2M3OW

Structure and dynamics of a human nedd4 ww domain-enac complex
Total Genus 4
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
4
sequence length
43
structure length
43
Chain Sequence
GSMEQGFLPKGWEVRHAPNGRPFFIDHNTKTTTWEDPRLKIPA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Peptide binding protein/protein binding
molecule keywords E3 ubiquitin-protein ligase NEDD4
publication title Structure and dynamics of human Nedd4-1 WW3 in complex with the alpha ENaC PY motif.
pubmed doi rcsb
source organism Homo sapiens
total genus 4
structure length 43
sequence length 43
ec nomenclature ec 2.3.2.26: HECT-type E3 ubiquitin transferase.
pdb deposition date 2013-01-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
W PF00397 WW WW domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.20.70.10 Mainly Beta Single Sheet Ubiquitin Ligase Nedd4; Chain: W; Ubiquitin Ligase Nedd4; Chain: W; 2m3oW01
4U84A 3LE4A 3KAGA 2YSHA 2DK7A 5CQ2A 1K9RA 2ZQVA 4REXA 2YSFA 3TDBA 2XP8A 2JXWA 2XPBA 1NMVA 3M85A 1K9QA 3TC5A 1JMQA 3L4HA 2ITKA 2LAJA 2M3OW 2F21A 2YSGA 2XP3A 2XP4A 2JMFA 2DJYA 2ZAJA 1TK7A 2ZR4A 3NTPA 2XP5A 1EG4A 2BA1A 2RE3A 2M8IA 3KADA 3KAFA 3ODKA 5AHTA 2XP6A 2M8JA 2JX8A 3M7NA 2EZ5W 3KCEA 2DMVA 1EG3A 1PINA 2Q5AA 3OOBA 2ZR5A 2L4JA 1YW5A 4U86A 2XP7A 2XPAA 2YSIA 1ZCNA 4U85A 3TCZA 2DWVA 1I5HW 2YSBA 2ZQUA 2ZR6A 2MDIA 3KAHA 1WR7A 2XP9A 2DK1A 3CNGA 1WMVA 3KABA 2JV4A 2KXQA 2E45A 4QIBA 1O6WA 3KAIA 4E5RA 1F8AB 2ZQSA 3WH0A 2ZQTA
chains in the Genus database with same CATH superfamily
4U84A 3LE4A 3KAGA 2YAJB 2YSHA 2DK7A 5CQ2A 1K9RA 2ZQVA 4REXA 2YSFA 3TDBA 5E5WA 2XP8A 2JXWA 2XPBA 1NMVA 3M85A 1K9QA 3TC5A 3FS8A 1JMQA 3L4HA 5E64A 2ITKA 2LAJA 2M3OW 2F21A 2YSGA 2XP3A 2OWOA 2XP4A 2JMFA 2DJYA 2ZAJA 1TK7A 3LKXA 3MQHA 2ZR4A 3NTPA 4A0TA 2XP5A 1EG4A 2BA1A 2RE3A 3LKXB 1RP5A 2M8IA 3KADA 3KAFA 3ODKA 1FLCA 5AHTA 2XP6A 2M8JA 2JX8A 2WADA 3M7NA 2EZ5W 3FSCA 3KCEA 5U47A 2Y8NB 2DMVA 5E65A 1EG3A 1PINA 2Q5AA 3OOBA 2WAEA 2L4JA 2ZR5A 3MQGA 1YW5A 4A0UA 4U86A 5E62A 2XP7A 2XPAA 3MCBB 2YSIA 2QRVA 1ZCNA 4U85A 3TCZA 5E66A 2DWVA 1I5HW 2YSBA 2ZQUA 2ZR6A 2MDIA 3KAHA 1WR7A 2XP9A 2DK1A 3CNGA 1WMVA 3KABA 2JV4A 2KXQA 3MCBA 2E45A 1TR8A 4QIBA 4GLXA 1O6WA 3KAIA 4E5RA 1F8AB 2ZQSA 3WH0A 2ZQTA 3PQHA 3FSBA
chains in the Genus database with same CATH topology
4U84A 3LE4A 3KAGA 2YAJB 2YSHA 2DK7A 5CQ2A 1K9RA 2ZQVA 4REXA 2YSFA 3TDBA 5E5WA 2XP8A 2JXWA 2XPBA 1NMVA 3M85A 1K9QA 3TC5A 3FS8A 1JMQA 3L4HA 5E64A 2ITKA 2LAJA 2M3OW 2F21A 2YSGA 2XP3A 2OWOA 2XP4A 2JMFA 2DJYA 2ZAJA 1TK7A 3LKXA 3MQHA 2ZR4A 3NTPA 4A0TA 2XP5A 1EG4A 2BA1A 2RE3A 3LKXB 1RP5A 2M8IA 3KADA 3KAFA 3ODKA 1FLCA 5AHTA 2XP6A 2M8JA 2JX8A 2WADA 3M7NA 2EZ5W 3FSCA 3KCEA 5U47A 2Y8NB 2DMVA 5E65A 1EG3A 1PINA 2Q5AA 3OOBA 2WAEA 2L4JA 2ZR5A 3MQGA 1YW5A 4A0UA 4U86A 5E62A 2XP7A 2XPAA 3MCBB 2YSIA 2QRVA 1ZCNA 4U85A 3TCZA 5E66A 2DWVA 1I5HW 2YSBA 2ZQUA 2ZR6A 2MDIA 3KAHA 1WR7A 2XP9A 2DK1A 3CNGA 1WMVA 3KABA 2JV4A 2KXQA 3MCBA 2E45A 1TR8A 4QIBA 4GLXA 1O6WA 3KAIA 4E5RA 1F8AB 2ZQSA 3WH0A 2ZQTA 3PQHA 3FSBA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4U84 A;  3LE4 A;  3KAG A;  2YSH A;  2DK7 A;  5CQ2 A;  1K9R A;  2ZQV A;  4REX A;  2YSF A;  3TDB A;  2XP8 A;  2JXW A;  2XPB A;  1NMV A;  3M85 A;  1K9Q A;  3TC5 A;  1JMQ A;  3L4H A;  2ITK A;  2LAJ A;  2M3O W;  2F21 A;  2YSG A;  2XP3 A;  2XP4 A;  2JMF A;  2DJY A;  2ZAJ A;  1TK7 A;  2ZR4 A;  3NTP A;  2XP5 A;  1EG4 A;  2BA1 A;  2RE3 A;  2M8I A;  3KAD A;  3KAF A;  3ODK A;  5AHT A;  2XP6 A;  2M8J A;  2JX8 A;  3M7N A;  2EZ5 W;  3KCE A;  2DMV A;  1EG3 A;  1PIN A;  2Q5A A;  3OOB A;  2ZR5 A;  2L4J A;  1YW5 A;  4U86 A;  2XP7 A;  2XPA A;  2YSI A;  1ZCN A;  4U85 A;  3TCZ A;  2DWV A;  1I5H W;  2YSB A;  2ZQU A;  2ZR6 A;  2MDI A;  3KAH A;  1WR7 A;  2XP9 A;  2DK1 A;  3CNG A;  1WMV A;  3KAB A;  2JV4 A;  2KXQ A;  2E45 A;  4QIB A;  1O6W A;  3KAI A;  4E5R A;  1F8A B;  2ZQS A;  3WH0 A;  2ZQT A; 
#chains in the Genus database with same CATH topology
 4U84 A;  3LE4 A;  3KAG A;  2YAJ B;  2YSH A;  2DK7 A;  5CQ2 A;  1K9R A;  2ZQV A;  4REX A;  2YSF A;  3TDB A;  5E5W A;  2XP8 A;  2JXW A;  2XPB A;  1NMV A;  3M85 A;  1K9Q A;  3TC5 A;  3FS8 A;  1JMQ A;  3L4H A;  5E64 A;  2ITK A;  2LAJ A;  2M3O W;  2F21 A;  2YSG A;  2XP3 A;  2OWO A;  2XP4 A;  2JMF A;  2DJY A;  2ZAJ A;  1TK7 A;  3LKX A;  3MQH A;  2ZR4 A;  3NTP A;  4A0T A;  2XP5 A;  1EG4 A;  2BA1 A;  2RE3 A;  3LKX B;  1RP5 A;  2M8I A;  3KAD A;  3KAF A;  3ODK A;  1FLC A;  5AHT A;  2XP6 A;  2M8J A;  2JX8 A;  2WAD A;  3M7N A;  2EZ5 W;  3FSC A;  3KCE A;  5U47 A;  2Y8N B;  2DMV A;  5E65 A;  1EG3 A;  1PIN A;  2Q5A A;  3OOB A;  2WAE A;  2L4J A;  2ZR5 A;  3MQG A;  1YW5 A;  4A0U A;  4U86 A;  5E62 A;  2XP7 A;  2XPA A;  3MCB B;  2YSI A;  2QRV A;  1ZCN A;  4U85 A;  3TCZ A;  5E66 A;  2DWV A;  1I5H W;  2YSB A;  2ZQU A;  2ZR6 A;  2MDI A;  3KAH A;  1WR7 A;  2XP9 A;  2DK1 A;  3CNG A;  1WMV A;  3KAB A;  2JV4 A;  2KXQ A;  3MCB A;  2E45 A;  1TR8 A;  4QIB A;  4GLX A;  1O6W A;  3KAI A;  4E5R A;  1F8A B;  2ZQS A;  3WH0 A;  2ZQT A;  3PQH A;  3FSB A; 
#chains in the Genus database with same CATH homology
 4U84 A;  3LE4 A;  3KAG A;  2YAJ B;  2YSH A;  2DK7 A;  5CQ2 A;  1K9R A;  2ZQV A;  4REX A;  2YSF A;  3TDB A;  5E5W A;  2XP8 A;  2JXW A;  2XPB A;  1NMV A;  3M85 A;  1K9Q A;  3TC5 A;  3FS8 A;  1JMQ A;  3L4H A;  5E64 A;  2ITK A;  2LAJ A;  2M3O W;  2F21 A;  2YSG A;  2XP3 A;  2OWO A;  2XP4 A;  2JMF A;  2DJY A;  2ZAJ A;  1TK7 A;  3LKX A;  3MQH A;  2ZR4 A;  3NTP A;  4A0T A;  2XP5 A;  1EG4 A;  2BA1 A;  2RE3 A;  3LKX B;  1RP5 A;  2M8I A;  3KAD A;  3KAF A;  3ODK A;  1FLC A;  5AHT A;  2XP6 A;  2M8J A;  2JX8 A;  2WAD A;  3M7N A;  2EZ5 W;  3FSC A;  3KCE A;  5U47 A;  2Y8N B;  2DMV A;  5E65 A;  1EG3 A;  1PIN A;  2Q5A A;  3OOB A;  2WAE A;  2L4J A;  2ZR5 A;  3MQG A;  1YW5 A;  4A0U A;  4U86 A;  5E62 A;  2XP7 A;  2XPA A;  3MCB B;  2YSI A;  2QRV A;  1ZCN A;  4U85 A;  3TCZ A;  5E66 A;  2DWV A;  1I5H W;  2YSB A;  2ZQU A;  2ZR6 A;  2MDI A;  3KAH A;  1WR7 A;  2XP9 A;  2DK1 A;  3CNG A;  1WMV A;  3KAB A;  2JV4 A;  2KXQ A;  3MCB A;  2E45 A;  1TR8 A;  4QIB A;  4GLX A;  1O6W A;  3KAI A;  4E5R A;  1F8A B;  2ZQS A;  3WH0 A;  2ZQT A;  3PQH A;  3FSB A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...