2M3OW

Structure and dynamics of a human nedd4 ww domain-enac complex
Total Genus 4
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
4
sequence length
43
structure length
43
Chain Sequence
GSMEQGFLPKGWEVRHAPNGRPFFIDHNTKTTTWEDPRLKIPA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords E3 ubiquitin-protein ligase NEDD4
publication title Structure and dynamics of human Nedd4-1 WW3 in complex with the alpha ENaC PY motif.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Peptide binding protein/protein binding
total genus 4
structure length 43
sequence length 43
ec nomenclature ec 2.3.2.26: HECT-type E3 ubiquitin transferase.
pdb deposition date 2013-01-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
W PF00397 WW WW domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.20.70.10 Mainly Beta Single Sheet Ubiquitin Ligase Nedd4; Chain: W; Ubiquitin Ligase Nedd4; Chain: W; 2m3oW01
2XPAA 3NTPA 2YSBA 2YSIA 1JMQA 2ZAJA 2KXQA 2ITKA 3L4HA 2YSHA 4REXA 1I5HW 2ZR4A 1WR7A 2M8IA 1YW5A 3KAFA 1K9QA 1F8AB 4U86A 4E5RA 2EZ5W 2XP4A 3KAIA 3CNGA 2ZR5A 2DWVA 5AHTA 2ZQUA 2YSGA 2BA1A 3KAHA 3WH0A 2DMVA 2XP6A 1ZCNA 2L4JA 2E45A 2M8JA 2ZQTA 2LAJA 2XPBA 2JV4A 1WMVA 2YSFA 2M3OW 2XP3A 2ZR6A 1PINA 4U84A 3KADA 1TK7A 3LE4A 2XP9A 3M85A 3OOBA 1NMVA 4U85A 2F21A 1O6WA 2JX8A 2ZQVA 2JMFA 2Q5AA 3KAGA 2MDIA 2XP5A 2XP7A 2DK1A 3KCEA 1EG3A 3ODKA 2DJYA 3TCZA 3TDBA 2DK7A 1K9RA 3M7NA 2RE3A 4QIBA 2XP8A 3TC5A 5CQ2A 3KABA 2ZQSA 2JXWA 1EG4A
chains in the Genus database with same CATH superfamily
2XPAA 3NTPA 2YSBA 2YSIA 5U47A 1JMQA 2ZAJA 3MQGA 1TR8A 2KXQA 2ITKA 3L4HA 2YSHA 4REXA 1I5HW 2ZR4A 5E66A 1WR7A 2M8IA 1YW5A 3KAFA 1K9QA 1F8AB 4U86A 4E5RA 3LKXB 2EZ5W 5E65A 2XP4A 3KAIA 3FSCA 3PQHA 3CNGA 2ZR5A 2DWVA 5AHTA 2ZQUA 2YSGA 3LKXA 2WAEA 2BA1A 3KAHA 3WH0A 2DMVA 2YAJB 2XP6A 1ZCNA 2L4JA 2E45A 2M8JA 3MCBB 2ZQTA 2LAJA 5E64A 2XPBA 3MCBA 2JV4A 1WMVA 2YSFA 2M3OW 2XP3A 2ZR6A 1PINA 2Y8NB 3KADA 4U84A 1TK7A 4A0TA 3LE4A 2XP9A 3M85A 2QRVA 3OOBA 1NMVA 4U85A 2F21A 1O6WA 2JX8A 2ZQVA 2JMFA 4A0UA 2Q5AA 3FS8A 3KAGA 2MDIA 2XP5A 2XP7A 2DK1A 3KCEA 1EG3A 3ODKA 2DJYA 3TCZA 3TDBA 2DK7A 1K9RA 5E5WA 3M7NA 2WADA 5E62A 4GLXA 1RP5A 2RE3A 4QIBA 2XP8A 3TC5A 5CQ2A 1FLCA 3KABA 3MQHA 2ZQSA 2JXWA 1EG4A 3FSBA 2OWOA
chains in the Genus database with same CATH topology
2XPAA 3NTPA 2YSBA 2YSIA 5U47A 1JMQA 2ZAJA 3MQGA 1TR8A 2KXQA 2ITKA 3L4HA 2YSHA 4REXA 1I5HW 2ZR4A 5E66A 1WR7A 2M8IA 1YW5A 3KAFA 1K9QA 1F8AB 4U86A 4E5RA 3LKXB 2EZ5W 5E65A 2XP4A 3KAIA 3FSCA 3PQHA 3CNGA 2ZR5A 2DWVA 5AHTA 2ZQUA 2YSGA 3LKXA 2WAEA 2BA1A 3KAHA 3WH0A 2DMVA 2YAJB 2XP6A 1ZCNA 2L4JA 2E45A 2M8JA 3MCBB 2ZQTA 2LAJA 5E64A 2XPBA 3MCBA 2JV4A 1WMVA 2YSFA 2M3OW 2XP3A 2ZR6A 1PINA 2Y8NB 3KADA 4U84A 1TK7A 4A0TA 3LE4A 2XP9A 3M85A 2QRVA 3OOBA 1NMVA 4U85A 2F21A 1O6WA 2JX8A 2ZQVA 2JMFA 4A0UA 2Q5AA 3FS8A 3KAGA 2MDIA 2XP5A 2XP7A 2DK1A 3KCEA 1EG3A 3ODKA 2DJYA 3TCZA 3TDBA 2DK7A 1K9RA 5E5WA 3M7NA 2WADA 5E62A 4GLXA 1RP5A 2RE3A 4QIBA 2XP8A 3TC5A 5CQ2A 1FLCA 3KABA 3MQHA 2ZQSA 2JXWA 1EG4A 3FSBA 2OWOA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2XPA A;  3NTP A;  2YSB A;  2YSI A;  1JMQ A;  2ZAJ A;  2KXQ A;  2ITK A;  3L4H A;  2YSH A;  4REX A;  1I5H W;  2ZR4 A;  1WR7 A;  2M8I A;  1YW5 A;  3KAF A;  1K9Q A;  1F8A B;  4U86 A;  4E5R A;  2EZ5 W;  2XP4 A;  3KAI A;  3CNG A;  2ZR5 A;  2DWV A;  5AHT A;  2ZQU A;  2YSG A;  2BA1 A;  3KAH A;  3WH0 A;  2DMV A;  2XP6 A;  1ZCN A;  2L4J A;  2E45 A;  2M8J A;  2ZQT A;  2LAJ A;  2XPB A;  2JV4 A;  1WMV A;  2YSF A;  2M3O W;  2XP3 A;  2ZR6 A;  1PIN A;  4U84 A;  3KAD A;  1TK7 A;  3LE4 A;  2XP9 A;  3M85 A;  3OOB A;  1NMV A;  4U85 A;  2F21 A;  1O6W A;  2JX8 A;  2ZQV A;  2JMF A;  2Q5A A;  3KAG A;  2MDI A;  2XP5 A;  2XP7 A;  2DK1 A;  3KCE A;  1EG3 A;  3ODK A;  2DJY A;  3TCZ A;  3TDB A;  2DK7 A;  1K9R A;  3M7N A;  2RE3 A;  4QIB A;  2XP8 A;  3TC5 A;  5CQ2 A;  3KAB A;  2ZQS A;  2JXW A;  1EG4 A; 
#chains in the Genus database with same CATH topology
 2XPA A;  3NTP A;  2YSB A;  2YSI A;  5U47 A;  1JMQ A;  2ZAJ A;  3MQG A;  1TR8 A;  2KXQ A;  2ITK A;  3L4H A;  2YSH A;  4REX A;  1I5H W;  2ZR4 A;  5E66 A;  1WR7 A;  2M8I A;  1YW5 A;  3KAF A;  1K9Q A;  1F8A B;  4U86 A;  4E5R A;  3LKX B;  2EZ5 W;  5E65 A;  2XP4 A;  3KAI A;  3FSC A;  3PQH A;  3CNG A;  2ZR5 A;  2DWV A;  5AHT A;  2ZQU A;  2YSG A;  3LKX A;  2WAE A;  2BA1 A;  3KAH A;  3WH0 A;  2DMV A;  2YAJ B;  2XP6 A;  1ZCN A;  2L4J A;  2E45 A;  2M8J A;  3MCB B;  2ZQT A;  2LAJ A;  5E64 A;  2XPB A;  3MCB A;  2JV4 A;  1WMV A;  2YSF A;  2M3O W;  2XP3 A;  2ZR6 A;  1PIN A;  2Y8N B;  3KAD A;  4U84 A;  1TK7 A;  4A0T A;  3LE4 A;  2XP9 A;  3M85 A;  2QRV A;  3OOB A;  1NMV A;  4U85 A;  2F21 A;  1O6W A;  2JX8 A;  2ZQV A;  2JMF A;  4A0U A;  2Q5A A;  3FS8 A;  3KAG A;  2MDI A;  2XP5 A;  2XP7 A;  2DK1 A;  3KCE A;  1EG3 A;  3ODK A;  2DJY A;  3TCZ A;  3TDB A;  2DK7 A;  1K9R A;  5E5W A;  3M7N A;  2WAD A;  5E62 A;  4GLX A;  1RP5 A;  2RE3 A;  4QIB A;  2XP8 A;  3TC5 A;  5CQ2 A;  1FLC A;  3KAB A;  3MQH A;  2ZQS A;  2JXW A;  1EG4 A;  3FSB A;  2OWO A; 
#chains in the Genus database with same CATH homology
 2XPA A;  3NTP A;  2YSB A;  2YSI A;  5U47 A;  1JMQ A;  2ZAJ A;  3MQG A;  1TR8 A;  2KXQ A;  2ITK A;  3L4H A;  2YSH A;  4REX A;  1I5H W;  2ZR4 A;  5E66 A;  1WR7 A;  2M8I A;  1YW5 A;  3KAF A;  1K9Q A;  1F8A B;  4U86 A;  4E5R A;  3LKX B;  2EZ5 W;  5E65 A;  2XP4 A;  3KAI A;  3FSC A;  3PQH A;  3CNG A;  2ZR5 A;  2DWV A;  5AHT A;  2ZQU A;  2YSG A;  3LKX A;  2WAE A;  2BA1 A;  3KAH A;  3WH0 A;  2DMV A;  2YAJ B;  2XP6 A;  1ZCN A;  2L4J A;  2E45 A;  2M8J A;  3MCB B;  2ZQT A;  2LAJ A;  5E64 A;  2XPB A;  3MCB A;  2JV4 A;  1WMV A;  2YSF A;  2M3O W;  2XP3 A;  2ZR6 A;  1PIN A;  2Y8N B;  3KAD A;  4U84 A;  1TK7 A;  4A0T A;  3LE4 A;  2XP9 A;  3M85 A;  2QRV A;  3OOB A;  1NMV A;  4U85 A;  2F21 A;  1O6W A;  2JX8 A;  2ZQV A;  2JMF A;  4A0U A;  2Q5A A;  3FS8 A;  3KAG A;  2MDI A;  2XP5 A;  2XP7 A;  2DK1 A;  3KCE A;  1EG3 A;  3ODK A;  2DJY A;  3TCZ A;  3TDB A;  2DK7 A;  1K9R A;  5E5W A;  3M7N A;  2WAD A;  5E62 A;  4GLX A;  1RP5 A;  2RE3 A;  4QIB A;  2XP8 A;  3TC5 A;  5CQ2 A;  1FLC A;  3KAB A;  3MQH A;  2ZQS A;  2JXW A;  1EG4 A;  3FSB A;  2OWO A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...