2ZQTA

Crystal structure of a mutant pin1 peptidyl-prolyl cis-trans isomerase
Total Genus 47
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
47
sequence length
158
structure length
153
Chain Sequence
KLPPGWEKRMSRSSGRVYYFNHITNASQWERPSGGKNGQGEPARVRCSHLLVKHSQSRRPSSWRQEKITRTKEEALELINGYIQKIKSGEEDFESLASQFSDCSSAKARGDLGAFSRGQAQKPFEDASFALRTGEMSGPVFTDSGIHIILRTE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Isomerase
molecule keywords Peptidyl-prolyl cis-trans isomerase NIMA-interacting 1
publication title Structural studies on PIN1 mutants
rcsb
source organism Homo sapiens
total genus 47
structure length 153
sequence length 158
ec nomenclature ec 5.2.1.8: Peptidylprolyl isomerase.
pdb deposition date 2008-08-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00397 WW WW domain
A PF00639 Rotamase PPIC-type PPIASE domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.20.70.10 Mainly Beta Single Sheet Ubiquitin Ligase Nedd4; Chain: W; Ubiquitin Ligase Nedd4; Chain: W; 2zqtA01
3.10.50.40 Alpha Beta Roll Chitinase A; domain 3 Chitinase A; domain 3 2zqtA02
4DRQA 2PV1A 3LE4A 2ZAJA 3UQBA 2YSIA 3O5JA 2JZVA 1D7JA 1Y0OA 4ODQA 3WH0A 4JFKA 3ODKA 4TNSA 3MDYB 4JFJA 2RQSA 3I6CA 1FKSA 4DRHA 2LAJA 3O5EA 1O6WA 1L1PA 1NMVA 4REXA 1WR7A 2JX8A 2PPPA 2RUDA 4R0XA 2YSHA 3KAGA 4BF8A 3UI5A 2IF4A 4E5RA 1PINA 3FAPA 2KFWA 4G50A 4MSPA 3NRKA 3KCEA 1FKRA 2RUCA 1EQ3A 4FN2A 5D75A 3KABA 1P5QA 3KAIA 2OFNA 1EYMA 5BXJA 1FKKA 2YSGA 3O5RA 2MLXA 1W26A 2MNTA 4DT4A 3JXVA 5AHTA 2XP6A 2XP7A 1I5HW 2PBCA 4ODRA 2ZR5A 2M8JA 2PPNA 2F2DA 2PV3A 2L2SA 4W9PA 1R9HA 3GPKA 4W9OA 2XPAA 1FKTA 4TW6A 3TC5A 4JYSA 1A7XA 2FAPA 1TK7A 3PRBA 4LAWA 1BKFA 4DRIA 1F8AB 2AWGA 1JMQA 2UZ5A 3PRDA 3EY6A 4IQ2A 1C9HA 4G2PA 4JFLA 1Q6IA 2K8IA 4ODOA 4JFIA 2ZQTA 1D7IA 4QT2A 5I98A 1FJDA 1YW5A 4GIVA 2Q5AA 4C02B 1J4HA 2ITKA 2XP9A 2LPVA 1K9RA 3CNGA 4DRKA 1N1AA 3IKGA 2DK7A 4ODKA 2MPHA 2JV4A 2M8IA 1JNTA 1K9QA 1PBKA 2KI3A 2ZR4A 3CGNA 1FKJA 4JFMA 2KR7A 2YSFA 4ITZA 1QPLA 2RUQA 1ZK6A 1HXVA 2XPBA 3KADA 1D7HA 4QIBA 4DRPA 4NNRA 1KT0A 3IHZA 4FAPA 2Y78A 1FKDA 1FKGA 1FKFA 2PPOA 2BA1A 4W9QA 5GPGA 2ZQSA 5B8IC 1NMWA 3CGMA 3O5IA 1U79A 1ROTA 3O5GA 5HW8A 2ZQVA 2DG9A 4DROA 2DG3A 3UQAA 3O5OA 3IKDA 3O5KA 2N87A 3UQIA 4DRNA 5DITA 3JYJA 1EG3A 1Q6HA 2RURA 2JXWA 1F40A 3L4HA 1FKHA 2XP5A 3UF8A 4ODMA 4DRJA 3KAFA 4U86A 3O5DA 2DG4A 1FKIA 2DK1A 3O5LA 3TCZA 1Q1CA 1FKLA 4LAVA 2XP4A 2XP8A 1FD9A 1TCOC 2ZQUA 2LJ4A 2KO7A 3KZ7A 1WMVA 2PV2A 5DIUA 4J4NA 1EG4A 3B7XA 3NTPA 1NSGA 3PA7A 4DIPA 1J6YA 2RE3A 2D9FA 1JVWA 1ROUA 4ODPA 4U85A 3O5PA 4IQCA 1J4IA 4O2TA 4ODLA 1QPFA 2KXQA 5HTGA 5DIVA 2MDIA 2VN1A 3KAHA 1J4RA 3LUOA 3M7NA 4IPXA 2DJYA 4ODNA 2L4JA 4TX0A 4GGQA 2M1IA 2LGOA 2VCDA 3TDBA 5HT1A 2YSBA 5J6EA 4U84A 2MLZA 2M08A 2KE0A 2DMVA 2LKNA 4TW7A 4LAXA 5HW6A 3IK8A 5HUAA 3M85A 2MLYA 3RFWA 3JYMA 3O5FA 1YATA 4TYOA 2XP3A 5HW7A 2EZ5W 4DZ3A 5HWCA 4DH0A 2MF9A 1QZ2A 5CQ2A 5HKGA 2M2AA 4N19A 3UI4A 3O5MA 4TW8A 1FAPA 3OOBA 3RGCA 1Q6UA 3NI6A 3KACA 2JMFA 1BL4A 1D6OA 4DRMA 3VAWA 2M3OW 2F4EA 4J4OA 4DZ2A 2ZR6A 5HWBA 3O5QA 3UI6A 1B6CA 4QT3A 2F21A 2KGJA 1ZCNA 4MGVA 1T11A 1JNSA 3H9RB 2E45A 1M5YA 2DWVA 4LAYA 2RSEA 1FKBA 2FKEA 1KT1A
chains in the Genus database with same CATH superfamily
2IUZA 5HBFA 1E44A 4DRQA 2PV1A 3EIPA 3LE4A 2ZAJA 3WQWA 3AQUA 3UQBA 2YSIA 3O5JA 1W1YA 2JZVA 4P8UA 1D7JA 1Y0OA 4ODQA 3WH0A 1OWQA 3CHEA 1NWSA 3RM4A 4JFKA 3ODKA 4TNSA 3MDYB 4DWSA 4JFJA 2RQSA 3I6CA 1FKSA 4DRHA 2LAJA 3O5EA 1UR9A 2Y8NB 1O6WA 2PI6A 3CH9A 3WD4A 1L1PA 1NMVA 4REXA 1WR7A 2JX8A 1WAWA 2PPPA 3OA5A 5JH8A 2RUDA 4S3JA 1LG1A 4R0XA 2YSHA 4IT6A 3KAGA 4BF8A 3UI5A 2IF4A 4E5RA 1W1PA 1CTNA 3CHFA 5DF0A 1PINA 3LKXB 3FAPA 2QRVA 3PR9A 2KFWA 4G50A 1X6LA 4MSPA 3NRKA 4ZS6A 3ARXA 4MNMA 2DT2A 5E62A 1HJXA 2A3CA 4W5UA 3KCEA 2DSZA 2F23A 1H0GA 1FKRA 2RUCA 1EQ3A 4FN2A 5D75A 4AY1A 3KABA 1P5QA 1ZBVA 3KAIA 2OFNA 1XHGA 1EYMA 5BXJA 1FKKA 2YSGA 3O5RA 2MLXA 1JNEA 1W26A 2MNTA 1ZU8A 2DT1A 2FDMA 5U47A 4KQZA 4DT4A 1ZBKA 2DSWA 3JXVA 5AHTA 2XP6A 1E15A 2YBTA 3G6MA 1ZBCA 4MTVA 3GU0A 2XP7A 1I5HW 2PBCA 3B9EA 4WKAA 4DWSD 4ODRA 1RD6A 3ARSA 1W1TA 2ZR5A 2M8JA 2PPNA 2WLZA 2DT0A 2F2DA 2PV3A 2L2SA 1R9HA 4W9PA 3WD0A 2O9OA 2WAEA 3GPKA 3B8SA 3ARUA 4L72B 4WJXA 4W9OA 2XPAA 1FKTA 4TW6A 3TC5A 4JYSA 1UR8A 1A7XA 2FAPA 4Z2JA 1TK7A 3PRBA 4LAWA 2AOSA 3B9AA 1BKFA 4DRIA 1F8AB 2AWGA 3PRAA 1K9TA 1JMQA 4QZVB 2UZ5A 4Z2GA 3PRDA 1NWTA 3EY6A 4IQ2A 1C9HA 4DWSB 4P8XA 1WNOA 4G2PA 4JFLA 4NZCA 3CZ8A 1Q6IA 2K8IA 4ODOA 1OGGA 4JFIA 4XAKA 2ZQTA 1D7IA 1GPFA 4QT2A 1SR0A 1HJVA 5I98A 3RMEA 1FJDA 1YW5A 4GIVA 2Q5AA 1KFWA 4C02B 1J4HA 2ITKA 2WM0A 4Q7NA 3MQHA 1W9VA 2XP9A 2LPVA 5DEZA 2WLYA 4Z2HA 1K9RA 3AS1A 3CNGA 4Z2IA 1N1AA 4DRKA 3IKGA 3ARTA 2DK7A 4ODKA 2DT3A 4ZPTR 1EHNA 1E6RA 1W9UA 4WIWA 3W4RA 2MPHA 2JV4A 2M8IA 1JNTA 3WL0A 1K9QA 1PBKA 2KI3A 3ALFA 2ZR4A 3CGNA 3FSCA 1FKJA 4JFMA 3ARVA 1ITXA 2KR7A 2YSFA 4ITZA 1QPLA 3AS2A 2RUQA 1ZK6A 1HXVA 2XPBA 3KADA 1HJWA 1D7HA 4QIBA 4DRPA 4MNJA 4NNRA 1TR8A 2DSVA 3AS3A 2YBUA 1KT0A 3IHZA 1NWRA 4FAPA 2Y78A 2EULA 1ZBWA 4A0UA 1FKDA 1FKGA 4GLXA 1GUVA 2ETNA 2OLHA 2QF8A 1FKFA 1W9PA 2PPOA 3BXWA 2BA1A 4W9QA 5GPGA 2ZQSA 2ESCA 5B8IC 3AROA 1NMWA 4WK9A 3LKXA 3CGMA 1RP5A 3O5IA 1ZB5A 3GTYX 4Q22A 1U79A 4KR0B 1ROTA 3O5GA 5HW8A 2ZQVA 2DG9A 3ARPA 2DG3A 3AS0A 4DROA 2O92A 3UQAA 3O5OA 4LGXA 3IKDA 3O5KA 4MNKA 2N87A 3CHDA 3UQIA 5GPRA 4DRNA 2DSUA 4ZPWR 5GQBA 5DITA 3JYJA 3G6LA 1EG3A 1Q6HA 2RURA 2JXWA 1FLCA 1F40A 3WD2A 3WD3A 3L4HA 1FKHA 2XP5A 4Z2KA 3UF8A 5E5WA 3ARQA 4ODMA 4DRJA 3KAFA 4P8VA 4U86A 3ARZA 4WKHA 3O5DA 3B9DA 1EDQA 2DG4A 1E6NA 2A3EA 1FKIA 2DK1A 3O5LA 3TCZA 1Q1CA 1FKLA 1FFRA 4LAVA 2XP4A 1D2KA 1LL6A 3MCBA 2A3AA 2XP8A 1FD9A 1TCOC 2ZQUA 2LJ4A 3RM8A 2KO7A 1E6ZA 2WK2A 2B5UB 1HKIA 3KZ7A 4PTMA 1VF8A 1WMVA 3PQHA 2PV2A 5DIUA 4J4NA 1EG4A 3B7XA 3NTPA 4R5EA 4UDMA 5DO2A 1NSGA 3PA7A 4DIPA 1J6YA 1LJYA 1XRVA 2RE3A 4A0TA 2D9FA 1JVWA 1HKKA 2PN0A 1ROUA 4U85A 4IQCA 3O5PA 4O2TA 1J4IA 4ODPA 4ODLA 4URIA 1QPFA 3WL1A 2KXQA 1TFVA 5HTGA 5DIVA 2MDIA 2VN1A 3KAHA 1J4RA 1E9LA 3LUOA 3M7NA 4ML4A 1SYTA 3WD1A 4IPXA 2DJYA 4ODNA 2L4JA 3RM9A 4TX0A 4GGQA 2M1IA 2LGOA 2VCDA 3TDBA 1HKJA 3CHCA 5HT1A 4Z2LA 1HKMA 2A3BA 2YSBA 3ARRA 5J6EA 4L3NA 4U84A 2YAJB 5E64A 2MLZA 1LL4A 2M08A 2KE0A 2DMVA 2LKNA 4TW7A 4LAXA 5HW6A 3IK8A 5HUAA 3M85A 1X6NA 2MLYA 3RFWA 2G41A 4ZPVR 3FXYA 3JYMA 3O5FA 1YATA 4TYOA 1O6IA 2XP3A 1NWUA 4P8WA 4MPKA 3ARYA 5HW7A 4IT4A 3BMBA 4NSBA 2EZ5W 3WQVA 4DZ3A 1GRJA 2MF9A 4DH0A 5HWCA 2WADA 1QZ2A 3FY1A 5CQ2A 5HKGA 2M2AA 4N19A 3UI4A 3O5MA 1FFQA 1W1VA 4TW8A 1FAPA 3OOBA 1ZL1A 3RGCA 1Q6UA 3NI6A 4HBOA 3KACA 2JMFA 3MQGA 4DWSC 1BL4A 5E66A 1D6OA 4S3KA 4DRMA 1JNDA 3FS8A 3VAWA 2P4VA 2M3OW 2B31A 2F4EA 4HARA 4J4OA 4WKFA 4DZ2A 2G8ZA 3MCBB 3WIJA 2ZR6A 3ARWA 4MAVA 5HWBA 3O5QA 3UI6A 1B6CA 4QT3A 2F21A 1E6PA 2KGJA 1ZCNA 2OWOA 3ALGA 4HBEA 4MGVA 1T11A 1JNSA 1NH6A 3FSBA 3H9RB 2E45A 1M5YA 3WKZA 1WB0A 2DWVA 4LAYA 4MNLA 1LL7A 1GOIA 2RSEA 1LG2A 2DPEA 3QOKA 5E65A 1FKBA 1LQ0A 1EIBA 1OGBA 2FKEA 1H0IA 1IX5A 1JCHB 1KT1A
chains in the Genus database with same CATH topology
2IUZA 5HBFA 4DRQA 2PV1A 3LE4A 2ZAJA 3WQWA 3AQUA 3UQBA 2YSIA 3O5JA 1W1YA 2JZVA 4P8UA 1D7JA 1Y0OA 4ODQA 3WH0A 1OWQA 3CHEA 1NWSA 3RM4A 4JFKA 3ODKA 4TNSA 3MDYB 4DWSA 4JFJA 2RQSA 3I6CA 1FKSA 4DRHA 2LAJA 3O5EA 1UR9A 2Y8NB 1O6WA 2PI6A 3CH9A 3WD4A 1L1PA 1NMVA 4REXA 1WR7A 2JX8A 1WAWA 2PPPA 3OA5A 5JH8A 2RUDA 4S3JA 1LG1A 4R0XA 2YSHA 4IT6A 3KAGA 4BF8A 3UI5A 2IF4A 4E5RA 1W1PA 1CTNA 3CHFA 5DF0A 1PINA 3LKXB 3FAPA 2QRVA 3PR9A 2KFWA 4G50A 1X6LA 4MSPA 3NRKA 4ZS6A 3ARXA 4MNMA 2DT2A 5E62A 1HJXA 2A3CA 4W5UA 3KCEA 2DSZA 1H0GA 1FKRA 2RUCA 1EQ3A 4FN2A 5D75A 4AY1A 3KABA 1P5QA 1ZBVA 3KAIA 2OFNA 1XHGA 1EYMA 5BXJA 1FKKA 2YSGA 3O5RA 2MLXA 1JNEA 1W26A 2MNTA 1ZU8A 2DT1A 2FDMA 5U47A 4KQZA 4DT4A 1ZBKA 2DSWA 3JXVA 5AHTA 2XP6A 1E15A 2YBTA 3G6MA 1ZBCA 4MTVA 2XP7A 1I5HW 2PBCA 3B9EA 4WKAA 4DWSD 4ODRA 1RD6A 3ARSA 1W1TA 2ZR5A 2M8JA 2PPNA 2WLZA 2DT0A 2F2DA 2PV3A 2L2SA 1R9HA 4W9PA 3WD0A 2O9OA 2WAEA 3GPKA 3B8SA 3ARUA 4L72B 4WJXA 4W9OA 2XPAA 1FKTA 4TW6A 3TC5A 4JYSA 1UR8A 1A7XA 2FAPA 4Z2JA 1TK7A 3PRBA 4LAWA 2AOSA 3B9AA 1BKFA 4DRIA 1F8AB 2AWGA 3PRAA 1K9TA 1JMQA 4QZVB 2UZ5A 4Z2GA 3PRDA 1NWTA 3EY6A 4IQ2A 1C9HA 4DWSB 4P8XA 1WNOA 4G2PA 4JFLA 4NZCA 3CZ8A 1Q6IA 2K8IA 4ODOA 1OGGA 4JFIA 4XAKA 2ZQTA 1D7IA 1GPFA 4QT2A 1SR0A 1HJVA 5I98A 3RMEA 1FJDA 1YW5A 4GIVA 2Q5AA 1KFWA 4C02B 1J4HA 2ITKA 2WM0A 4Q7NA 3MQHA 1W9VA 2XP9A 2LPVA 5DEZA 2WLYA 4Z2HA 1K9RA 3AS1A 3CNGA 4Z2IA 1N1AA 4DRKA 3IKGA 3ARTA 2DK7A 4ODKA 2DT3A 4ZPTR 1EHNA 1E6RA 1W9UA 4WIWA 3W4RA 2MPHA 2JV4A 2M8IA 1JNTA 3WL0A 1K9QA 1PBKA 2KI3A 3ALFA 2ZR4A 3CGNA 3FSCA 1FKJA 4JFMA 3ARVA 1ITXA 2KR7A 2YSFA 4ITZA 1QPLA 3AS2A 2RUQA 1ZK6A 1HXVA 2XPBA 3KADA 1HJWA 1D7HA 4QIBA 4DRPA 4MNJA 4NNRA 1TR8A 2DSVA 3AS3A 2YBUA 1KT0A 3IHZA 1NWRA 4FAPA 2Y78A 1ZBWA 4A0UA 1FKDA 1FKGA 4GLXA 1GUVA 2OLHA 2QF8A 3BXWA 1FKFA 1W9PA 2PPOA 2BA1A 4W9QA 5GPGA 2ZQSA 2ESCA 5B8IC 3AROA 1NMWA 4WK9A 3LKXA 3CGMA 1RP5A 3O5IA 1ZB5A 4Q22A 1U79A 4KR0B 1ROTA 3O5GA 5HW8A 2ZQVA 2DG9A 3AS0A 2DG3A 4DROA 2O92A 3UQAA 3O5OA 4LGXA 3IKDA 3O5KA 4MNKA 2N87A 3CHDA 3UQIA 5GPRA 4DRNA 2DSUA 4ZPWR 5GQBA 5DITA 3JYJA 3G6LA 1EG3A 1Q6HA 2RURA 2JXWA 1FLCA 1F40A 3WD2A 3WD3A 3L4HA 1FKHA 2XP5A 4Z2KA 3UF8A 5E5WA 3ARQA 4ODMA 4DRJA 3KAFA 4P8VA 4U86A 3ARZA 4WKHA 3O5DA 3B9DA 1EDQA 2DG4A 1E6NA 2A3EA 1FKIA 2DK1A 3O5LA 3TCZA 1Q1CA 1FKLA 1FFRA 4LAVA 2XP4A 1D2KA 1LL6A 3MCBA 2A3AA 2XP8A 1FD9A 1TCOC 2ZQUA 2LJ4A 3RM8A 2KO7A 1E6ZA 2WK2A 1HKIA 3KZ7A 4PTMA 1VF8A 1WMVA 3PQHA 2PV2A 5DIUA 4J4NA 1EG4A 3B7XA 3NTPA 4R5EA 5DO2A 1NSGA 3PA7A 4DIPA 1J6YA 1LJYA 1XRVA 2RE3A 4A0TA 2D9FA 1JVWA 1HKKA 1ROUA 4U85A 4IQCA 3O5PA 4O2TA 1J4IA 4ODPA 4ODLA 4URIA 1QPFA 3WL1A 2KXQA 1TFVA 5HTGA 5DIVA 2MDIA 2VN1A 3KAHA 1J4RA 1E9LA 3LUOA 3M7NA 4ML4A 1SYTA 3WD1A 4IPXA 2DJYA 4ODNA 2L4JA 3RM9A 4TX0A 4GGQA 2M1IA 2LGOA 2VCDA 3TDBA 1HKJA 3CHCA 5HT1A 4Z2LA 1HKMA 2A3BA 2YSBA 3ARRA 5J6EA 4L3NA 4U84A 2YAJB 5E64A 2MLZA 1LL4A 2M08A 2KE0A 2DMVA 2LKNA 4TW7A 4LAXA 5HW6A 3IK8A 5HUAA 3M85A 1X6NA 2MLYA 3RFWA 2G41A 4ZPVR 3FXYA 3JYMA 3O5FA 1YATA 4TYOA 1O6IA 2XP3A 1NWUA 4P8WA 4MPKA 3ARYA 5HW7A 4IT4A 3WQVA 4NSBA 2EZ5W 4DZ3A 5HWCA 4DH0A 2MF9A 2WADA 1QZ2A 3FY1A 5CQ2A 5HKGA 2M2AA 4N19A 3UI4A 3O5MA 1FFQA 1W1VA 4TW8A 1FAPA 3OOBA 1ZL1A 3RGCA 1Q6UA 3NI6A 4HBOA 3KACA 2JMFA 3MQGA 4DWSC 1BL4A 5E66A 1D6OA 4S3KA 4DRMA 1JNDA 3FS8A 3VAWA 2M3OW 2B31A 2F4EA 4HARA 4J4OA 4WKFA 4DZ2A 2G8ZA 3MCBB 3WIJA 2ZR6A 3ARWA 4MAVA 5HWBA 3O5QA 3UI6A 1B6CA 4QT3A 2F21A 1E6PA 2KGJA 1ZCNA 2OWOA 3ALGA 4HBEA 4MGVA 1T11A 1JNSA 1NH6A 3FSBA 3H9RB 2E45A 1M5YA 3WKZA 1WB0A 2DWVA 4LAYA 4MNLA 1LL7A 1GOIA 2RSEA 1LG2A 2DPEA 3QOKA 5E65A 1FKBA 1LQ0A 1EIBA 1OGBA 2FKEA 1H0IA 1IX5A 3ARPA 1KT1A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4DRQ A;  2PV1 A;  3LE4 A;  2ZAJ A;  3UQB A;  2YSI A;  3O5J A;  2JZV A;  1D7J A;  1Y0O A;  4ODQ A;  3WH0 A;  4JFK A;  3ODK A;  4TNS A;  3MDY B;  4JFJ A;  2RQS A;  3I6C A;  1FKS A;  4DRH A;  2LAJ A;  3O5E A;  1O6W A;  1L1P A;  1NMV A;  4REX A;  1WR7 A;  2JX8 A;  2PPP A;  2RUD A;  4R0X A;  2YSH A;  3KAG A;  4BF8 A;  3UI5 A;  2IF4 A;  4E5R A;  1PIN A;  3FAP A;  2KFW A;  4G50 A;  4MSP A;  3NRK A;  3KCE A;  1FKR A;  2RUC A;  1EQ3 A;  4FN2 A;  5D75 A;  3KAB A;  1P5Q A;  3KAI A;  2OFN A;  1EYM A;  5BXJ A;  1FKK A;  2YSG A;  3O5R A;  2MLX A;  1W26 A;  2MNT A;  4DT4 A;  3JXV A;  5AHT A;  2XP6 A;  2XP7 A;  1I5H W;  2PBC A;  4ODR A;  2ZR5 A;  2M8J A;  2PPN A;  2F2D A;  2PV3 A;  2L2S A;  4W9P A;  1R9H A;  3GPK A;  4W9O A;  2XPA A;  1FKT A;  4TW6 A;  3TC5 A;  4JYS A;  1A7X A;  2FAP A;  1TK7 A;  3PRB A;  4LAW A;  1BKF A;  4DRI A;  1F8A B;  2AWG A;  1JMQ A;  2UZ5 A;  3PRD A;  3EY6 A;  4IQ2 A;  1C9H A;  4G2P A;  4JFL A;  1Q6I A;  2K8I A;  4ODO A;  4JFI A;  2ZQT A;  1D7I A;  4QT2 A;  5I98 A;  1FJD A;  1YW5 A;  4GIV A;  2Q5A A;  4C02 B;  1J4H A;  2ITK A;  2XP9 A;  2LPV A;  1K9R A;  3CNG A;  4DRK A;  1N1A A;  3IKG A;  2DK7 A;  4ODK A;  2MPH A;  2JV4 A;  2M8I A;  1JNT A;  1K9Q A;  1PBK A;  2KI3 A;  2ZR4 A;  3CGN A;  1FKJ A;  4JFM A;  2KR7 A;  2YSF A;  4ITZ A;  1QPL A;  2RUQ A;  1ZK6 A;  1HXV A;  2XPB A;  3KAD A;  1D7H A;  4QIB A;  4DRP A;  4NNR A;  1KT0 A;  3IHZ A;  4FAP A;  2Y78 A;  1FKD A;  1FKG A;  1FKF A;  2PPO A;  2BA1 A;  4W9Q A;  5GPG A;  2ZQS A;  5B8I C;  1NMW A;  3CGM A;  3O5I A;  1U79 A;  1ROT A;  3O5G A;  5HW8 A;  2ZQV A;  2DG9 A;  4DRO A;  2DG3 A;  3UQA A;  3O5O A;  3IKD A;  3O5K A;  2N87 A;  3UQI A;  4DRN A;  5DIT A;  3JYJ A;  1EG3 A;  1Q6H A;  2RUR A;  2JXW A;  1F40 A;  3L4H A;  1FKH A;  2XP5 A;  3UF8 A;  4ODM A;  4DRJ A;  3KAF A;  4U86 A;  3O5D A;  2DG4 A;  1FKI A;  2DK1 A;  3O5L A;  3TCZ A;  1Q1C A;  1FKL A;  4LAV A;  2XP4 A;  2XP8 A;  1FD9 A;  1TCO C;  2ZQU A;  2LJ4 A;  2KO7 A;  3KZ7 A;  1WMV A;  2PV2 A;  5DIU A;  4J4N A;  1EG4 A;  3B7X A;  3NTP A;  1NSG A;  3PA7 A;  4DIP A;  1J6Y A;  2RE3 A;  2D9F A;  1JVW A;  1ROU A;  4ODP A;  4U85 A;  3O5P A;  4IQC A;  1J4I A;  4O2T A;  4ODL A;  1QPF A;  2KXQ A;  5HTG A;  5DIV A;  2MDI A;  2VN1 A;  3KAH A;  1J4R A;  3LUO A;  3M7N A;  4IPX A;  2DJY A;  4ODN A;  2L4J A;  4TX0 A;  4GGQ A;  2M1I A;  2LGO A;  2VCD A;  3TDB A;  5HT1 A;  2YSB A;  5J6E A;  4U84 A;  2MLZ A;  2M08 A;  2KE0 A;  2DMV A;  2LKN A;  4TW7 A;  4LAX A;  5HW6 A;  3IK8 A;  5HUA A;  3M85 A;  2MLY A;  3RFW A;  3JYM A;  3O5F A;  1YAT A;  4TYO A;  2XP3 A;  5HW7 A;  2EZ5 W;  4DZ3 A;  5HWC A;  4DH0 A;  2MF9 A;  1QZ2 A;  5CQ2 A;  5HKG A;  2M2A A;  4N19 A;  3UI4 A;  3O5M A;  4TW8 A;  1FAP A;  3OOB A;  3RGC A;  1Q6U A;  3NI6 A;  3KAC A;  2JMF A;  1BL4 A;  1D6O A;  4DRM A;  3VAW A;  2M3O W;  2F4E A;  4J4O A;  4DZ2 A;  2ZR6 A;  5HWB A;  3O5Q A;  3UI6 A;  1B6C A;  4QT3 A;  2F21 A;  2KGJ A;  1ZCN A;  4MGV A;  1T11 A;  1JNS A;  3H9R B;  2E45 A;  1M5Y A;  2DWV A;  4LAY A;  2RSE A;  1FKB A;  2FKE A;  1KT1 A; 
#chains in the Genus database with same CATH topology
 2IUZ A;  5HBF A;  1E44 A;  4DRQ A;  2PV1 A;  3EIP A;  3LE4 A;  2ZAJ A;  3WQW A;  3AQU A;  3UQB A;  2YSI A;  3O5J A;  1W1Y A;  2JZV A;  4P8U A;  1D7J A;  1Y0O A;  4ODQ A;  3WH0 A;  1OWQ A;  3CHE A;  1NWS A;  3RM4 A;  4JFK A;  3ODK A;  4TNS A;  3MDY B;  4DWS A;  4JFJ A;  2RQS A;  3I6C A;  1FKS A;  4DRH A;  2LAJ A;  3O5E A;  1UR9 A;  2Y8N B;  1O6W A;  2PI6 A;  3CH9 A;  3WD4 A;  1L1P A;  1NMV A;  4REX A;  1WR7 A;  2JX8 A;  1WAW A;  2PPP A;  3OA5 A;  5JH8 A;  2RUD A;  4S3J A;  1LG1 A;  4R0X A;  2YSH A;  4IT6 A;  3KAG A;  4BF8 A;  3UI5 A;  2IF4 A;  4E5R A;  1W1P A;  1CTN A;  3CHF A;  5DF0 A;  1PIN A;  3LKX B;  3FAP A;  2QRV A;  3PR9 A;  2KFW A;  4G50 A;  1X6L A;  4MSP A;  3NRK A;  4ZS6 A;  3ARX A;  4MNM A;  2DT2 A;  5E62 A;  1HJX A;  2A3C A;  4W5U A;  3KCE A;  2DSZ A;  2F23 A;  1H0G A;  1FKR A;  2RUC A;  1EQ3 A;  4FN2 A;  5D75 A;  4AY1 A;  3KAB A;  1P5Q A;  1ZBV A;  3KAI A;  2OFN A;  1XHG A;  1EYM A;  5BXJ A;  1FKK A;  2YSG A;  3O5R A;  2MLX A;  1JNE A;  1W26 A;  2MNT A;  1ZU8 A;  2DT1 A;  2FDM A;  5U47 A;  4KQZ A;  4DT4 A;  1ZBK A;  2DSW A;  3JXV A;  5AHT A;  2XP6 A;  1E15 A;  2YBT A;  3G6M A;  1ZBC A;  4MTV A;  3GU0 A;  2XP7 A;  1I5H W;  2PBC A;  3B9E A;  4WKA A;  4DWS D;  4ODR A;  1RD6 A;  3ARS A;  1W1T A;  2ZR5 A;  2M8J A;  2PPN A;  2WLZ A;  2DT0 A;  2F2D A;  2PV3 A;  2L2S A;  1R9H A;  4W9P A;  3WD0 A;  2O9O A;  2WAE A;  3GPK A;  3B8S A;  3ARU A;  4L72 B;  4WJX A;  4W9O A;  2XPA A;  1FKT A;  4TW6 A;  3TC5 A;  4JYS A;  1UR8 A;  1A7X A;  2FAP A;  4Z2J A;  1TK7 A;  3PRB A;  4LAW A;  2AOS A;  3B9A A;  1BKF A;  4DRI A;  1F8A B;  2AWG A;  3PRA A;  1K9T A;  1JMQ A;  4QZV B;  2UZ5 A;  4Z2G A;  3PRD A;  1NWT A;  3EY6 A;  4IQ2 A;  1C9H A;  4DWS B;  4P8X A;  1WNO A;  4G2P A;  4JFL A;  4NZC A;  3CZ8 A;  1Q6I A;  2K8I A;  4ODO A;  1OGG A;  4JFI A;  4XAK A;  2ZQT A;  1D7I A;  1GPF A;  4QT2 A;  1SR0 A;  1HJV A;  5I98 A;  3RME A;  1FJD A;  1YW5 A;  4GIV A;  2Q5A A;  1KFW A;  4C02 B;  1J4H A;  2ITK A;  2WM0 A;  4Q7N A;  3MQH A;  1W9V A;  2XP9 A;  2LPV A;  5DEZ A;  2WLY A;  4Z2H A;  1K9R A;  3AS1 A;  3CNG A;  4Z2I A;  1N1A A;  4DRK A;  3IKG A;  3ART A;  2DK7 A;  4ODK A;  2DT3 A;  4ZPT R;  1EHN A;  1E6R A;  1W9U A;  4WIW A;  3W4R A;  2MPH A;  2JV4 A;  2M8I A;  1JNT A;  3WL0 A;  1K9Q A;  1PBK A;  2KI3 A;  3ALF A;  2ZR4 A;  3CGN A;  3FSC A;  1FKJ A;  4JFM A;  3ARV A;  1ITX A;  2KR7 A;  2YSF A;  4ITZ A;  1QPL A;  3AS2 A;  2RUQ A;  1ZK6 A;  1HXV A;  2XPB A;  3KAD A;  1HJW A;  1D7H A;  4QIB A;  4DRP A;  4MNJ A;  4NNR A;  1TR8 A;  2DSV A;  3AS3 A;  2YBU A;  1KT0 A;  3IHZ A;  1NWR A;  4FAP A;  2Y78 A;  2EUL A;  1ZBW A;  4A0U A;  1FKD A;  1FKG A;  4GLX A;  1GUV A;  2ETN A;  2OLH A;  2QF8 A;  1FKF A;  1W9P A;  2PPO A;  3BXW A;  2BA1 A;  4W9Q A;  5GPG A;  2ZQS A;  2ESC A;  5B8I C;  3ARO A;  1NMW A;  4WK9 A;  3LKX A;  3CGM A;  1RP5 A;  3O5I A;  1ZB5 A;  3GTY X;  4Q22 A;  1U79 A;  4KR0 B;  1ROT A;  3O5G A;  5HW8 A;  2ZQV A;  2DG9 A;  3ARP A;  2DG3 A;  3AS0 A;  4DRO A;  2O92 A;  3UQA A;  3O5O A;  4LGX A;  3IKD A;  3O5K A;  4MNK A;  2N87 A;  3CHD A;  3UQI A;  5GPR A;  4DRN A;  2DSU A;  4ZPW R;  5GQB A;  5DIT A;  3JYJ A;  3G6L A;  1EG3 A;  1Q6H A;  2RUR A;  2JXW A;  1FLC A;  1F40 A;  3WD2 A;  3WD3 A;  3L4H A;  1FKH A;  2XP5 A;  4Z2K A;  3UF8 A;  5E5W A;  3ARQ A;  4ODM A;  4DRJ A;  3KAF A;  4P8V A;  4U86 A;  3ARZ A;  4WKH A;  3O5D A;  3B9D A;  1EDQ A;  2DG4 A;  1E6N A;  2A3E A;  1FKI A;  2DK1 A;  3O5L A;  3TCZ A;  1Q1C A;  1FKL A;  1FFR A;  4LAV A;  2XP4 A;  1D2K A;  1LL6 A;  3MCB A;  2A3A A;  2XP8 A;  1FD9 A;  1TCO C;  2ZQU A;  2LJ4 A;  3RM8 A;  2KO7 A;  1E6Z A;  2WK2 A;  2B5U B;  1HKI A;  3KZ7 A;  4PTM A;  1VF8 A;  1WMV A;  3PQH A;  2PV2 A;  5DIU A;  4J4N A;  1EG4 A;  3B7X A;  3NTP A;  4R5E A;  4UDM A;  5DO2 A;  1NSG A;  3PA7 A;  4DIP A;  1J6Y A;  1LJY A;  1XRV A;  2RE3 A;  4A0T A;  2D9F A;  1JVW A;  1HKK A;  2PN0 A;  1ROU A;  4U85 A;  4IQC A;  3O5P A;  4O2T A;  1J4I A;  4ODP A;  4ODL A;  4URI A;  1QPF A;  3WL1 A;  2KXQ A;  1TFV A;  5HTG A;  5DIV A;  2MDI A;  2VN1 A;  3KAH A;  1J4R A;  1E9L A;  3LUO A;  3M7N A;  4ML4 A;  1SYT A;  3WD1 A;  4IPX A;  2DJY A;  4ODN A;  2L4J A;  3RM9 A;  4TX0 A;  4GGQ A;  2M1I A;  2LGO A;  2VCD A;  3TDB A;  1HKJ A;  3CHC A;  5HT1 A;  4Z2L A;  1HKM A;  2A3B A;  2YSB A;  3ARR A;  5J6E A;  4L3N A;  4U84 A;  2YAJ B;  5E64 A;  2MLZ A;  1LL4 A;  2M08 A;  2KE0 A;  2DMV A;  2LKN A;  4TW7 A;  4LAX A;  5HW6 A;  3IK8 A;  5HUA A;  3M85 A;  1X6N A;  2MLY A;  3RFW A;  2G41 A;  4ZPV R;  3FXY A;  3JYM A;  3O5F A;  1YAT A;  4TYO A;  1O6I A;  2XP3 A;  1NWU A;  4P8W A;  4MPK A;  3ARY A;  5HW7 A;  4IT4 A;  3BMB A;  4NSB A;  2EZ5 W;  3WQV A;  4DZ3 A;  1GRJ A;  2MF9 A;  4DH0 A;  5HWC A;  2WAD A;  1QZ2 A;  3FY1 A;  5CQ2 A;  5HKG A;  2M2A A;  4N19 A;  3UI4 A;  3O5M A;  1FFQ A;  1W1V A;  4TW8 A;  1FAP A;  3OOB A;  1ZL1 A;  3RGC A;  1Q6U A;  3NI6 A;  4HBO A;  3KAC A;  2JMF A;  3MQG A;  4DWS C;  1BL4 A;  5E66 A;  1D6O A;  4S3K A;  4DRM A;  1JND A;  3FS8 A;  3VAW A;  2P4V A;  2M3O W;  2B31 A;  2F4E A;  4HAR A;  4J4O A;  4WKF A;  4DZ2 A;  2G8Z A;  3MCB B;  3WIJ A;  2ZR6 A;  3ARW A;  4MAV A;  5HWB A;  3O5Q A;  3UI6 A;  1B6C A;  4QT3 A;  2F21 A;  1E6P A;  2KGJ A;  1ZCN A;  2OWO A;  3ALG A;  4HBE A;  4MGV A;  1T11 A;  1JNS A;  1NH6 A;  3FSB A;  3H9R B;  2E45 A;  1M5Y A;  3WKZ A;  1WB0 A;  2DWV A;  4LAY A;  4MNL A;  1LL7 A;  1GOI A;  2RSE A;  1LG2 A;  2DPE A;  3QOK A;  5E65 A;  1FKB A;  1LQ0 A;  1EIB A;  1OGB A;  2FKE A;  1H0I A;  1IX5 A;  1JCH B;  1KT1 A; 
#chains in the Genus database with same CATH homology
 2IUZ A;  5HBF A;  4DRQ A;  2PV1 A;  3LE4 A;  2ZAJ A;  3WQW A;  3AQU A;  3UQB A;  2YSI A;  3O5J A;  1W1Y A;  2JZV A;  4P8U A;  1D7J A;  1Y0O A;  4ODQ A;  3WH0 A;  1OWQ A;  3CHE A;  1NWS A;  3RM4 A;  4JFK A;  3ODK A;  4TNS A;  3MDY B;  4DWS A;  4JFJ A;  2RQS A;  3I6C A;  1FKS A;  4DRH A;  2LAJ A;  3O5E A;  1UR9 A;  2Y8N B;  1O6W A;  2PI6 A;  3CH9 A;  3WD4 A;  1L1P A;  1NMV A;  4REX A;  1WR7 A;  2JX8 A;  1WAW A;  2PPP A;  3OA5 A;  5JH8 A;  2RUD A;  4S3J A;  1LG1 A;  4R0X A;  2YSH A;  4IT6 A;  3KAG A;  4BF8 A;  3UI5 A;  2IF4 A;  4E5R A;  1W1P A;  1CTN A;  3CHF A;  5DF0 A;  1PIN A;  3LKX B;  3FAP A;  2QRV A;  3PR9 A;  2KFW A;  4G50 A;  1X6L A;  4MSP A;  3NRK A;  4ZS6 A;  3ARX A;  4MNM A;  2DT2 A;  5E62 A;  1HJX A;  2A3C A;  4W5U A;  3KCE A;  2DSZ A;  1H0G A;  1FKR A;  2RUC A;  1EQ3 A;  4FN2 A;  5D75 A;  4AY1 A;  3KAB A;  1P5Q A;  1ZBV A;  3KAI A;  2OFN A;  1XHG A;  1EYM A;  5BXJ A;  1FKK A;  2YSG A;  3O5R A;  2MLX A;  1JNE A;  1W26 A;  2MNT A;  1ZU8 A;  2DT1 A;  2FDM A;  5U47 A;  4KQZ A;  4DT4 A;  1ZBK A;  2DSW A;  3JXV A;  5AHT A;  2XP6 A;  1E15 A;  2YBT A;  3G6M A;  1ZBC A;  4MTV A;  2XP7 A;  1I5H W;  2PBC A;  3B9E A;  4WKA A;  4DWS D;  4ODR A;  1RD6 A;  3ARS A;  1W1T A;  2ZR5 A;  2M8J A;  2PPN A;  2WLZ A;  2DT0 A;  2F2D A;  2PV3 A;  2L2S A;  1R9H A;  4W9P A;  3WD0 A;  2O9O A;  2WAE A;  3GPK A;  3B8S A;  3ARU A;  4L72 B;  4WJX A;  4W9O A;  2XPA A;  1FKT A;  4TW6 A;  3TC5 A;  4JYS A;  1UR8 A;  1A7X A;  2FAP A;  4Z2J A;  1TK7 A;  3PRB A;  4LAW A;  2AOS A;  3B9A A;  1BKF A;  4DRI A;  1F8A B;  2AWG A;  3PRA A;  1K9T A;  1JMQ A;  4QZV B;  2UZ5 A;  4Z2G A;  3PRD A;  1NWT A;  3EY6 A;  4IQ2 A;  1C9H A;  4DWS B;  4P8X A;  1WNO A;  4G2P A;  4JFL A;  4NZC A;  3CZ8 A;  1Q6I A;  2K8I A;  4ODO A;  1OGG A;  4JFI A;  4XAK A;  2ZQT A;  1D7I A;  1GPF A;  4QT2 A;  1SR0 A;  1HJV A;  5I98 A;  3RME A;  1FJD A;  1YW5 A;  4GIV A;  2Q5A A;  1KFW A;  4C02 B;  1J4H A;  2ITK A;  2WM0 A;  4Q7N A;  3MQH A;  1W9V A;  2XP9 A;  2LPV A;  5DEZ A;  2WLY A;  4Z2H A;  1K9R A;  3AS1 A;  3CNG A;  4Z2I A;  1N1A A;  4DRK A;  3IKG A;  3ART A;  2DK7 A;  4ODK A;  2DT3 A;  4ZPT R;  1EHN A;  1E6R A;  1W9U A;  4WIW A;  3W4R A;  2MPH A;  2JV4 A;  2M8I A;  1JNT A;  3WL0 A;  1K9Q A;  1PBK A;  2KI3 A;  3ALF A;  2ZR4 A;  3CGN A;  3FSC A;  1FKJ A;  4JFM A;  3ARV A;  1ITX A;  2KR7 A;  2YSF A;  4ITZ A;  1QPL A;  3AS2 A;  2RUQ A;  1ZK6 A;  1HXV A;  2XPB A;  3KAD A;  1HJW A;  1D7H A;  4QIB A;  4DRP A;  4MNJ A;  4NNR A;  1TR8 A;  2DSV A;  3AS3 A;  2YBU A;  1KT0 A;  3IHZ A;  1NWR A;  4FAP A;  2Y78 A;  1ZBW A;  4A0U A;  1FKD A;  1FKG A;  4GLX A;  1GUV A;  2OLH A;  2QF8 A;  3BXW A;  1FKF A;  1W9P A;  2PPO A;  2BA1 A;  4W9Q A;  5GPG A;  2ZQS A;  2ESC A;  5B8I C;  3ARO A;  1NMW A;  4WK9 A;  3LKX A;  3CGM A;  1RP5 A;  3O5I A;  1ZB5 A;  4Q22 A;  1U79 A;  4KR0 B;  1ROT A;  3O5G A;  5HW8 A;  2ZQV A;  2DG9 A;  3AS0 A;  2DG3 A;  4DRO A;  2O92 A;  3UQA A;  3O5O A;  4LGX A;  3IKD A;  3O5K A;  4MNK A;  2N87 A;  3CHD A;  3UQI A;  5GPR A;  4DRN A;  2DSU A;  4ZPW R;  5GQB A;  5DIT A;  3JYJ A;  3G6L A;  1EG3 A;  1Q6H A;  2RUR A;  2JXW A;  1FLC A;  1F40 A;  3WD2 A;  3WD3 A;  3L4H A;  1FKH A;  2XP5 A;  4Z2K A;  3UF8 A;  5E5W A;  3ARQ A;  4ODM A;  4DRJ A;  3KAF A;  4P8V A;  4U86 A;  3ARZ A;  4WKH A;  3O5D A;  3B9D A;  1EDQ A;  2DG4 A;  1E6N A;  2A3E A;  1FKI A;  2DK1 A;  3O5L A;  3TCZ A;  1Q1C A;  1FKL A;  1FFR A;  4LAV A;  2XP4 A;  1D2K A;  1LL6 A;  3MCB A;  2A3A A;  2XP8 A;  1FD9 A;  1TCO C;  2ZQU A;  2LJ4 A;  3RM8 A;  2KO7 A;  1E6Z A;  2WK2 A;  1HKI A;  3KZ7 A;  4PTM A;  1VF8 A;  1WMV A;  3PQH A;  2PV2 A;  5DIU A;  4J4N A;  1EG4 A;  3B7X A;  3NTP A;  4R5E A;  5DO2 A;  1NSG A;  3PA7 A;  4DIP A;  1J6Y A;  1LJY A;  1XRV A;  2RE3 A;  4A0T A;  2D9F A;  1JVW A;  1HKK A;  1ROU A;  4U85 A;  4IQC A;  3O5P A;  4O2T A;  1J4I A;  4ODP A;  4ODL A;  4URI A;  1QPF A;  3WL1 A;  2KXQ A;  1TFV A;  5HTG A;  5DIV A;  2MDI A;  2VN1 A;  3KAH A;  1J4R A;  1E9L A;  3LUO A;  3M7N A;  4ML4 A;  1SYT A;  3WD1 A;  4IPX A;  2DJY A;  4ODN A;  2L4J A;  3RM9 A;  4TX0 A;  4GGQ A;  2M1I A;  2LGO A;  2VCD A;  3TDB A;  1HKJ A;  3CHC A;  5HT1 A;  4Z2L A;  1HKM A;  2A3B A;  2YSB A;  3ARR A;  5J6E A;  4L3N A;  4U84 A;  2YAJ B;  5E64 A;  2MLZ A;  1LL4 A;  2M08 A;  2KE0 A;  2DMV A;  2LKN A;  4TW7 A;  4LAX A;  5HW6 A;  3IK8 A;  5HUA A;  3M85 A;  1X6N A;  2MLY A;  3RFW A;  2G41 A;  4ZPV R;  3FXY A;  3JYM A;  3O5F A;  1YAT A;  4TYO A;  1O6I A;  2XP3 A;  1NWU A;  4P8W A;  4MPK A;  3ARY A;  5HW7 A;  4IT4 A;  3WQV A;  4NSB A;  2EZ5 W;  4DZ3 A;  5HWC A;  4DH0 A;  2MF9 A;  2WAD A;  1QZ2 A;  3FY1 A;  5CQ2 A;  5HKG A;  2M2A A;  4N19 A;  3UI4 A;  3O5M A;  1FFQ A;  1W1V A;  4TW8 A;  1FAP A;  3OOB A;  1ZL1 A;  3RGC A;  1Q6U A;  3NI6 A;  4HBO A;  3KAC A;  2JMF A;  3MQG A;  4DWS C;  1BL4 A;  5E66 A;  1D6O A;  4S3K A;  4DRM A;  1JND A;  3FS8 A;  3VAW A;  2M3O W;  2B31 A;  2F4E A;  4HAR A;  4J4O A;  4WKF A;  4DZ2 A;  2G8Z A;  3MCB B;  3WIJ A;  2ZR6 A;  3ARW A;  4MAV A;  5HWB A;  3O5Q A;  3UI6 A;  1B6C A;  4QT3 A;  2F21 A;  1E6P A;  2KGJ A;  1ZCN A;  2OWO A;  3ALG A;  4HBE A;  4MGV A;  1T11 A;  1JNS A;  1NH6 A;  3FSB A;  3H9R B;  2E45 A;  1M5Y A;  3WKZ A;  1WB0 A;  2DWV A;  4LAY A;  4MNL A;  1LL7 A;  1GOI A;  2RSE A;  1LG2 A;  2DPE A;  3QOK A;  5E65 A;  1FKB A;  1LQ0 A;  1EIB A;  1OGB A;  2FKE A;  1H0I A;  1IX5 A;  3ARP A;  1KT1 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...