 1ZL1A 1Q6HA 2WK2A 1FJDA 3ARPA 1R9HA 3G6MA 2DWVA 2M8JA 3OOBA 2WLYA 1JMQA 2DT1A 4ODMA 1FKLA 3FXYA 1NWSA 1E6NA 2A3EA 1UR9A 4DH0A 2G8ZA 3UI6A 2M1IA 4DZ3A 2KFWA 2OFNA 4WKAA 1HXVA 5I98A 5DIUA 1J4RA 2O9OA 2XP3A 4P8VA 4ODNA 2A3BA 3O5KA 1WR7A 5B8IC 1NWUA 1D2KA 4Q22A 5E5WA 1FKJA 1E6PA 4LAYA 1BL4A 5GPRA 2DPEA 3JYMA 3ALGA 3CHCA 1WAWA 2LGOA 3PR9A 3CGNA 1JNSA 4DWSA 4R5EA 5BXJA 2JV4A 2XP6A 4MNJA 4MNKA 4REXA 4MSPA 1U79A 4TW6A 5HUAA 3NRKA 3MDYB 1ROUA 2YSIA 1TFVA 3CGMA 4MPKA 4DIPA 1K9QA 3FY1A 1EQ3A 4DROA 3ARXA 2DJYA 3UI5A 5HWCA 2LPVA 3RGCA 2LAJA 4A0TA 3B8SA 5DITA 3O5QA 1W9UA 1D7JA 1WMVA 4DRHA 4FN2A 3PA7A 4MGVA 1HJXA 1XRVA 2M2AA 2JZVA 3MQHA 3VAWA 1P5QA 1HJVA 3RFWA 3W4RA 1A7XA 5HBFA 4DRIA 2DG4A 1TR8A 3B7XA 3O5PA 1JNEA 1LL7A 2JX8A 2ZR5A 4DT4A 1EDQA 5HW6A 2XP4A 1ZBWA 2WM0A 3ARRA 4TW7A 2PV2A 4LAWA 1JNTA 4L72B 2XP8A 1GPFA 1FFQA 5HTGA 4ODKA 2MF9A 4A0UA 5DEZA 1PINA 2IUZA 3KAHA 1E15A 2DK1A 3ARUA 4JFIA 2KO7A 2OLHA 4IQCA 3ARSA 2PV3A 1RP5A 1W9VA 3WL0A 5DO2A 1EIBA 3KACA 3LE4A 2DSVA 2MLYA 3PRDA 4ODLA 1K9TA 1QZ2A 4U86A 1E9LA 3AS1A 3FS8A 1UR8A 4DRNA 4Q7NA 3RM4A 2WLZA 3O5DA 3KAFA 2L4JA 1ZB5A 2Y8NB 3EY6A 4TX0A 1F40A 2YAJB 4NNRA 1LG2A 2DT2A 3O5GA 2RQSA 2QF8A 3CZ8A 3UF8A 1XHGA 1GOIA 1PBKA 2MLXA 3ARTA 4XAKA 2DT3A 3AS3A 4ML4A 2ZQSA 3ARVA 3IK8A 2M08A 2LJ4A 4U84A 1ZCNA 1KT0A 1ZBKA 4TYOA 5GPGA 3FSBA 3M85A 3PQHA 4TW8A 3WD0A 1M5YA 1NH6A 4JFLA 4W9PA 3IKDA 4S3KA 4LAVA 1YW5A 1H0GA 1O6IA 1ITXA 1NMVA 3L4HA 5AHTA 3WIJA 1RD6A 1EYMA 4ZPVR 2YSFA 4DWSC 5JH8A 2YBTA 4GLXA 4Z2IA 2DSUA 2FDMA 2XP5A 4P8UA 1ZU8A 3O5JA 1OGGA 5HKGA 1FD9A 3UQBA 3CHFA 1FKHA 1W1TA 3AQUA 1FKKA 1HKMA 1FKFA 4MTVA 4P8XA 3AS2A 1VF8A 4URIA 3WKZA 1NSGA 2D9FA 2DG9A 3OA5A 4DWSB 4NSBA 1FLCA 3FAPA 1OGBA 2O92A 4IT4A 4Z2KA 1BKFA 4GIVA 3QOKA 3O5EA 4R0XA 4DRQA 5GQBA 4IPXA 3B9DA 4DRMA 3O5LA 2MDIA 5HW7A 2RUCA 2RUDA 4LAXA 2UZ5A 1SYTA 2Y78A 2WADA 4AY1A 2YBUA 3TC5A 1B6CA 2K8IA 2WAEA 2JXWA 4E5RA 2ZQTA 2PV1A 4JFMA 1J4HA 3TDBA 4ODQA 3LKXA 2RUQA 3FSCA 2BA1A 3PRBA 5J6EA 2KI3A 4W5UA 4WIWA 2PPNA 2XP9A 2YSGA 4JFKA 3UQIA 4W9QA 1X6NA 3H9RB 4G50A 3O5FA 1D7IA 1ROTA 2MPHA 2XPBA 1KFWA 2ZQVA 3LKXB 2DSZA 2VN1A 3AROA 1W1YA 3ARZA 1HKIA 3WD2A 1K9RA 5DIVA 2DSWA 4DWSD 1TK7A 1Q1CA 2DMVA 1W1PA 1X6LA 2OWOA 1HKJA 3CH9A 2MLZA 4ODPA 4ZS6A 4GGQA 4HBOA 2JMFA 3RM8A 3NI6A 2ZR6A 5U47A 1FKTA 3MCBA 2LKNA 2DG3A 3WH0A 1LL6A 3UI4A 4Z2LA 1I5HW 1FKRA 3RMEA 5D75A 4N19A 2F4EA 1FKSA 2QRVA 3MCBB 1FKIA 3CNGA 4ODRA 4QT3A 1D7HA 3AS0A 4NZCA 1Q6UA 5E64A 2DT0A 3MQGA 2RURA 4J4OA 4BF8A 5E62A 3O5OA 3NTPA 4JYSA 5HW8A 2N87A 2RE3A 4ZPTR 4W9OA 3WD3A 1IX5A 1FFRA 4IT6A 3WL1A 3KAGA 1W9PA 2PI6A 4Z2JA 3PRAA 3ARYA 1D6OA 2FKEA 3BXWA 4KQZA 1HJWA 3WQVA 1N1AA 1FKBA 3WD4A 3ARWA 1QPFA 1O6WA 1NMWA 1LQ0A 4WK9A 1NWRA 2ZR4A 2L2SA 1E6ZA 1NWTA 2MNTA 5CQ2A 4HARA 5HWBA 3WD1A 2M3OW 4S3JA 3O5IA 1C9HA 2ZAJA 2E45A 3GPKA 1W26A 3B9EA 2M8IA 1FAPA 4L3NA 1WNOA 2F21A 4HBEA 1QPLA 4ZPWR 1WB0A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2DK7 A;  1Q6I A;  3O5R A;  4TNS A;  2PBC A;  2VCD A;  1ZK6 A;  4G2P A;  3JXV A;  4DRK A;  3O5M A;  2FAP A;  1Y0O A;  2KGJ A;  3KZ7 A;  2XP7 A;  3LUO A;  4DRP A;  2KE0 A;  3KAI A;  4ITZ A;  1EG3 A;  2XPA A;  3M7N A;  4JFJ A;  4DZ2 A;  2KR7 A;  1FKD A;  2AWG A;  1FKG A;  4DRJ A;  3ODK A;  2YSH A;  1J6Y A;  5HT1 A;  4J4N A;  1F8A B;  1TCO C;  1L1P A;  2YSB A;  4ODO A;  1JVW A;  4QT2 A;  2ZQU A;  4QIB A;  3KAD A;  2ITK A;  2RSE A;  4U85 A;  3I6C A;  2EZ5 W;  2Q5A A;  1KT1 A;  3IHZ A;  4O2T A;  3KAB A;  4IQ2 A;  2KXQ A;  3IKG A;  4FAP A;  3JYJ A;  3KCE A;  3TCZ A;  2PPP A;  3UQA A;  1T11 A;  1EG4 A;  2F2D A;  1YAT A;  4C02 B;  2IF4 A;  1J4I A;  2PPO A;  1Q6H A;  1FJD A;  1R9H A;  2DWV A;  2M8J A;  3OOB A;  1JMQ A;  4ODM A;  1FKL A;  4DH0 A;  3UI6 A;  2M1I A;  4DZ3 A;  2KFW A;  2OFN A;  1HXV A;  5I98 A;  5DIU A;  1J4R A;  2XP3 A;  4ODN A;  3O5K A;  1WR7 A;  5B8I C;  1FKJ A;  4LAY A;  1BL4 A;  3JYM A;  2LGO A;  3CGN A;  1JNS A;  5BXJ A;  2JV4 A;  2XP6 A;  4REX A;  4MSP A;  1U79 A;  4TW6 A;  5HUA A;  3NRK A;  3MDY B;  1ROU A;  2YSI A;  3CGM A;  4DIP A;  1K9Q A;  1EQ3 A;  4DRO A;  5HWC A;  2DJY A;  3UI5 A;  2LPV A;  3RGC A;  2LAJ A;  5DIT A;  3O5Q A;  1D7J A;  1WMV A;  4DRH A;  4FN2 A;  3PA7 A;  4MGV A;  2M2A A;  2JZV A;  3VAW A;  1P5Q A;  3RFW A;  1A7X A;  4DRI A;  2DG4 A;  3O5P A;  3B7X A;  2JX8 A;  2ZR5 A;  4DT4 A;  5HW6 A;  2XP4 A;  4TW7 A;  2PV2 A;  4LAW A;  1JNT A;  2XP8 A;  5HTG A;  4ODK A;  2MF9 A;  1PIN A;  4JFI A;  3KAH A;  2DK1 A;  2KO7 A;  4IQC A;  2PV3 A;  3KAC A;  3LE4 A;  2MLY A;  3PRD A;  4ODL A;  1QZ2 A;  4U86 A;  4DRN A;  3O5D A;  3KAF A;  2L4J A;  4TX0 A;  3EY6 A;  1F40 A;  4NNR A;  3O5G A;  2RQS A;  3UF8 A;  2MLX A;  1PBK A;  2ZQS A;  3IK8 A;  2M08 A;  2LJ4 A;  4U84 A;  1ZCN A;  1KT0 A;  4TYO A;  5GPG A;  3M85 A;  4TW8 A;  1M5Y A;  4JFL A;  4W9P A;  3IKD A;  4LAV A;  1YW5 A;  1NMV A;  3L4H A;  5AHT A;  1EYM A;  2YSF A;  2XP5 A;  3O5J A;  5HKG A;  1FD9 A;  3UQB A;  1FKH A;  1FKK A;  1FKF A;  1NSG A;  2D9F A;  2DG9 A;  3FAP A;  1BKF A;  4GIV A;  3O5E A;  4R0X A;  4DRQ A;  4IPX A;  4DRM A;  3O5L A;  2MDI A;  5HW7 A;  2RUC A;  2RUD A;  4LAX A;  2UZ5 A;  2Y78 A;  3TC5 A;  1B6C A;  2K8I A;  2JXW A;  4E5R A;  2ZQT A;  2PV1 A;  4JFM A;  1J4H A;  3TDB A;  4ODQ A;  2RUQ A;  2BA1 A;  3PRB A;  5J6E A;  2KI3 A;  2PPN A;  2XP9 A;  2YSG A;  4JFK A;  3UQI A;  4W9Q A;  3H9R B;  4G50 A;  3O5F A;  1D7I A;  1ROT A;  2MPH A;  2XPB A;  2VN1 A;  2ZQV A;  1K9R A;  5DIV A;  1TK7 A;  1Q1C A;  2DMV A;  2MLZ A;  4ODP A;  4GGQ A;  2JMF A;  3NI6 A;  2ZR6 A;  1FKT A;  2LKN A;  2DG3 A;  3WH0 A;  3UI4 A;  1I5H W;  1FKR A;  5D75 A;  4N19 A;  2F4E A;  1FKS A;  1FKI A;  3CNG A;  4ODR A;  4QT3 A;  1D7H A;  1Q6U A;  4BF8 A;  2RUR A;  4J4O A;  3O5O A;  3NTP A;  4JYS A;  5HW8 A;  2N87 A;  2RE3 A;  4W9O A;  3KAG A;  1D6O A;  2FKE A;  1N1A A;  1FKB A;  1QPF A;  1O6W A;  1NMW A;  2ZR4 A;  2L2S A;  2MNT A;  5CQ2 A;  5HWB A;  2M3O W;  3O5I A;  1C9H A;  2ZAJ A;  2E45 A;  3GPK A;  1W26 A;  2M8I A;  1FAP A;  2F21 A;  1QPL A; 
#chains in the Genus database with same CATH topology
 4LGX A;  2DK7 A;  1OWQ A;  1Q6I A;  4KR0 B;  4WJX A;  3O5R A;  4TNS A;  4P8W A;  2PBC A;  2VCD A;  1LG1 A;  1ZK6 A;  4G2P A;  3EIP A;  3JXV A;  4DRK A;  3O5M A;  4WKF A;  2FAP A;  1Y0O A;  2KGJ A;  3KZ7 A;  2XP7 A;  4Z2G A;  3LUO A;  1JND A;  4DRP A;  2P4V A;  2KE0 A;  3KAI A;  4ITZ A;  1EG3 A;  2G41 A;  3CHE A;  1E6R A;  3ARQ A;  2XPA A;  3M7N A;  4JFJ A;  1GUV A;  4DZ2 A;  2KR7 A;  1H0I A;  1FKD A;  2A3C A;  2AWG A;  4MNL A;  1FKG A;  3WQW A;  4DRJ A;  3ODK A;  2YSH A;  4MNM A;  1J6Y A;  5HT1 A;  4J4N A;  3RM9 A;  1F8A B;  1TCO C;  2ESC A;  1L1P A;  2YSB A;  5E65 A;  1CTN A;  4ODO A;  3B9A A;  3ALF A;  4QZV B;  5E66 A;  1JVW A;  4QT2 A;  1SR0 A;  4MAV A;  3CHD A;  2ETN A;  2ZQU A;  1ZBV A;  1W1V A;  4QIB A;  3KAD A;  4WKH A;  2ITK A;  2RSE A;  4U85 A;  3I6C A;  2EZ5 W;  2Q5A A;  1KT1 A;  3IHZ A;  4PTM A;  1HKK A;  4O2T A;  1LJY A;  3KAB A;  4IQ2 A;  3G6L A;  5DF0 A;  2KXQ A;  3IKG A;  4FAP A;  2A3A A;  2AOS A;  3JYJ A;  2B31 A;  3KCE A;  3TCZ A;  1LL4 A;  2PPP A;  3UQA A;  1ZBC A;  1T11 A;  1EG4 A;  4Z2H A;  2F2D A;  1YAT A;  2IF4 A;  4C02 B;  1J4I A;  2PPO A;  1EHN A;  1ZL1 A;  1Q6H A;  2WK2 A;  1FJD A;  3ARP A;  1R9H A;  3G6M A;  2DWV A;  2M8J A;  3OOB A;  2WLY A;  1JMQ A;  2DT1 A;  4ODM A;  1JCH B;  1FKL A;  3FXY A;  1NWS A;  1E6N A;  2A3E A;  1UR9 A;  2F23 A;  4DH0 A;  2G8Z A;  3UI6 A;  2M1I A;  4DZ3 A;  2KFW A;  2OFN A;  4WKA A;  2PN0 A;  1HXV A;  5I98 A;  5DIU A;  1J4R A;  2O9O A;  2XP3 A;  4P8V A;  4ODN A;  2A3B A;  3O5K A;  1WR7 A;  5B8I C;  1NWU A;  1D2K A;  4Q22 A;  5E5W A;  1FKJ A;  1E6P A;  4LAY A;  1BL4 A;  5GPR A;  2DPE A;  3JYM A;  3ALG A;  3CHC A;  1WAW A;  2LGO A;  3PR9 A;  3CGN A;  1JNS A;  4DWS A;  4R5E A;  5BXJ A;  2JV4 A;  2XP6 A;  4MNJ A;  4MNK A;  4REX A;  4MSP A;  1U79 A;  4TW6 A;  5HUA A;  3NRK A;  3MDY B;  1ROU A;  2YSI A;  1TFV A;  3CGM A;  4MPK A;  4DIP A;  1K9Q A;  3FY1 A;  1EQ3 A;  4DRO A;  3ARX A;  2DJY A;  3UI5 A;  5HWC A;  2LPV A;  3RGC A;  2LAJ A;  4A0T A;  3B8S A;  5DIT A;  3O5Q A;  1W9U A;  1D7J A;  1WMV A;  4DRH A;  4FN2 A;  3PA7 A;  4MGV A;  1HJX A;  1XRV A;  2M2A A;  2JZV A;  3MQH A;  3VAW A;  1P5Q A;  1HJV A;  3RFW A;  3W4R A;  1A7X A;  5HBF A;  4DRI A;  2DG4 A;  1TR8 A;  3B7X A;  3O5P A;  1JNE A;  1LL7 A;  2JX8 A;  2ZR5 A;  4DT4 A;  1EDQ A;  5HW6 A;  2XP4 A;  1ZBW A;  2WM0 A;  3ARR A;  4TW7 A;  2PV2 A;  4LAW A;  1JNT A;  4L72 B;  2XP8 A;  1GPF A;  1FFQ A;  5HTG A;  4ODK A;  2MF9 A;  4A0U A;  4UDM A;  5DEZ A;  1PIN A;  2IUZ A;  3KAH A;  1E15 A;  2DK1 A;  3ARU A;  4JFI A;  2KO7 A;  2OLH A;  4IQC A;  3ARS A;  2PV3 A;  1RP5 A;  1W9V A;  3WL0 A;  5DO2 A;  1EIB A;  3KAC A;  3LE4 A;  2DSV A;  2MLY A;  3PRD A;  4ODL A;  1GRJ A;  1K9T A;  2EUL A;  1QZ2 A;  4U86 A;  1E9L A;  3AS1 A;  3FS8 A;  1UR8 A;  4DRN A;  4Q7N A;  3RM4 A;  2WLZ A;  3O5D A;  3KAF A;  2L4J A;  1ZB5 A;  2Y8N B;  3EY6 A;  4TX0 A;  1F40 A;  2YAJ B;  4NNR A;  1LG2 A;  2DT2 A;  3O5G A;  2RQS A;  2QF8 A;  3CZ8 A;  3UF8 A;  1XHG A;  1GOI A;  1PBK A;  2MLX A;  3ART A;  4XAK A;  2DT3 A;  3AS3 A;  4ML4 A;  2ZQS A;  3ARV A;  3IK8 A;  2M08 A;  2LJ4 A;  4U84 A;  3GTY X;  1ZCN A;  1KT0 A;  1ZBK A;  4TYO A;  5GPG A;  3FSB A;  3M85 A;  3PQH A;  4TW8 A;  3WD0 A;  1M5Y A;  1NH6 A;  4JFL A;  4W9P A;  3IKD A;  4S3K A;  4LAV A;  1YW5 A;  1H0G A;  1O6I A;  1ITX A;  1NMV A;  3L4H A;  5AHT A;  3WIJ A;  1RD6 A;  1EYM A;  4ZPV R;  2YSF A;  4DWS C;  5JH8 A;  2YBT A;  4GLX A;  4Z2I A;  2DSU A;  2FDM A;  2XP5 A;  4P8U A;  1ZU8 A;  3O5J A;  1OGG A;  5HKG A;  1FD9 A;  2B5U B;  3UQB A;  3CHF A;  1FKH A;  1W1T A;  3AQU A;  1FKK A;  1HKM A;  1FKF A;  4MTV A;  4P8X A;  3AS2 A;  1VF8 A;  4URI A;  3WKZ A;  1NSG A;  2D9F A;  2DG9 A;  3OA5 A;  4DWS B;  4NSB A;  1FLC A;  3FAP A;  1OGB A;  2O92 A;  4IT4 A;  4Z2K A;  1BKF A;  4GIV A;  3QOK A;  3O5E A;  4R0X A;  4DRQ A;  5GQB A;  4IPX A;  3B9D A;  4DRM A;  3O5L A;  2MDI A;  5HW7 A;  3GU0 A;  2RUC A;  2RUD A;  4LAX A;  2UZ5 A;  1SYT A;  2Y78 A;  2WAD A;  4AY1 A;  2YBU A;  3TC5 A;  1B6C A;  2K8I A;  2WAE A;  2JXW A;  4E5R A;  2ZQT A;  2PV1 A;  4JFM A;  1J4H A;  3TDB A;  4ODQ A;  3LKX A;  2RUQ A;  3FSC A;  2BA1 A;  3PRB A;  5J6E A;  2KI3 A;  4W5U A;  4WIW A;  2PPN A;  2XP9 A;  2YSG A;  4JFK A;  3UQI A;  4W9Q A;  1X6N A;  3H9R B;  4G50 A;  3O5F A;  1D7I A;  1ROT A;  2MPH A;  2XPB A;  1KFW A;  2ZQV A;  3LKX B;  2DSZ A;  2VN1 A;  3ARO A;  1W1Y A;  3ARZ A;  1HKI A;  3BMB A;  3WD2 A;  1K9R A;  5DIV A;  2DSW A;  4DWS D;  1TK7 A;  1Q1C A;  2DMV A;  1W1P A;  1X6L A;  2OWO A;  1HKJ A;  3CH9 A;  2MLZ A;  4ODP A;  4ZS6 A;  4GGQ A;  4HBO A;  2JMF A;  3RM8 A;  3NI6 A;  2ZR6 A;  5U47 A;  1FKT A;  3MCB A;  2LKN A;  2DG3 A;  3WH0 A;  1LL6 A;  3UI4 A;  4Z2L A;  1I5H W;  1FKR A;  3RME A;  5D75 A;  4N19 A;  2F4E A;  1FKS A;  2QRV A;  3MCB B;  1FKI A;  3CNG A;  4ODR A;  4QT3 A;  1D7H A;  3AS0 A;  4NZC A;  1Q6U A;  5E64 A;  2DT0 A;  1E44 A;  3MQG A;  2RUR A;  4J4O A;  4BF8 A;  5E62 A;  3O5O A;  3NTP A;  4JYS A;  5HW8 A;  2N87 A;  2RE3 A;  4ZPT R;  4W9O A;  3WD3 A;  1IX5 A;  1FFR A;  4IT6 A;  3WL1 A;  3KAG A;  1W9P A;  2PI6 A;  4Z2J A;  3PRA A;  3ARY A;  1D6O A;  2FKE A;  3BXW A;  4KQZ A;  1HJW A;  3WQV A;  1N1A A;  1FKB A;  3WD4 A;  3ARW A;  1QPF A;  1O6W A;  1NMW A;  1LQ0 A;  4WK9 A;  1NWR A;  2ZR4 A;  2L2S A;  1E6Z A;  1NWT A;  2MNT A;  5CQ2 A;  4HAR A;  5HWB A;  3WD1 A;  2M3O W;  4S3J A;  3O5I A;  1C9H A;  2ZAJ A;  2E45 A;  3GPK A;  1W26 A;  3B9E A;  2M8I A;  1FAP A;  4L3N A;  1WNO A;  2F21 A;  4HBE A;  1QPL A;  4ZPW R;  1WB0 A; 
#chains in the Genus database with same CATH homology
 4LGX A;  2DK7 A;  1OWQ A;  1Q6I A;  4KR0 B;  4WJX A;  3O5R A;  4TNS A;  4P8W A;  2PBC A;  2VCD A;  1LG1 A;  1ZK6 A;  4G2P A;  3JXV A;  4DRK A;  3O5M A;  4WKF A;  2FAP A;  1Y0O A;  2KGJ A;  3KZ7 A;  2XP7 A;  4Z2G A;  3LUO A;  1JND A;  4DRP A;  2KE0 A;  3KAI A;  4ITZ A;  1EG3 A;  2G41 A;  3CHE A;  1E6R A;  3ARQ A;  2XPA A;  3M7N A;  4JFJ A;  1GUV A;  4DZ2 A;  2KR7 A;  1H0I A;  1FKD A;  2A3C A;  2AWG A;  4MNL A;  1FKG A;  3WQW A;  4DRJ A;  3ODK A;  2YSH A;  4MNM A;  1J6Y A;  5HT1 A;  4J4N A;  3RM9 A;  1F8A B;  1TCO C;  2ESC A;  1L1P A;  2YSB A;  5E65 A;  1CTN A;  4ODO A;  3B9A A;  3ALF A;  4QZV B;  5E66 A;  1JVW A;  4QT2 A;  1SR0 A;  4MAV A;  3CHD A;  2ZQU A;  1ZBV A;  1W1V A;  4QIB A;  3KAD A;  4WKH A;  2ITK A;  2RSE A;  4U85 A;  3I6C A;  2EZ5 W;  2Q5A A;  1KT1 A;  3IHZ A;  4PTM A;  1HKK A;  4O2T A;  1LJY A;  3KAB A;  4IQ2 A;  3G6L A;  5DF0 A;  2KXQ A;  3IKG A;  4FAP A;  2A3A A;  2AOS A;  3JYJ A;  2B31 A;  3KCE A;  3TCZ A;  1LL4 A;  2PPP A;  3UQA A;  1ZBC A;  1T11 A;  1EG4 A;  4Z2H A;  2F2D A;  1YAT A;  2IF4 A;  4C02 B;  1J4I A;  2PPO A;  1EHN A;  1ZL1 A;  1Q6H A;  2WK2 A;  1FJD A;  3ARP A;  1R9H A;  3G6M A;  2DWV A;  2M8J A;  3OOB A;  2WLY A;  1JMQ A;  2DT1 A;  4ODM A;  1FKL A;  3FXY A;  1NWS A;  1E6N A;  2A3E A;  1UR9 A;  4DH0 A;  2G8Z A;  3UI6 A;  2M1I A;  4DZ3 A;  2KFW A;  2OFN A;  4WKA A;  1HXV A;  5I98 A;  5DIU A;  1J4R A;  2O9O A;  2XP3 A;  4P8V A;  4ODN A;  2A3B A;  3O5K A;  1WR7 A;  5B8I C;  1NWU A;  1D2K A;  4Q22 A;  5E5W A;  1FKJ A;  1E6P A;  4LAY A;  1BL4 A;  5GPR A;  2DPE A;  3JYM A;  3ALG A;  3CHC A;  1WAW A;  2LGO A;  3PR9 A;  3CGN A;  1JNS A;  4DWS A;  4R5E A;  5BXJ A;  2JV4 A;  2XP6 A;  4MNJ A;  4MNK A;  4REX A;  4MSP A;  1U79 A;  4TW6 A;  5HUA A;  3NRK A;  3MDY B;  1ROU A;  2YSI A;  1TFV A;  3CGM A;  4MPK A;  4DIP A;  1K9Q A;  3FY1 A;  1EQ3 A;  4DRO A;  3ARX A;  2DJY A;  3UI5 A;  5HWC A;  2LPV A;  3RGC A;  2LAJ A;  4A0T A;  3B8S A;  5DIT A;  3O5Q A;  1W9U A;  1D7J A;  1WMV A;  4DRH A;  4FN2 A;  3PA7 A;  4MGV A;  1HJX A;  1XRV A;  2M2A A;  2JZV A;  3MQH A;  3VAW A;  1P5Q A;  1HJV A;  3RFW A;  3W4R A;  1A7X A;  5HBF A;  4DRI A;  2DG4 A;  1TR8 A;  3B7X A;  3O5P A;  1JNE A;  1LL7 A;  2JX8 A;  2ZR5 A;  4DT4 A;  1EDQ A;  5HW6 A;  2XP4 A;  1ZBW A;  2WM0 A;  3ARR A;  4TW7 A;  2PV2 A;  4LAW A;  1JNT A;  4L72 B;  2XP8 A;  1GPF A;  1FFQ A;  5HTG A;  4ODK A;  2MF9 A;  4A0U A;  5DEZ A;  1PIN A;  2IUZ A;  3KAH A;  1E15 A;  2DK1 A;  3ARU A;  4JFI A;  2KO7 A;  2OLH A;  4IQC A;  3ARS A;  2PV3 A;  1RP5 A;  1W9V A;  3WL0 A;  5DO2 A;  1EIB A;  3KAC A;  3LE4 A;  2DSV A;  2MLY A;  3PRD A;  4ODL A;  1K9T A;  1QZ2 A;  4U86 A;  1E9L A;  3AS1 A;  3FS8 A;  1UR8 A;  4DRN A;  4Q7N A;  3RM4 A;  2WLZ A;  3O5D A;  3KAF A;  2L4J A;  1ZB5 A;  2Y8N B;  3EY6 A;  4TX0 A;  1F40 A;  2YAJ B;  4NNR A;  1LG2 A;  2DT2 A;  3O5G A;  2RQS A;  2QF8 A;  3CZ8 A;  3UF8 A;  1XHG A;  1GOI A;  1PBK A;  2MLX A;  3ART A;  4XAK A;  2DT3 A;  3AS3 A;  4ML4 A;  2ZQS A;  3ARV A;  3IK8 A;  2M08 A;  2LJ4 A;  4U84 A;  1ZCN A;  1KT0 A;  1ZBK A;  4TYO A;  5GPG A;  3FSB A;  3M85 A;  3PQH A;  4TW8 A;  3WD0 A;  1M5Y A;  1NH6 A;  4JFL A;  4W9P A;  3IKD A;  4S3K A;  4LAV A;  1YW5 A;  1H0G A;  1O6I A;  1ITX A;  1NMV A;  3L4H A;  5AHT A;  3WIJ A;  1RD6 A;  1EYM A;  4ZPV R;  2YSF A;  4DWS C;  5JH8 A;  2YBT A;  4GLX A;  4Z2I A;  2DSU A;  2FDM A;  2XP5 A;  4P8U A;  1ZU8 A;  3O5J A;  1OGG A;  5HKG A;  1FD9 A;  3UQB A;  3CHF A;  1FKH A;  1W1T A;  3AQU A;  1FKK A;  1HKM A;  1FKF A;  4MTV A;  4P8X A;  3AS2 A;  1VF8 A;  4URI A;  3WKZ A;  1NSG A;  2D9F A;  2DG9 A;  3OA5 A;  4DWS B;  4NSB A;  1FLC A;  3FAP A;  1OGB A;  2O92 A;  4IT4 A;  4Z2K A;  1BKF A;  4GIV A;  3QOK A;  3O5E A;  4R0X A;  4DRQ A;  5GQB A;  4IPX A;  3B9D A;  4DRM A;  3O5L A;  2MDI A;  5HW7 A;  2RUC A;  2RUD A;  4LAX A;  2UZ5 A;  1SYT A;  2Y78 A;  2WAD A;  4AY1 A;  2YBU A;  3TC5 A;  1B6C A;  2K8I A;  2WAE A;  2JXW A;  4E5R A;  2ZQT A;  2PV1 A;  4JFM A;  1J4H A;  3TDB A;  4ODQ A;  3LKX A;  2RUQ A;  3FSC A;  2BA1 A;  3PRB A;  5J6E A;  2KI3 A;  4W5U A;  4WIW A;  2PPN A;  2XP9 A;  2YSG A;  4JFK A;  3UQI A;  4W9Q A;  1X6N A;  3H9R B;  4G50 A;  3O5F A;  1D7I A;  1ROT A;  2MPH A;  2XPB A;  1KFW A;  2ZQV A;  3LKX B;  2DSZ A;  2VN1 A;  3ARO A;  1W1Y A;  3ARZ A;  1HKI A;  3WD2 A;  1K9R A;  5DIV A;  2DSW A;  4DWS D;  1TK7 A;  1Q1C A;  2DMV A;  1W1P A;  1X6L A;  2OWO A;  1HKJ A;  3CH9 A;  2MLZ A;  4ODP A;  4ZS6 A;  4GGQ A;  4HBO A;  2JMF A;  3RM8 A;  3NI6 A;  2ZR6 A;  5U47 A;  1FKT A;  3MCB A;  2LKN A;  2DG3 A;  3WH0 A;  1LL6 A;  3UI4 A;  4Z2L A;  1I5H W;  1FKR A;  3RME A;  5D75 A;  4N19 A;  2F4E A;  1FKS A;  2QRV A;  3MCB B;  1FKI A;  3CNG A;  4ODR A;  4QT3 A;  1D7H A;  3AS0 A;  4NZC A;  1Q6U A;  5E64 A;  2DT0 A;  3MQG A;  2RUR A;  4J4O A;  4BF8 A;  5E62 A;  3O5O A;  3NTP A;  4JYS A;  5HW8 A;  2N87 A;  2RE3 A;  4ZPT R;  4W9O A;  3WD3 A;  1IX5 A;  1FFR A;  4IT6 A;  3WL1 A;  3KAG A;  1W9P A;  2PI6 A;  4Z2J A;  3PRA A;  3ARY A;  1D6O A;  2FKE A;  3BXW A;  4KQZ A;  1HJW A;  3WQV A;  1N1A A;  1FKB A;  3WD4 A;  3ARW A;  1QPF A;  1O6W A;  1NMW A;  1LQ0 A;  4WK9 A;  1NWR A;  2ZR4 A;  2L2S A;  1E6Z A;  1NWT A;  2MNT A;  5CQ2 A;  4HAR A;  5HWB A;  3WD1 A;  2M3O W;  4S3J A;  3O5I A;  1C9H A;  2ZAJ A;  2E45 A;  3GPK A;  1W26 A;  3B9E A;  2M8I A;  1FAP A;  4L3N A;  1WNO A;  2F21 A;  4HBE A;  1QPL A;  4ZPW R;  1WB0 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...