2ZQTA

Crystal structure of a mutant pin1 peptidyl-prolyl cis-trans isomerase
Total Genus 47
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
47
sequence length
158
structure length
153
Chain Sequence
KLPPGWEKRMSRSSGRVYYFNHITNASQWERPSGGKNGQGEPARVRCSHLLVKHSQSRRPSSWRQEKITRTKEEALELINGYIQKIKSGEEDFESLASQFSDCSSAKARGDLGAFSRGQAQKPFEDASFALRTGEMSGPVFTDSGIHIILRTE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural studies on PIN1 mutants
rcsb
source organism Homo sapiens
molecule tags Isomerase
molecule keywords Peptidyl-prolyl cis-trans isomerase NIMA-interacting 1
total genus 47
structure length 153
sequence length 158
ec nomenclature ec 5.2.1.8: Peptidylprolyl isomerase.
pdb deposition date 2008-08-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00397 WW WW domain
A PF00639 Rotamase PPIC-type PPIASE domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.20.70.10 Mainly Beta Single Sheet Ubiquitin Ligase Nedd4; Chain: W; Ubiquitin Ligase Nedd4; Chain: W; 2zqtA01
3.10.50.40 Alpha Beta Roll Chitinase A; domain 3 Chitinase A; domain 3 2zqtA02
4U85A 5HUAA 3KAFA 3WH0A 4J4NA 5HW7A 4TW6A 2F4EA 4TNSA 5I98A 5BXJA 2MF9A 2F21A 1FKSA 1F8AB 2BA1A 1JNTA 1Q6UA 1ZCNA 3NI6A 3KCEA 1BKFA 3IKDA 2LPVA 2YSBA 2LKNA 1TCOC 2XPAA 2K8IA 1FKRA 2YSFA 1D7HA 2PV3A 1HXVA 2RE3A 2MLYA 1WMVA 3O5MA 5GPGA 2D9FA 2XP6A 2M8JA 4MGVA 5CQ2A 3O5DA 3UI5A 2RUDA 3IK8A 5DIUA 1J4IA 1QZ2A 2MLZA 4IQ2A 4DH0A 4DRMA 4DRJA 1A7XA 1FKIA 2DG3A 2XP8A 3PRDA 3CNGA 1WR7A 2YSHA 1C9HA 1QPFA 2PPOA 2FKEA 2M2AA 1D7JA 2RQSA 2RURA 2KO7A 2L4JA 4DRKA 1J6YA 1FKBA 3KABA 2DG4A 5HWCA 2ZQVA 4ODQA 1ZK6A 4TW8A 1FAPA 1YW5A 2RSEA 2RUCA 3JYMA 5D75A 3I6CA 4DT4A 3O5EA 1D7IA 3VAWA 4DZ2A 4TW7A 4DROA 2M3OW 2LGOA 2E45A 2L2SA 3UQAA 4JFJA 1KT0A 2ZQSA 2KGJA 2Y78A 2DMVA 2MNTA 4TYOA 1JMQA 1FKKA 3EY6A 4JFKA 4DRNA 2F2DA 3MDYB 1EG3A 2KXQA 1NMVA 1T11A 2FAPA 4ODRA 1JNSA 2PBCA 1J4RA 4LAXA 2AWGA 4IQCA 2UZ5A 2XP3A 4W9QA 1TK7A 3OOBA 4ODMA 4QT3A 3H9RB 4DRPA 4JYSA 5HW6A 2XP9A 1FD9A 2JV4A 1Q6IA 3KACA 4DIPA 2DJYA 3TC5A 2ZQUA 1FKFA 5HTGA 4BF8A 4IPXA 2JXWA 5J6EA 3PA7A 3RGCA 2ZAJA 2PV1A 3O5LA 3KAGA 4GGQA 3NTPA 1NMWA 2EZ5W 1FKJA 3GPKA 4W9OA 2Q5AA 3O5JA 4LAWA 2ZR4A 3M85A 5B8IC 1PINA 4JFMA 4N19A 2LAJA 2M1IA 1R9HA 4G2PA 1O6WA 3LE4A 1EYMA 3O5KA 4ODOA 4U84A 1K9QA 3O5FA 5HKGA 4NNRA 5HW8A 1P5QA 4U86A 2PPNA 2VN1A 3O5GA 2N87A 2ZR5A 1FKGA 1Q1CA 2DG9A 3JXVA 4REXA 2KE0A 4ITZA 1K9RA 5DITA 4QIBA 1YATA 3O5QA 3TCZA 2M08A 2M8IA 4FN2A 3UQIA 5HWBA 1F40A 3PRBA 1FKTA 3IHZA 4JFLA 4J4OA 2PV2A 1L1PA 4TX0A 3CGMA 1QPLA 1FKDA 2JZVA 3O5RA 2DK1A 1U79A 3CGNA 2RUQA 1FKHA 3TDBA 1KT1A 2JMFA 2KR7A 4C02B 4E5RA 1J4HA 1ROUA 4GIVA 3UQBA 2MPHA 3LUOA 2DWVA 1EQ3A 1B6CA 3UI6A 1ROTA 3ODKA 1Y0OA 3NRKA 4ODPA 2YSGA 4W9PA 2JX8A 3IKGA 3O5IA 2YSIA 3KAIA 1W26A 1EG4A 2XPBA 2KI3A 4ODKA 3KADA 1M5YA 4FAPA 4DRQA 4O2TA 2LJ4A 3L4HA 1D6OA 3KZ7A 4QT2A 5HT1A 1FKLA 3RFWA 1JVWA 3JYJA 2DK7A 2XP4A 4R0XA 2ZR6A 3O5OA 4ODNA 4MSPA 2OFNA 5DIVA 5AHTA 2MDIA 3O5PA 2XP7A 3FAPA 1PBKA 3M7NA 3UI4A 4G50A 4DZ3A 2ITKA 1BL4A 1NSGA 2IF4A 4JFIA 3B7XA 4LAYA 2PPPA 3KAHA 4ODLA 1Q6HA 3UF8A 1I5HW 1FJDA 1N1AA 4DRHA 2MLXA 2XP5A 4DRIA 2KFWA 2VCDA 2ZQTA 4LAVA
chains in the Genus database with same CATH superfamily
2G41A 3WH0A 1CTNA 4ZS6A 2LPVA 4S3JA 2YSBA 2K8IA 2PV3A 1HXVA 5E66A 4HARA 3IK8A 3CHCA 1J4IA 2MLZA 4DRMA 1LG1A 2DG3A 3PRDA 3CNGA 1ZBCA 1QPFA 5GQBA 3GU0A 2F23A 3WKZA 1TR8A 3CH9A 2ZQVA 4TW8A 1OGGA 2RSEA 1O6IA 1X6LA 3I6CA 4DT4A 3O5EA 3VAWA 2LGOA 1WAWA 2DT1A 1GUVA 2ZQSA 2KGJA 2WLYA 4JFKA 1SYTA 2KXQA 1HKJA 1TFVA 2PBCA 4HBOA 5HW6A 2XP9A 3KACA 2JV4A 4DIPA 4MTVA 2DJYA 1FKFA 4P8VA 3WD1A 4IPXA 3PA7A 3RGCA 2ZAJA 2Y8NB 3O5JA 3M85A 1R9HA 1O6WA 3LE4A 1EYMA 3CHFA 4ODOA 4Z2IA 4NNRA 1ZBVA 3O5GA 5DITA 1H0GA 1SR0A 4PTMA 3TCZA 2WLZA 4WKAA 4Z2KA 3PRBA 3MQHA 3IHZA 4JFLA 3MQGA 1QPLA 3B9EA 1U79A 3CGNA 2ESCA 2JMFA 4C02B 4GIVA 3FSCA 1EIBA 2JX8A 3GTYX 2YSIA 4O2TA 2YAJB 4DWSD 2LJ4A 3L4HA 1D6OA 3KZ7A 1D2KA 1HJWA 4QT2A 3RFWA 5DEZA 2ZR6A 2OFNA 1JNDA 3UI4A 1OWQA 2ITKA 1BL4A 1NSGA 1FJDA 2IUZA 2XP5A 4WKFA 2ZQTA 4LAVA 5BXJA 3ARQA 1FKSA 1JNTA 3WQVA 1H0IA 3CHEA 5U47A 5E5WA 4Z2GA 1W1TA 1K9TA 1D7HA 3O5MA 3AS2A 3AROA 1GRJA 1W9UA 2XP6A 3WD0A 4MGVA 5CQ2A 3WIJA 4DWSB 2A3BA 2XP8A 2PPOA 2FKEA 1D7JA 1JCHB 2RURA 2KO7A 2L4JA 1J6YA 3BMBA 2A3AA 4IT4A 4ODQA 1ZK6A 4P8XA 2RUCA 1YW5A 3JYMA 1NH6A 5D75A 3CZ8A 5JH8A 1D7IA 4TW7A 2QRVA 1HKMA 2L2SA 2DSZA 1E6PA 1ZU8A 2Y78A 4L3NA 4Z2HA 1NWRA 1LL4A 1J4RA 4LAXA 1E44A 4Q22A 1W1YA 3B9DA 4Q7NA 2A3EA 3OOBA 4A0TA 4JYSA 2DSUA 3TC5A 3WL0A 2JXWA 2P4VA 3ARXA 3G6LA 2WM0A 1NMWA 2EZ5W 2WAEA 2Q5AA 4LAWA 3CHDA 4ZPWR 2O92A 4N19A 2M1IA 3O5KA 4U84A 5HKGA 3O5FA 1RP5A 4ITZA 4NSBA 4REXA 2KE0A 3QOKA 4QIBA 1YATA 3UQIA 4FN2A 2M8IA 4MAVA 3ALGA 1XHGA 3CGMA 4MPKA 3O5RA 3PR9A 2RUQA 2KR7A 1J4HA 1LG2A 2DWVA 3UI6A 1NWSA 2OLHA 4ODPA 3IKGA 4UDMA 1W26A 4FAPA 2KI3A 1M5YA 2B5UB 4DRQA 3RM8A 4XAKA 2YBUA 5HT1A 3JYJA 2XP4A 3ARRA 1ZB5A 3O5OA 5DIVA 3MCBA 2DSWA 3ARZA 2MDIA 3O5PA 2XP7A 3FAPA 3WD2A 1FFQA 4MNKA 3ARWA 4AY1A 4LAYA 4ODLA 2DT0A 3OA5A 2KFWA 4DRIA 1JNSA 4P8WA 4NZCA 3ARUA 2A3CA 4Z2JA 5I98A 2B31A 2MF9A 3G6MA 2F21A 3NI6A 1WNOA 1ZCNA 3FXYA 3IKDA 1EDQA 2XPAA 2YSFA 2RE3A 2MLYA 4S3KA 5GPGA 2D9FA 3RM9A 5GPRA 4Z2LA 1WR7A 2OWOA 3B8SA 1FKBA 5HWCA 2DG4A 4MNLA 3FY1A 5E65A 4DZ2A 4ZPTR 2M3OW 4ML4A 4DROA 4JFJA 1KT0A 2MNTA 4DRNA 2F2DA 1NWUA 1EG3A 1NMVA 4ODRA 2AWGA 2UZ5A 1HJVA 2ETNA 3BXWA 4ODMA 4WK9A 3ARTA 1FD9A 4WKHA 1E6ZA 3EIPA 3ARVA 2ZQUA 5HTGA 5J6EA 4GGQA 4KQZA 4W9OA 1FKJA 3LKXA 4IT6A 2ZR4A 5B8IC 4JFMA 2LAJA 4G2PA 3PRAA 1K9QA 5HW8A 4U86A 2PPNA 2VN1A 1LJYA 2N87A 2ZR5A 1FFRA 1Q1CA 1UR8A 2DT2A 3ALFA 3O5QA 2M08A 1F40A 1FKTA 4J4OA 3W4RA 1KFWA 1L1PA 4A0UA 1KT1A 4E5RA 1ROUA 2MPHA 3LUOA 1EQ3A 1B6CA 4WIWA 1ROTA 3ODKA 3PQHA 2YSGA 4W9PA 3AQUA 1EG4A 2XPBA 4QZVB 3KADA 1VF8A 1LQ0A 3WQWA 1W9VA 1E6NA 4ODNA 4DZ3A 1PBKA 3M7NA 1LL6A 2YBTA 4JFIA 3KAHA 5HBFA 5DO2A 3UF8A 1N1AA 2MLXA 1NWTA 4U85A 5HUAA 5E62A 1E15A 2WK2A 3KAFA 3AS1A 4J4NA 5HW7A 4TW6A 2F4EA 4TNSA 5DF0A 2PN0A 1F8AB 2BA1A 1Q6UA 3MCBB 1ITXA 3KCEA 3LKXB 1BKFA 1E9LA 2LKNA 1TCOC 1FKRA 1FLCA 3B9AA 1WMVA 2M8JA 1XRVA 3O5DA 4GLXA 3UI5A 2RUDA 5DIUA 1QZ2A 1UR9A 4IQ2A 4DH0A 4DRJA 1A7XA 1FKIA 1W9PA 2YSHA 4DWSA 4MNJA 1C9HA 2M2AA 2RQSA 1JNEA 4DRKA 3KABA 2G8ZA 1FAPA 4W5UA 2DSVA 1ZL1A 1W1PA 3UQAA 2E45A 4URIA 1OGBA 1W1VA 2DT3A 2DMVA 4TYOA 1JMQA 1FKKA 3EY6A 4R5EA 5E64A 3MDYB 1T11A 1GOIA 2FAPA 1HKKA 4IQCA 2XP3A 4W9QA 1TK7A 4QT3A 1LL7A 3H9RB 4DRPA 1E6RA 1Q6IA 3WL1A 1WB0A 4BF8A 2PV1A 3O5LA 3KAGA 4KR0B 3NTPA 4P8UA 1IX5A 3GPKA 1PINA 2WADA 4ZPVR 1GPFA 2AOSA 3RMEA 1P5QA 2EULA 3ARYA 1FKGA 2DG9A 3JXVA 1K9RA 4DWSC 5HWBA 2FDMA 1HJXA 2O9OA 2PV2A 4TX0A 1FKDA 2JZVA 3WD3A 2DK1A 1FKHA 3TDBA 1RD6A 3FSBA 2DPEA 4L72B 3UQBA 3AS3A 2QF8A 4MNMA 1Y0OA 1HKIA 3NRKA 4HBEA 4WJXA 3O5IA 3KAIA 4ODKA 3RM4A 3WD4A 1FKLA 1X6NA 1JVWA 3AS0A 2DK7A 2PI6A 4R0XA 4MSPA 1EHNA 5AHTA 3ARSA 4G50A 2IF4A 4LGXA 1ZBKA 3B7XA 2PPPA 3FS8A 1Q6HA 1I5HW 1ZBWA 4DRHA 3ARPA 2VCDA
chains in the Genus database with same CATH topology
2G41A 3WH0A 1CTNA 4ZS6A 2LPVA 4S3JA 2YSBA 2K8IA 2PV3A 1HXVA 5E66A 4HARA 3IK8A 3CHCA 1J4IA 2MLZA 4DRMA 1LG1A 2DG3A 3PRDA 3CNGA 1ZBCA 1QPFA 5GQBA 3WKZA 1TR8A 3CH9A 2ZQVA 4TW8A 1OGGA 2RSEA 1O6IA 1X6LA 3I6CA 4DT4A 3O5EA 3VAWA 2LGOA 1WAWA 2DT1A 1GUVA 2ZQSA 2KGJA 2WLYA 4JFKA 1SYTA 2KXQA 1HKJA 1TFVA 2PBCA 4HBOA 5HW6A 2XP9A 3KACA 2JV4A 4DIPA 4MTVA 2DJYA 1FKFA 4P8VA 3WD1A 4IPXA 3PA7A 3RGCA 2ZAJA 2Y8NB 3O5JA 3M85A 1R9HA 1O6WA 3LE4A 1EYMA 3CHFA 4ODOA 4Z2IA 4NNRA 1ZBVA 3O5GA 5DITA 1H0GA 1SR0A 4PTMA 3TCZA 2WLZA 4WKAA 4Z2KA 3PRBA 3MQHA 3IHZA 4JFLA 3MQGA 1QPLA 3B9EA 1U79A 3CGNA 2ESCA 2JMFA 4C02B 4GIVA 3FSCA 1EIBA 2JX8A 2YSIA 4O2TA 2YAJB 4DWSD 2LJ4A 3L4HA 1D6OA 3KZ7A 1D2KA 1HJWA 4QT2A 3RFWA 5DEZA 2ZR6A 2OFNA 1JNDA 3UI4A 1OWQA 2ITKA 1BL4A 1NSGA 1FJDA 2IUZA 2XP5A 4WKFA 2ZQTA 4LAVA 5BXJA 3ARQA 1FKSA 1JNTA 3WQVA 1H0IA 3CHEA 5U47A 5E5WA 4Z2GA 1W1TA 1K9TA 1D7HA 3O5MA 3AS2A 3AROA 1W9UA 2XP6A 3WD0A 4MGVA 5CQ2A 3WIJA 4DWSB 2A3BA 2XP8A 2PPOA 2FKEA 1D7JA 2RURA 2KO7A 2L4JA 1J6YA 2A3AA 4IT4A 4ODQA 1ZK6A 4P8XA 2RUCA 1YW5A 3JYMA 1NH6A 5D75A 3CZ8A 5JH8A 1D7IA 4TW7A 2QRVA 1HKMA 2L2SA 2DSZA 1E6PA 1ZU8A 2Y78A 4L3NA 4Z2HA 1NWRA 1LL4A 1J4RA 4LAXA 4Q22A 1W1YA 3B9DA 4Q7NA 2A3EA 3OOBA 4A0TA 4JYSA 2DSUA 3TC5A 3WL0A 2JXWA 3ARXA 3G6LA 2WM0A 1NMWA 2EZ5W 2WAEA 2Q5AA 4LAWA 3CHDA 4ZPWR 2O92A 4N19A 2M1IA 3O5KA 4U84A 5HKGA 3O5FA 1RP5A 4ITZA 4NSBA 4REXA 2KE0A 3QOKA 4QIBA 1YATA 3UQIA 4FN2A 2M8IA 4MAVA 3ALGA 1XHGA 3CGMA 4MPKA 3O5RA 3PR9A 2RUQA 2KR7A 1J4HA 1LG2A 2DWVA 3UI6A 1NWSA 2OLHA 4ODPA 3IKGA 1W26A 4FAPA 2KI3A 1M5YA 4DRQA 3RM8A 4XAKA 2YBUA 5HT1A 3JYJA 2XP4A 3ARRA 1ZB5A 3O5OA 5DIVA 3MCBA 2DSWA 3ARZA 2MDIA 3O5PA 2XP7A 3FAPA 3WD2A 1FFQA 4MNKA 3ARWA 4AY1A 4LAYA 4ODLA 2DT0A 3OA5A 2KFWA 4DRIA 1JNSA 4P8WA 4NZCA 3ARUA 2A3CA 4Z2JA 5I98A 2B31A 2MF9A 3G6MA 2F21A 3NI6A 1WNOA 1ZCNA 3FXYA 3IKDA 1EDQA 2XPAA 2YSFA 2RE3A 2MLYA 4S3KA 5GPGA 2D9FA 3RM9A 5GPRA 4Z2LA 1WR7A 2OWOA 3B8SA 1FKBA 5HWCA 2DG4A 4MNLA 3FY1A 5E65A 4DZ2A 4ZPTR 2M3OW 4ML4A 4DROA 4JFJA 1KT0A 2MNTA 4DRNA 2F2DA 1NWUA 1EG3A 1NMVA 4ODRA 2AWGA 2UZ5A 1HJVA 3BXWA 4ODMA 4WK9A 3ARTA 1FD9A 4WKHA 1E6ZA 3ARVA 2ZQUA 5HTGA 5J6EA 4GGQA 4KQZA 4W9OA 1FKJA 3LKXA 4IT6A 2ZR4A 5B8IC 4JFMA 2LAJA 4G2PA 3PRAA 1K9QA 5HW8A 4U86A 2PPNA 2VN1A 1LJYA 2N87A 2ZR5A 1FFRA 1Q1CA 1UR8A 2DT2A 3ALFA 3O5QA 2M08A 1F40A 1FKTA 4J4OA 3W4RA 1KFWA 1L1PA 4A0UA 1KT1A 4E5RA 1ROUA 2MPHA 3LUOA 1EQ3A 1B6CA 4WIWA 1ROTA 3ODKA 3PQHA 2YSGA 4W9PA 3AQUA 1EG4A 2XPBA 4QZVB 3KADA 1VF8A 1LQ0A 3WQWA 1W9VA 1E6NA 4ODNA 4DZ3A 1PBKA 3M7NA 1LL6A 2YBTA 4JFIA 3KAHA 5HBFA 5DO2A 3UF8A 1N1AA 2MLXA 1NWTA 4U85A 5HUAA 5E62A 1E15A 2WK2A 3KAFA 3AS1A 4J4NA 5HW7A 4TW6A 2F4EA 4TNSA 5DF0A 1F8AB 2BA1A 1Q6UA 3MCBB 1ITXA 3KCEA 3LKXB 1BKFA 1E9LA 2LKNA 1TCOC 1FKRA 1FLCA 3B9AA 1WMVA 2M8JA 1XRVA 3O5DA 4GLXA 3UI5A 2RUDA 5DIUA 1QZ2A 1UR9A 4IQ2A 4DH0A 4DRJA 1A7XA 1FKIA 1W9PA 2YSHA 4DWSA 4MNJA 1C9HA 2M2AA 2RQSA 1JNEA 4DRKA 3KABA 2G8ZA 1FAPA 4W5UA 2DSVA 1ZL1A 1W1PA 3UQAA 2E45A 4URIA 1OGBA 1W1VA 2DT3A 2DMVA 4TYOA 1JMQA 1FKKA 3EY6A 4R5EA 5E64A 3MDYB 1T11A 1GOIA 2FAPA 1HKKA 4IQCA 2XP3A 4W9QA 1TK7A 4QT3A 1LL7A 3H9RB 4DRPA 1E6RA 1Q6IA 3WL1A 1WB0A 4BF8A 2PV1A 3O5LA 3KAGA 4KR0B 3NTPA 4P8UA 1IX5A 3GPKA 1PINA 2WADA 4ZPVR 1GPFA 2AOSA 3RMEA 1P5QA 3ARYA 1FKGA 2DG9A 3JXVA 1K9RA 4DWSC 5HWBA 2FDMA 1HJXA 2O9OA 2PV2A 4TX0A 1FKDA 2JZVA 3WD3A 2DK1A 1FKHA 3TDBA 1RD6A 3FSBA 2DPEA 4L72B 3UQBA 3AS3A 2QF8A 4MNMA 1Y0OA 1HKIA 3NRKA 4HBEA 4WJXA 3O5IA 3KAIA 4ODKA 3RM4A 3WD4A 1FKLA 1X6NA 1JVWA 3AS0A 2DK7A 2PI6A 4R0XA 4MSPA 1EHNA 5AHTA 3ARSA 4G50A 2IF4A 4LGXA 1ZBKA 3B7XA 2PPPA 3FS8A 1Q6HA 1I5HW 1ZBWA 4DRHA 3ARPA 2VCDA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4U85 A;  5HUA A;  3KAF A;  3WH0 A;  4J4N A;  5HW7 A;  4TW6 A;  2F4E A;  4TNS A;  5I98 A;  5BXJ A;  2MF9 A;  2F21 A;  1FKS A;  1F8A B;  2BA1 A;  1JNT A;  1Q6U A;  1ZCN A;  3NI6 A;  3KCE A;  1BKF A;  3IKD A;  2LPV A;  2YSB A;  2LKN A;  1TCO C;  2XPA A;  2K8I A;  1FKR A;  2YSF A;  1D7H A;  2PV3 A;  1HXV A;  2RE3 A;  2MLY A;  1WMV A;  3O5M A;  5GPG A;  2D9F A;  2XP6 A;  2M8J A;  4MGV A;  5CQ2 A;  3O5D A;  3UI5 A;  2RUD A;  3IK8 A;  5DIU A;  1J4I A;  1QZ2 A;  2MLZ A;  4IQ2 A;  4DH0 A;  4DRM A;  4DRJ A;  1A7X A;  1FKI A;  2DG3 A;  2XP8 A;  3PRD A;  3CNG A;  1WR7 A;  2YSH A;  1C9H A;  1QPF A;  2PPO A;  2FKE A;  2M2A A;  1D7J A;  2RQS A;  2RUR A;  2KO7 A;  2L4J A;  4DRK A;  1J6Y A;  1FKB A;  3KAB A;  2DG4 A;  5HWC A;  2ZQV A;  4ODQ A;  1ZK6 A;  4TW8 A;  1FAP A;  1YW5 A;  2RSE A;  2RUC A;  3JYM A;  5D75 A;  3I6C A;  4DT4 A;  3O5E A;  1D7I A;  3VAW A;  4DZ2 A;  4TW7 A;  4DRO A;  2M3O W;  2LGO A;  2E45 A;  2L2S A;  3UQA A;  4JFJ A;  1KT0 A;  2ZQS A;  2KGJ A;  2Y78 A;  2DMV A;  2MNT A;  4TYO A;  1JMQ A;  1FKK A;  3EY6 A;  4JFK A;  4DRN A;  2F2D A;  3MDY B;  1EG3 A;  2KXQ A;  1NMV A;  1T11 A;  2FAP A;  4ODR A;  1JNS A;  2PBC A;  1J4R A;  4LAX A;  2AWG A;  4IQC A;  2UZ5 A;  2XP3 A;  4W9Q A;  1TK7 A;  3OOB A;  4ODM A;  4QT3 A;  3H9R B;  4DRP A;  4JYS A;  5HW6 A;  2XP9 A;  1FD9 A;  2JV4 A;  1Q6I A;  3KAC A;  4DIP A;  2DJY A;  3TC5 A;  2ZQU A;  1FKF A;  5HTG A;  4BF8 A;  4IPX A;  2JXW A;  5J6E A;  3PA7 A;  3RGC A;  2ZAJ A;  2PV1 A;  3O5L A;  3KAG A;  4GGQ A;  3NTP A;  1NMW A;  2EZ5 W;  1FKJ A;  3GPK A;  4W9O A;  2Q5A A;  3O5J A;  4LAW A;  2ZR4 A;  3M85 A;  5B8I C;  1PIN A;  4JFM A;  4N19 A;  2LAJ A;  2M1I A;  1R9H A;  4G2P A;  1O6W A;  3LE4 A;  1EYM A;  3O5K A;  4ODO A;  4U84 A;  1K9Q A;  3O5F A;  5HKG A;  4NNR A;  5HW8 A;  1P5Q A;  4U86 A;  2PPN A;  2VN1 A;  3O5G A;  2N87 A;  2ZR5 A;  1FKG A;  1Q1C A;  2DG9 A;  3JXV A;  4REX A;  2KE0 A;  4ITZ A;  1K9R A;  5DIT A;  4QIB A;  1YAT A;  3O5Q A;  3TCZ A;  2M08 A;  2M8I A;  4FN2 A;  3UQI A;  5HWB A;  1F40 A;  3PRB A;  1FKT A;  3IHZ A;  4JFL A;  4J4O A;  2PV2 A;  1L1P A;  4TX0 A;  3CGM A;  1QPL A;  1FKD A;  2JZV A;  3O5R A;  2DK1 A;  1U79 A;  3CGN A;  2RUQ A;  1FKH A;  3TDB A;  1KT1 A;  2JMF A;  2KR7 A;  4C02 B;  4E5R A;  1J4H A;  1ROU A;  4GIV A;  3UQB A;  2MPH A;  3LUO A;  2DWV A;  1EQ3 A;  1B6C A;  3UI6 A;  1ROT A;  3ODK A;  1Y0O A;  3NRK A;  4ODP A;  2YSG A;  4W9P A;  2JX8 A;  3IKG A;  3O5I A;  2YSI A;  3KAI A;  1W26 A;  1EG4 A;  2XPB A;  2KI3 A;  4ODK A;  3KAD A;  1M5Y A;  4FAP A;  4DRQ A;  4O2T A;  2LJ4 A;  3L4H A;  1D6O A;  3KZ7 A;  4QT2 A;  5HT1 A;  1FKL A;  3RFW A;  1JVW A;  3JYJ A;  2DK7 A;  2XP4 A;  4R0X A;  2ZR6 A;  3O5O A;  4ODN A;  4MSP A;  2OFN A;  5DIV A;  5AHT A;  2MDI A;  3O5P A;  2XP7 A;  3FAP A;  1PBK A;  3M7N A;  3UI4 A;  4G50 A;  4DZ3 A;  2ITK A;  1BL4 A;  1NSG A;  2IF4 A;  4JFI A;  3B7X A;  4LAY A;  2PPP A;  3KAH A;  4ODL A;  1Q6H A;  3UF8 A;  1I5H W;  1FJD A;  1N1A A;  4DRH A;  2MLX A;  2XP5 A;  4DRI A;  2KFW A;  2VCD A;  2ZQT A;  4LAV A; 
#chains in the Genus database with same CATH topology
 2G41 A;  3WH0 A;  1CTN A;  4ZS6 A;  2LPV A;  4S3J A;  2YSB A;  2K8I A;  2PV3 A;  1HXV A;  5E66 A;  4HAR A;  3IK8 A;  3CHC A;  1J4I A;  2MLZ A;  4DRM A;  1LG1 A;  2DG3 A;  3PRD A;  3CNG A;  1ZBC A;  1QPF A;  5GQB A;  3GU0 A;  2F23 A;  3WKZ A;  1TR8 A;  3CH9 A;  2ZQV A;  4TW8 A;  1OGG A;  2RSE A;  1O6I A;  1X6L A;  3I6C A;  4DT4 A;  3O5E A;  3VAW A;  2LGO A;  1WAW A;  2DT1 A;  1GUV A;  2ZQS A;  2KGJ A;  2WLY A;  4JFK A;  1SYT A;  2KXQ A;  1HKJ A;  1TFV A;  2PBC A;  4HBO A;  5HW6 A;  2XP9 A;  3KAC A;  2JV4 A;  4DIP A;  4MTV A;  2DJY A;  1FKF A;  4P8V A;  3WD1 A;  4IPX A;  3PA7 A;  3RGC A;  2ZAJ A;  2Y8N B;  3O5J A;  3M85 A;  1R9H A;  1O6W A;  3LE4 A;  1EYM A;  3CHF A;  4ODO A;  4Z2I A;  4NNR A;  1ZBV A;  3O5G A;  5DIT A;  1H0G A;  1SR0 A;  4PTM A;  3TCZ A;  2WLZ A;  4WKA A;  4Z2K A;  3PRB A;  3MQH A;  3IHZ A;  4JFL A;  3MQG A;  1QPL A;  3B9E A;  1U79 A;  3CGN A;  2ESC A;  2JMF A;  4C02 B;  4GIV A;  3FSC A;  1EIB A;  2JX8 A;  3GTY X;  2YSI A;  4O2T A;  2YAJ B;  4DWS D;  2LJ4 A;  3L4H A;  1D6O A;  3KZ7 A;  1D2K A;  1HJW A;  4QT2 A;  3RFW A;  5DEZ A;  2ZR6 A;  2OFN A;  1JND A;  3UI4 A;  1OWQ A;  2ITK A;  1BL4 A;  1NSG A;  1FJD A;  2IUZ A;  2XP5 A;  4WKF A;  2ZQT A;  4LAV A;  5BXJ A;  3ARQ A;  1FKS A;  1JNT A;  3WQV A;  1H0I A;  3CHE A;  5U47 A;  5E5W A;  4Z2G A;  1W1T A;  1K9T A;  1D7H A;  3O5M A;  3AS2 A;  3ARO A;  1GRJ A;  1W9U A;  2XP6 A;  3WD0 A;  4MGV A;  5CQ2 A;  3WIJ A;  4DWS B;  2A3B A;  2XP8 A;  2PPO A;  2FKE A;  1D7J A;  1JCH B;  2RUR A;  2KO7 A;  2L4J A;  1J6Y A;  3BMB A;  2A3A A;  4IT4 A;  4ODQ A;  1ZK6 A;  4P8X A;  2RUC A;  1YW5 A;  3JYM A;  1NH6 A;  5D75 A;  3CZ8 A;  5JH8 A;  1D7I A;  4TW7 A;  2QRV A;  1HKM A;  2L2S A;  2DSZ A;  1E6P A;  1ZU8 A;  2Y78 A;  4L3N A;  4Z2H A;  1NWR A;  1LL4 A;  1J4R A;  4LAX A;  1E44 A;  4Q22 A;  1W1Y A;  3B9D A;  4Q7N A;  2A3E A;  3OOB A;  4A0T A;  4JYS A;  2DSU A;  3TC5 A;  3WL0 A;  2JXW A;  2P4V A;  3ARX A;  3G6L A;  2WM0 A;  1NMW A;  2EZ5 W;  2WAE A;  2Q5A A;  4LAW A;  3CHD A;  4ZPW R;  2O92 A;  4N19 A;  2M1I A;  3O5K A;  4U84 A;  5HKG A;  3O5F A;  1RP5 A;  4ITZ A;  4NSB A;  4REX A;  2KE0 A;  3QOK A;  4QIB A;  1YAT A;  3UQI A;  4FN2 A;  2M8I A;  4MAV A;  3ALG A;  1XHG A;  3CGM A;  4MPK A;  3O5R A;  3PR9 A;  2RUQ A;  2KR7 A;  1J4H A;  1LG2 A;  2DWV A;  3UI6 A;  1NWS A;  2OLH A;  4ODP A;  3IKG A;  4UDM A;  1W26 A;  4FAP A;  2KI3 A;  1M5Y A;  2B5U B;  4DRQ A;  3RM8 A;  4XAK A;  2YBU A;  5HT1 A;  3JYJ A;  2XP4 A;  3ARR A;  1ZB5 A;  3O5O A;  5DIV A;  3MCB A;  2DSW A;  3ARZ A;  2MDI A;  3O5P A;  2XP7 A;  3FAP A;  3WD2 A;  1FFQ A;  4MNK A;  3ARW A;  4AY1 A;  4LAY A;  4ODL A;  2DT0 A;  3OA5 A;  2KFW A;  4DRI A;  1JNS A;  4P8W A;  4NZC A;  3ARU A;  2A3C A;  4Z2J A;  5I98 A;  2B31 A;  2MF9 A;  3G6M A;  2F21 A;  3NI6 A;  1WNO A;  1ZCN A;  3FXY A;  3IKD A;  1EDQ A;  2XPA A;  2YSF A;  2RE3 A;  2MLY A;  4S3K A;  5GPG A;  2D9F A;  3RM9 A;  5GPR A;  4Z2L A;  1WR7 A;  2OWO A;  3B8S A;  1FKB A;  5HWC A;  2DG4 A;  4MNL A;  3FY1 A;  5E65 A;  4DZ2 A;  4ZPT R;  2M3O W;  4ML4 A;  4DRO A;  4JFJ A;  1KT0 A;  2MNT A;  4DRN A;  2F2D A;  1NWU A;  1EG3 A;  1NMV A;  4ODR A;  2AWG A;  2UZ5 A;  1HJV A;  2ETN A;  3BXW A;  4ODM A;  4WK9 A;  3ART A;  1FD9 A;  4WKH A;  1E6Z A;  3EIP A;  3ARV A;  2ZQU A;  5HTG A;  5J6E A;  4GGQ A;  4KQZ A;  4W9O A;  1FKJ A;  3LKX A;  4IT6 A;  2ZR4 A;  5B8I C;  4JFM A;  2LAJ A;  4G2P A;  3PRA A;  1K9Q A;  5HW8 A;  4U86 A;  2PPN A;  2VN1 A;  1LJY A;  2N87 A;  2ZR5 A;  1FFR A;  1Q1C A;  1UR8 A;  2DT2 A;  3ALF A;  3O5Q A;  2M08 A;  1F40 A;  1FKT A;  4J4O A;  3W4R A;  1KFW A;  1L1P A;  4A0U A;  1KT1 A;  4E5R A;  1ROU A;  2MPH A;  3LUO A;  1EQ3 A;  1B6C A;  4WIW A;  1ROT A;  3ODK A;  3PQH A;  2YSG A;  4W9P A;  3AQU A;  1EG4 A;  2XPB A;  4QZV B;  3KAD A;  1VF8 A;  1LQ0 A;  3WQW A;  1W9V A;  1E6N A;  4ODN A;  4DZ3 A;  1PBK A;  3M7N A;  1LL6 A;  2YBT A;  4JFI A;  3KAH A;  5HBF A;  5DO2 A;  3UF8 A;  1N1A A;  2MLX A;  1NWT A;  4U85 A;  5HUA A;  5E62 A;  1E15 A;  2WK2 A;  3KAF A;  3AS1 A;  4J4N A;  5HW7 A;  4TW6 A;  2F4E A;  4TNS A;  5DF0 A;  2PN0 A;  1F8A B;  2BA1 A;  1Q6U A;  3MCB B;  1ITX A;  3KCE A;  3LKX B;  1BKF A;  1E9L A;  2LKN A;  1TCO C;  1FKR A;  1FLC A;  3B9A A;  1WMV A;  2M8J A;  1XRV A;  3O5D A;  4GLX A;  3UI5 A;  2RUD A;  5DIU A;  1QZ2 A;  1UR9 A;  4IQ2 A;  4DH0 A;  4DRJ A;  1A7X A;  1FKI A;  1W9P A;  2YSH A;  4DWS A;  4MNJ A;  1C9H A;  2M2A A;  2RQS A;  1JNE A;  4DRK A;  3KAB A;  2G8Z A;  1FAP A;  4W5U A;  2DSV A;  1ZL1 A;  1W1P A;  3UQA A;  2E45 A;  4URI A;  1OGB A;  1W1V A;  2DT3 A;  2DMV A;  4TYO A;  1JMQ A;  1FKK A;  3EY6 A;  4R5E A;  5E64 A;  3MDY B;  1T11 A;  1GOI A;  2FAP A;  1HKK A;  4IQC A;  2XP3 A;  4W9Q A;  1TK7 A;  4QT3 A;  1LL7 A;  3H9R B;  4DRP A;  1E6R A;  1Q6I A;  3WL1 A;  1WB0 A;  4BF8 A;  2PV1 A;  3O5L A;  3KAG A;  4KR0 B;  3NTP A;  4P8U A;  1IX5 A;  3GPK A;  1PIN A;  2WAD A;  4ZPV R;  1GPF A;  2AOS A;  3RME A;  1P5Q A;  2EUL A;  3ARY A;  1FKG A;  2DG9 A;  3JXV A;  1K9R A;  4DWS C;  5HWB A;  2FDM A;  1HJX A;  2O9O A;  2PV2 A;  4TX0 A;  1FKD A;  2JZV A;  3WD3 A;  2DK1 A;  1FKH A;  3TDB A;  1RD6 A;  3FSB A;  2DPE A;  4L72 B;  3UQB A;  3AS3 A;  2QF8 A;  4MNM A;  1Y0O A;  1HKI A;  3NRK A;  4HBE A;  4WJX A;  3O5I A;  3KAI A;  4ODK A;  3RM4 A;  3WD4 A;  1FKL A;  1X6N A;  1JVW A;  3AS0 A;  2DK7 A;  2PI6 A;  4R0X A;  4MSP A;  1EHN A;  5AHT A;  3ARS A;  4G50 A;  2IF4 A;  4LGX A;  1ZBK A;  3B7X A;  2PPP A;  3FS8 A;  1Q6H A;  1I5H W;  1ZBW A;  4DRH A;  3ARP A;  2VCD A; 
#chains in the Genus database with same CATH homology
 2G41 A;  3WH0 A;  1CTN A;  4ZS6 A;  2LPV A;  4S3J A;  2YSB A;  2K8I A;  2PV3 A;  1HXV A;  5E66 A;  4HAR A;  3IK8 A;  3CHC A;  1J4I A;  2MLZ A;  4DRM A;  1LG1 A;  2DG3 A;  3PRD A;  3CNG A;  1ZBC A;  1QPF A;  5GQB A;  3WKZ A;  1TR8 A;  3CH9 A;  2ZQV A;  4TW8 A;  1OGG A;  2RSE A;  1O6I A;  1X6L A;  3I6C A;  4DT4 A;  3O5E A;  3VAW A;  2LGO A;  1WAW A;  2DT1 A;  1GUV A;  2ZQS A;  2KGJ A;  2WLY A;  4JFK A;  1SYT A;  2KXQ A;  1HKJ A;  1TFV A;  2PBC A;  4HBO A;  5HW6 A;  2XP9 A;  3KAC A;  2JV4 A;  4DIP A;  4MTV A;  2DJY A;  1FKF A;  4P8V A;  3WD1 A;  4IPX A;  3PA7 A;  3RGC A;  2ZAJ A;  2Y8N B;  3O5J A;  3M85 A;  1R9H A;  1O6W A;  3LE4 A;  1EYM A;  3CHF A;  4ODO A;  4Z2I A;  4NNR A;  1ZBV A;  3O5G A;  5DIT A;  1H0G A;  1SR0 A;  4PTM A;  3TCZ A;  2WLZ A;  4WKA A;  4Z2K A;  3PRB A;  3MQH A;  3IHZ A;  4JFL A;  3MQG A;  1QPL A;  3B9E A;  1U79 A;  3CGN A;  2ESC A;  2JMF A;  4C02 B;  4GIV A;  3FSC A;  1EIB A;  2JX8 A;  2YSI A;  4O2T A;  2YAJ B;  4DWS D;  2LJ4 A;  3L4H A;  1D6O A;  3KZ7 A;  1D2K A;  1HJW A;  4QT2 A;  3RFW A;  5DEZ A;  2ZR6 A;  2OFN A;  1JND A;  3UI4 A;  1OWQ A;  2ITK A;  1BL4 A;  1NSG A;  1FJD A;  2IUZ A;  2XP5 A;  4WKF A;  2ZQT A;  4LAV A;  5BXJ A;  3ARQ A;  1FKS A;  1JNT A;  3WQV A;  1H0I A;  3CHE A;  5U47 A;  5E5W A;  4Z2G A;  1W1T A;  1K9T A;  1D7H A;  3O5M A;  3AS2 A;  3ARO A;  1W9U A;  2XP6 A;  3WD0 A;  4MGV A;  5CQ2 A;  3WIJ A;  4DWS B;  2A3B A;  2XP8 A;  2PPO A;  2FKE A;  1D7J A;  2RUR A;  2KO7 A;  2L4J A;  1J6Y A;  2A3A A;  4IT4 A;  4ODQ A;  1ZK6 A;  4P8X A;  2RUC A;  1YW5 A;  3JYM A;  1NH6 A;  5D75 A;  3CZ8 A;  5JH8 A;  1D7I A;  4TW7 A;  2QRV A;  1HKM A;  2L2S A;  2DSZ A;  1E6P A;  1ZU8 A;  2Y78 A;  4L3N A;  4Z2H A;  1NWR A;  1LL4 A;  1J4R A;  4LAX A;  4Q22 A;  1W1Y A;  3B9D A;  4Q7N A;  2A3E A;  3OOB A;  4A0T A;  4JYS A;  2DSU A;  3TC5 A;  3WL0 A;  2JXW A;  3ARX A;  3G6L A;  2WM0 A;  1NMW A;  2EZ5 W;  2WAE A;  2Q5A A;  4LAW A;  3CHD A;  4ZPW R;  2O92 A;  4N19 A;  2M1I A;  3O5K A;  4U84 A;  5HKG A;  3O5F A;  1RP5 A;  4ITZ A;  4NSB A;  4REX A;  2KE0 A;  3QOK A;  4QIB A;  1YAT A;  3UQI A;  4FN2 A;  2M8I A;  4MAV A;  3ALG A;  1XHG A;  3CGM A;  4MPK A;  3O5R A;  3PR9 A;  2RUQ A;  2KR7 A;  1J4H A;  1LG2 A;  2DWV A;  3UI6 A;  1NWS A;  2OLH A;  4ODP A;  3IKG A;  1W26 A;  4FAP A;  2KI3 A;  1M5Y A;  4DRQ A;  3RM8 A;  4XAK A;  2YBU A;  5HT1 A;  3JYJ A;  2XP4 A;  3ARR A;  1ZB5 A;  3O5O A;  5DIV A;  3MCB A;  2DSW A;  3ARZ A;  2MDI A;  3O5P A;  2XP7 A;  3FAP A;  3WD2 A;  1FFQ A;  4MNK A;  3ARW A;  4AY1 A;  4LAY A;  4ODL A;  2DT0 A;  3OA5 A;  2KFW A;  4DRI A;  1JNS A;  4P8W A;  4NZC A;  3ARU A;  2A3C A;  4Z2J A;  5I98 A;  2B31 A;  2MF9 A;  3G6M A;  2F21 A;  3NI6 A;  1WNO A;  1ZCN A;  3FXY A;  3IKD A;  1EDQ A;  2XPA A;  2YSF A;  2RE3 A;  2MLY A;  4S3K A;  5GPG A;  2D9F A;  3RM9 A;  5GPR A;  4Z2L A;  1WR7 A;  2OWO A;  3B8S A;  1FKB A;  5HWC A;  2DG4 A;  4MNL A;  3FY1 A;  5E65 A;  4DZ2 A;  4ZPT R;  2M3O W;  4ML4 A;  4DRO A;  4JFJ A;  1KT0 A;  2MNT A;  4DRN A;  2F2D A;  1NWU A;  1EG3 A;  1NMV A;  4ODR A;  2AWG A;  2UZ5 A;  1HJV A;  3BXW A;  4ODM A;  4WK9 A;  3ART A;  1FD9 A;  4WKH A;  1E6Z A;  3ARV A;  2ZQU A;  5HTG A;  5J6E A;  4GGQ A;  4KQZ A;  4W9O A;  1FKJ A;  3LKX A;  4IT6 A;  2ZR4 A;  5B8I C;  4JFM A;  2LAJ A;  4G2P A;  3PRA A;  1K9Q A;  5HW8 A;  4U86 A;  2PPN A;  2VN1 A;  1LJY A;  2N87 A;  2ZR5 A;  1FFR A;  1Q1C A;  1UR8 A;  2DT2 A;  3ALF A;  3O5Q A;  2M08 A;  1F40 A;  1FKT A;  4J4O A;  3W4R A;  1KFW A;  1L1P A;  4A0U A;  1KT1 A;  4E5R A;  1ROU A;  2MPH A;  3LUO A;  1EQ3 A;  1B6C A;  4WIW A;  1ROT A;  3ODK A;  3PQH A;  2YSG A;  4W9P A;  3AQU A;  1EG4 A;  2XPB A;  4QZV B;  3KAD A;  1VF8 A;  1LQ0 A;  3WQW A;  1W9V A;  1E6N A;  4ODN A;  4DZ3 A;  1PBK A;  3M7N A;  1LL6 A;  2YBT A;  4JFI A;  3KAH A;  5HBF A;  5DO2 A;  3UF8 A;  1N1A A;  2MLX A;  1NWT A;  4U85 A;  5HUA A;  5E62 A;  1E15 A;  2WK2 A;  3KAF A;  3AS1 A;  4J4N A;  5HW7 A;  4TW6 A;  2F4E A;  4TNS A;  5DF0 A;  1F8A B;  2BA1 A;  1Q6U A;  3MCB B;  1ITX A;  3KCE A;  3LKX B;  1BKF A;  1E9L A;  2LKN A;  1TCO C;  1FKR A;  1FLC A;  3B9A A;  1WMV A;  2M8J A;  1XRV A;  3O5D A;  4GLX A;  3UI5 A;  2RUD A;  5DIU A;  1QZ2 A;  1UR9 A;  4IQ2 A;  4DH0 A;  4DRJ A;  1A7X A;  1FKI A;  1W9P A;  2YSH A;  4DWS A;  4MNJ A;  1C9H A;  2M2A A;  2RQS A;  1JNE A;  4DRK A;  3KAB A;  2G8Z A;  1FAP A;  4W5U A;  2DSV A;  1ZL1 A;  1W1P A;  3UQA A;  2E45 A;  4URI A;  1OGB A;  1W1V A;  2DT3 A;  2DMV A;  4TYO A;  1JMQ A;  1FKK A;  3EY6 A;  4R5E A;  5E64 A;  3MDY B;  1T11 A;  1GOI A;  2FAP A;  1HKK A;  4IQC A;  2XP3 A;  4W9Q A;  1TK7 A;  4QT3 A;  1LL7 A;  3H9R B;  4DRP A;  1E6R A;  1Q6I A;  3WL1 A;  1WB0 A;  4BF8 A;  2PV1 A;  3O5L A;  3KAG A;  4KR0 B;  3NTP A;  4P8U A;  1IX5 A;  3GPK A;  1PIN A;  2WAD A;  4ZPV R;  1GPF A;  2AOS A;  3RME A;  1P5Q A;  3ARY A;  1FKG A;  2DG9 A;  3JXV A;  1K9R A;  4DWS C;  5HWB A;  2FDM A;  1HJX A;  2O9O A;  2PV2 A;  4TX0 A;  1FKD A;  2JZV A;  3WD3 A;  2DK1 A;  1FKH A;  3TDB A;  1RD6 A;  3FSB A;  2DPE A;  4L72 B;  3UQB A;  3AS3 A;  2QF8 A;  4MNM A;  1Y0O A;  1HKI A;  3NRK A;  4HBE A;  4WJX A;  3O5I A;  3KAI A;  4ODK A;  3RM4 A;  3WD4 A;  1FKL A;  1X6N A;  1JVW A;  3AS0 A;  2DK7 A;  2PI6 A;  4R0X A;  4MSP A;  1EHN A;  5AHT A;  3ARS A;  4G50 A;  2IF4 A;  4LGX A;  1ZBK A;  3B7X A;  2PPP A;  3FS8 A;  1Q6H A;  1I5H W;  1ZBW A;  4DRH A;  3ARP A;  2VCD A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...