2ZQTA

Crystal structure of a mutant pin1 peptidyl-prolyl cis-trans isomerase
Total Genus 47
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
47
sequence length
158
structure length
153
Chain Sequence
KLPPGWEKRMSRSSGRVYYFNHITNASQWERPSGGKNGQGEPARVRCSHLLVKHSQSRRPSSWRQEKITRTKEEALELINGYIQKIKSGEEDFESLASQFSDCSSAKARGDLGAFSRGQAQKPFEDASFALRTGEMSGPVFTDSGIHIILRTE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Peptidyl-prolyl cis-trans isomerase NIMA-interacting 1
publication title Structural studies on PIN1 mutants
rcsb
source organism Homo sapiens
molecule tags Isomerase
total genus 47
structure length 153
sequence length 158
ec nomenclature ec 5.2.1.8: Peptidylprolyl isomerase.
pdb deposition date 2008-08-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00397 WW WW domain
A PF00639 Rotamase PPIC-type PPIASE domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.20.70.10 Mainly Beta Single Sheet Ubiquitin Ligase Nedd4; Chain: W; Ubiquitin Ligase Nedd4; Chain: W; 2zqtA01
3.10.50.40 Alpha Beta Roll Chitinase A; domain 3 Chitinase A; domain 3 2zqtA02
2DK1A 3KZ7A 4IQ2A 4G2PA 1FKKA 2FKEA 4GIVA 3UQAA 1Q6HA 1FJDA 2MDIA 2N87A 2DMVA 5DIVA 1ZCNA 3KABA 3NI6A 4E5RA 2PPPA 1FKHA 2MLZA 2ZQSA 1FKIA 4FAPA 3O5PA 2K8IA 3ODKA 4DRQA 5HW7A 4IPXA 4ODOA 4O2TA 1HXVA 5DIUA 5DITA 4N19A 2ZR4A 4DRMA 5HW8A 1PBKA 1TCOC 1FKLA 1D7JA 2RQSA 4ITZA 1FAPA 3TCZA 1FKFA 1PINA 1W26A 3UQBA 2LJ4A 1NSGA 4JFMA 2RUDA 1O6WA 2F4EA 5I98A 3NRKA 2DWVA 4TX0A 2XP3A 1N1AA 4ODLA 2RSEA 4JFJA 2F21A 4DRHA 4QT2A 1WR7A 4ODPA 1P5QA 1T11A 1R9HA 1NMVA 1I5HW 2E45A 1ROUA 4DZ2A 1EYMA 2XP4A 2YSHA 2ZQUA 2MLYA 1FKDA 2ZR5A 2JV4A 2Q5AA 1YW5A 1JVWA 2JX8A 1FKTA 2RE3A 2DG4A 1Q6UA 1J6YA 4LAYA 4DH0A 2YSFA 2DG3A 4TW8A 2KO7A 2XPBA 2XPAA 5CQ2A 2FAPA 4W9QA 3O5QA 2XP5A 2JZVA 2PV1A 1QPLA 3TC5A 3O5FA 2PPOA 2L4JA 4J4OA 3UQIA 2L2SA 4ODRA 3H9RB 2MF9A 4TYOA 4LAVA 1JNTA 2OFNA 4MSPA 2ZQVA 2XP7A 4J4NA 4ODKA 1B6CA 3JYMA 5HKGA 4REXA 4QIBA 1KT0A 1ZK6A 1YATA 1Y0OA 1BL4A 4W9PA 3IHZA 2YSIA 3M85A 4NNRA 2M08A 3IKDA 2D9FA 2VN1A 3JXVA 2M8JA 1J4RA 3KAIA 4DRIA 2PV3A 3UI5A 3O5GA 2KGJA 2KE0A 4JYSA 3O5EA 1NMWA 1EG4A 4IQCA 1J4HA 2LPVA 1FD9A 2PBCA 2IF4A 2VCDA 5B8IC 2ZR6A 3IKGA 4ODNA 2KI3A 5HUAA 3O5KA 2BA1A 4U85A 5HT1A 1Q1CA 3KACA 2RUCA 3B7XA 1EQ3A 3NTPA 1JNSA 2ZAJA 1U79A 1QPFA 3GPKA 4DROA 5GPGA 2DJYA 5J6EA 2KFWA 1EG3A 3KAGA 1F8AB 3TDBA 3EY6A 5HTGA 4DRNA 1ROTA 3O5RA 2LGOA 2DG9A 4DRPA 2M2AA 2XP6A 4LAXA 4FN2A 2YSGA 5HWCA 3IK8A 4U86A 1K9RA 3O5OA 1FKRA 4C02B 4G50A 3PA7A 3UI6A 3KADA 3I6CA 1FKGA 3FAPA 3O5DA 5D75A 2F2DA 1JMQA 3MDYB 4W9OA 1KT1A 3KAHA 3WH0A 4DT4A 3PRBA 4R0XA 2PV2A 4JFIA 2M3OW 2UZ5A 2RUQA 2MPHA 5BXJA 2JMFA 3KAFA 1QZ2A 2AWGA 1F40A 4BF8A 3RGCA 1FKJA 5HWBA 3LUOA 4DZ3A 2YSBA 1D7IA 2XP9A 3O5JA 3UF8A 1BKFA 2Y78A 4JFLA 1TK7A 1J4IA 1FKSA 3VAWA 1K9QA 1L1PA 2MNTA 3L4HA 4DRKA 4GGQA 4U84A 4ODMA 2EZ5W 3UI4A 4DIPA 4TW6A 1A7XA 1M5YA 4TNSA 3LE4A 1D7HA 3RFWA 1Q6IA 5HW6A 3O5LA 2DK7A 3CNGA 3O5IA 3O5MA 1WMVA 4LAWA 2RURA 2LAJA 3PRDA 3CGMA 2MLXA 1C9HA 3OOBA 2ITKA 3KCEA 2LKNA 4QT3A 4JFKA 4DRJA 3JYJA 3M7NA 4MGVA 1FKBA 2ZQTA 2JXWA 2KR7A 4TW7A 2M8IA 2KXQA 5AHTA 3CGNA 1D6OA 4ODQA 2XP8A 2PPNA 2M1IA
chains in the Genus database with same CATH superfamily
2DK1A 3KZ7A 1E44A 1HKKA 4IQ2A 4G2PA 4L3NA 1FKKA 2FKEA 3W4RA 4GIVA 1H0IA 3UQAA 3ARQA 4MNMA 3PR9A 3WD4A 1Q6HA 1FJDA 2MDIA 1GPFA 4DWSC 2N87A 2B31A 2DMVA 5DIVA 4HARA 1ZCNA 3KABA 3BMBA 1E6NA 3NI6A 4E5RA 2PPPA 1FKHA 2MLZA 4P8XA 2ZQSA 1FKIA 2B5UB 4FAPA 3PQHA 3O5PA 2K8IA 3RM9A 3ODKA 4DRQA 5HW7A 2DSWA 4IPXA 4ODOA 4ZPTR 4HBOA 4O2TA 1HXVA 2DPEA 1NWSA 3AQUA 1LL7A 5DIUA 4IT6A 5DITA 4N19A 2ZR4A 1OWQA 1ZL1A 4DRMA 4KR0B 5HW8A 4PTMA 1PBKA 1TCOC 1XRVA 1FKLA 1D7JA 3MQGA 3PRAA 3G6MA 4R5EA 1E6RA 2RQSA 1FAPA 3TCZA 1FKFA 1PINA 1W26A 2ETNA 2LJ4A 4ITZA 1SR0A 5GPRA 1W1YA 5U47A 1LJYA 1NSGA 4MNKA 4P8UA 1W9PA 4AY1A 4P8WA 1FLCA 4JFMA 2RUDA 4P8VA 3RMEA 1O6WA 4KQZA 2F4EA 4WKFA 3NRKA 3WD2A 5I98A 2DWVA 3ARYA 4TX0A 2WM0A 2XP3A 1N1AA 1NH6A 4ODLA 2DT0A 4UDMA 2G8ZA 5E5WA 2RSEA 1JNEA 4JFJA 2F21A 2A3BA 4DRHA 4QT2A 1WR7A 4ODPA 1P5QA 1T11A 1R9HA 1NMVA 4Z2JA 1I5HW 2E45A 1ZBKA 1ROUA 4DZ2A 3FS8A 4MNJA 1EYMA 2QRVA 2EULA 2XP4A 2YSHA 3ARXA 5DEZA 2ZQUA 4WKAA 1HKMA 2MLYA 3CH9A 1FKDA 2ZR5A 2JV4A 2Q5AA 1YW5A 2P4VA 1WB0A 3ARWA 5GQBA 1JVWA 2JX8A 1XHGA 1FKTA 2RE3A 4Z2LA 2DG4A 1Q6UA 1J6YA 1ZB5A 4LAYA 1RP5A 1KFWA 4DH0A 2YSFA 2DG3A 4TW8A 2KO7A 2XPBA 2A3EA 2WAEA 3AROA 4URIA 3OA5A 2XPAA 5CQ2A 2FAPA 4W9QA 3O5QA 4Q22A 2XP5A 2JZVA 5DF0A 2PV1A 1QPLA 1W9UA 3TC5A 3ALGA 3WQWA 3O5FA 2PPOA 4MNLA 2L4JA 4J4OA 3UQIA 3UQBA 2G41A 1ZU8A 1JNDA 3AS0A 1W9VA 2WLZA 2YAJB 2L2SA 3WD1A 3B9AA 4ODRA 3H9RB 1X6NA 3EIPA 2MF9A 4TYOA 4LAVA 1JNTA 2OFNA 2Y8NB 4MSPA 2ZQVA 2XP7A 4J4NA 3ARUA 4ODKA 1B6CA 3JYMA 5HKGA 4REXA 1HKIA 2OLHA 4QIBA 1VF8A 1KT0A 4IT4A 5E62A 1ZK6A 4S3JA 3RM4A 1YATA 1HJWA 1Y0OA 1BL4A 3AS3A 1OGBA 4W9PA 1NWUA 3LKXB 2YSIA 3M85A 2A3CA 3IHZA 4NNRA 2M08A 3IKDA 3WQVA 2D9FA 2VN1A 3JXVA 2M8JA 1LL6A 1J4RA 3KAIA 4DRIA 2PV3A 2PN0A 4DWSB 3UI5A 3O5GA 1NWRA 2KGJA 3ARZA 2KE0A 4JYSA 2PI6A 3O5EA 1NMWA 1EG4A 4DWSA 4IQCA 1FFRA 1GOIA 1UR8A 1LG2A 1J4HA 2LPVA 1FD9A 2PBCA 3ARTA 2IF4A 3WL1A 1GUVA 4WIWA 2VCDA 5B8IC 2ZR6A 3IKGA 4ODNA 2KI3A 5HUAA 3O5KA 1X6LA 2BA1A 4NZCA 5HBFA 4U85A 1ZBVA 4W5UA 5HT1A 1Q1CA 2IUZA 1GRJA 1O6IA 1TFVA 1HJVA 4ML4A 3KACA 1EIBA 2RUCA 3B7XA 1EQ3A 3NTPA 4WJXA 3B9EA 1JNSA 2ZAJA 1D2KA 1QPFA 1U79A 3GPKA 4DROA 3BXWA 3FSCA 5GPGA 1ITXA 2DJYA 5J6EA 2KFWA 4GLXA 2WK2A 3WD3A 1EG3A 3KAGA 1EDQA 2O9OA 1FFQA 1F8AB 4L72B 3TDBA 3EY6A 1H0GA 3FSBA 1LQ0A 3ALFA 5HTGA 4DRNA 1ROTA 2DT1A 3O5RA 2LGOA 2DG9A 5JH8A 1HKJA 4DRPA 3CHCA 2M2AA 2XP6A 4LAXA 4FN2A 4MAVA 2YSGA 1CTNA 5HWCA 3IK8A 4U86A 1K9RA 4XAKA 3O5OA 1FKRA 4C02B 4G50A 5DO2A 3PA7A 3UI6A 2YBTA 2ESCA 3KADA 1HJXA 2DSUA 3I6CA 1FKGA 3FAPA 1OGGA 3O5DA 5D75A 2F2DA 1JMQA 3MDYB 4W9OA 1KT1A 3KAHA 3WH0A 4DT4A 1ZBWA 3WD0A 3PRBA 4R0XA 4DWSD 2WADA 4A0TA 2PV2A 3CHDA 1W1PA 4JFIA 2M3OW 2UZ5A 2RUQA 1E9LA 5E65A 2MPHA 5BXJA 2JMFA 3KAFA 1QZ2A 2AWGA 3FXYA 1F40A 4BF8A 3RGCA 1FKJA 1W1TA 2A3AA 5HWBA 3CHEA 3LUOA 4DZ3A 4ZPWR 2YSBA 1E6ZA 1D7IA 2XP9A 2DT3A 3O5JA 3AS2A 4A0UA 3UF8A 2AOSA 4Z2KA 1BKFA 2Y78A 4JFLA 1TK7A 3FY1A 1J4IA 3MQHA 3LKXA 1FKSA 2O92A 3GTYX 1WNOA 3VAWA 4Z2HA 1K9QA 1RD6A 1L1PA 2MNTA 3L4HA 4DRKA 3ARSA 2OWOA 4GGQA 4U84A 4ODMA 3CZ8A 2EZ5W 2DT2A 4ZPVR 3UI4A 4DIPA 3G6LA 4TW6A 2FDMA 1A7XA 1M5YA 4TNSA 3LE4A 1LL4A 4NSBA 3WL0A 1D7HA 3RFWA 1Q6IA 5HW6A 3ARRA 1E15A 4WK9A 2DSVA 3O5LA 2DK7A 3CNGA 3O5IA 5E66A 1LG1A 4HBEA 4MPKA 3O5MA 1WMVA 4LAWA 2RURA 1EHNA 2LAJA 3WIJA 3PRDA 4LGXA 3CGMA 1JCHB 2MLXA 4WKHA 1C9HA 3OOBA 2WLYA 1WAWA 4Q7NA 1TR8A 2DSZA 3ARPA 4S3KA 2ITKA 1K9TA 3KCEA 1IX5A 3RM8A 2LKNA 4QT3A 4JFKA 4MTVA 1SYTA 1E6PA 3AS1A 3QOKA 4DRJA 2QF8A 3JYJA 3WKZA 5E64A 3MCBB 4QZVB 3M7NA 2YBUA 4MGVA 1FKBA 2ZQTA 2JXWA 2KR7A 4Z2GA 4TW7A 3MCBA 2M8IA 2KXQA 2F23A 3CHFA 5AHTA 4ZS6A 3CGNA 1NWTA 1UR9A 1W1VA 3B9DA 4Z2IA 3B8SA 1D6OA 4ODQA 3ARVA 2XP8A 1ZBCA 2PPNA 2M1IA 3GU0A
chains in the Genus database with same CATH topology
2DK1A 3KZ7A 1HKKA 4IQ2A 4G2PA 4L3NA 1FKKA 2FKEA 3W4RA 4GIVA 1H0IA 3UQAA 3ARQA 4MNMA 3PR9A 3WD4A 1Q6HA 1FJDA 2MDIA 1GPFA 4DWSC 2N87A 2B31A 2DMVA 5DIVA 4HARA 1ZCNA 3KABA 1E6NA 3NI6A 4E5RA 2PPPA 1FKHA 2MLZA 4P8XA 2ZQSA 1FKIA 4FAPA 3PQHA 3O5PA 2K8IA 3RM9A 3ODKA 4DRQA 5HW7A 2DSWA 4IPXA 4ODOA 4ZPTR 4HBOA 4O2TA 1HXVA 2DPEA 1NWSA 3AQUA 1LL7A 5DIUA 4IT6A 5DITA 4N19A 2ZR4A 1OWQA 1ZL1A 4DRMA 4KR0B 5HW8A 4PTMA 1PBKA 1TCOC 1XRVA 1FKLA 1D7JA 3MQGA 3PRAA 3G6MA 4R5EA 1E6RA 2RQSA 1FAPA 3TCZA 1FKFA 1PINA 1W26A 4ITZA 2LJ4A 3UQBA 1SR0A 5GPRA 1W1YA 5U47A 1LJYA 1NSGA 4MNKA 4P8UA 1W9PA 4AY1A 4P8WA 1FLCA 4JFMA 2RUDA 4P8VA 3RMEA 1O6WA 4KQZA 2F4EA 4WKFA 3NRKA 3WD2A 5I98A 2DWVA 3ARYA 4TX0A 2WM0A 2XP3A 1N1AA 1NH6A 4ODLA 2DT0A 2G8ZA 5E5WA 2RSEA 1JNEA 4JFJA 2F21A 2A3BA 4DRHA 4QT2A 1WR7A 4ODPA 1P5QA 1T11A 1R9HA 1NMVA 4Z2JA 1I5HW 2E45A 1ZBKA 1ROUA 4DZ2A 3FS8A 4MNJA 1EYMA 2QRVA 2XP4A 2YSHA 3ARXA 5DEZA 2ZQUA 4WKAA 1HKMA 2MLYA 3CH9A 1FKDA 2ZR5A 2JV4A 2Q5AA 1YW5A 1WB0A 3ARWA 5GQBA 1JVWA 2JX8A 1XHGA 1FKTA 2RE3A 4Z2LA 2DG4A 1Q6UA 1J6YA 1ZB5A 4LAYA 1RP5A 1KFWA 4DH0A 2YSFA 2DG3A 4TW8A 2KO7A 2XPBA 2A3EA 2WAEA 3AROA 4URIA 3OA5A 2XPAA 5CQ2A 2FAPA 4W9QA 3O5QA 4Q22A 2XP5A 2JZVA 5DF0A 2PV1A 1QPLA 1W9UA 3TC5A 3ALGA 3WQWA 3O5FA 2PPOA 4MNLA 2L4JA 4J4OA 3UQIA 2G41A 1ZU8A 1JNDA 3AS0A 1W9VA 2WLZA 2YAJB 2L2SA 3WD1A 3B9AA 4ODRA 3H9RB 1X6NA 2MF9A 4TYOA 4LAVA 1JNTA 2OFNA 2Y8NB 4MSPA 2ZQVA 2XP7A 4J4NA 3ARUA 4ODKA 1B6CA 3JYMA 5HKGA 4REXA 1HKIA 2OLHA 4QIBA 1VF8A 1KT0A 4IT4A 5E62A 1ZK6A 4S3JA 3RM4A 1YATA 1HJWA 1Y0OA 1BL4A 3AS3A 1OGBA 4W9PA 1NWUA 3LKXB 2YSIA 3M85A 2A3CA 3IHZA 4NNRA 2M08A 3IKDA 3WQVA 2D9FA 2VN1A 3JXVA 2M8JA 1LL6A 1J4RA 3KAIA 4DRIA 2PV3A 4DWSB 3UI5A 3O5GA 1NWRA 2KGJA 3ARZA 2KE0A 4JYSA 2PI6A 3O5EA 1NMWA 1EG4A 4DWSA 4IQCA 1FFRA 1GOIA 1UR8A 1LG2A 1J4HA 2LPVA 1FD9A 2PBCA 3ARTA 2IF4A 3WL1A 1GUVA 4WIWA 2VCDA 5B8IC 2ZR6A 3IKGA 4ODNA 2KI3A 5HUAA 3O5KA 1X6LA 2BA1A 4NZCA 5HBFA 4U85A 1ZBVA 4W5UA 5HT1A 1Q1CA 2IUZA 1O6IA 1TFVA 1HJVA 4ML4A 3KACA 1EIBA 2RUCA 3B7XA 1EQ3A 3NTPA 4WJXA 3B9EA 1JNSA 2ZAJA 1D2KA 1QPFA 1U79A 3GPKA 4DROA 3BXWA 3FSCA 5GPGA 1ITXA 2DJYA 5J6EA 2KFWA 4GLXA 2WK2A 3WD3A 1EG3A 3KAGA 1EDQA 2O9OA 1FFQA 1F8AB 4L72B 3TDBA 3EY6A 1H0GA 3FSBA 1LQ0A 3ALFA 5HTGA 4DRNA 1ROTA 2DT1A 3O5RA 2LGOA 2DG9A 5JH8A 1HKJA 4DRPA 3CHCA 2M2AA 2XP6A 4LAXA 4FN2A 4MAVA 2YSGA 1CTNA 5HWCA 3IK8A 4U86A 1K9RA 4XAKA 3O5OA 1FKRA 4C02B 4G50A 5DO2A 3PA7A 3UI6A 2YBTA 2ESCA 3KADA 1HJXA 2DSUA 3I6CA 1FKGA 3FAPA 1OGGA 3O5DA 5D75A 2F2DA 1JMQA 3MDYB 4W9OA 1KT1A 3KAHA 3WH0A 4DT4A 1ZBWA 3WD0A 3PRBA 4R0XA 4DWSD 2WADA 4A0TA 2PV2A 3CHDA 1W1PA 4JFIA 2M3OW 2UZ5A 2RUQA 1E9LA 5E65A 2MPHA 5BXJA 2JMFA 3KAFA 1QZ2A 2AWGA 3FXYA 1F40A 4BF8A 3RGCA 1FKJA 1W1TA 2A3AA 5HWBA 3CHEA 3LUOA 4DZ3A 4ZPWR 2YSBA 1E6ZA 1D7IA 2XP9A 2DT3A 3O5JA 3AS2A 4A0UA 3UF8A 2AOSA 4Z2KA 1BKFA 2Y78A 4JFLA 1TK7A 3FY1A 1J4IA 3MQHA 3LKXA 1FKSA 2O92A 1WNOA 3VAWA 4Z2HA 1K9QA 1RD6A 1L1PA 2MNTA 3L4HA 4DRKA 3ARSA 2OWOA 4GGQA 4U84A 4ODMA 3CZ8A 2EZ5W 2DT2A 4ZPVR 3UI4A 4DIPA 3G6LA 4TW6A 2FDMA 1A7XA 1M5YA 4TNSA 3LE4A 1LL4A 4NSBA 3WL0A 1D7HA 3RFWA 1Q6IA 5HW6A 3ARRA 1E15A 4WK9A 2DSVA 3O5LA 2DK7A 3CNGA 3O5IA 5E66A 1LG1A 4HBEA 4MPKA 3O5MA 1WMVA 4LAWA 2RURA 1EHNA 2LAJA 3WIJA 3PRDA 4LGXA 3CGMA 2MLXA 4WKHA 1C9HA 3OOBA 2WLYA 1WAWA 4Q7NA 1TR8A 2DSZA 3ARPA 4S3KA 2ITKA 1K9TA 3KCEA 1IX5A 3RM8A 2LKNA 4QT3A 4JFKA 4MTVA 1SYTA 1E6PA 3AS1A 3QOKA 4DRJA 2QF8A 3JYJA 3WKZA 5E64A 3MCBB 4QZVB 3M7NA 2YBUA 4MGVA 1FKBA 2ZQTA 2JXWA 2KR7A 4Z2GA 4TW7A 3MCBA 2M8IA 2KXQA 3CHFA 5AHTA 4ZS6A 3CGNA 1NWTA 1UR9A 1W1VA 3B9DA 4Z2IA 3B8SA 1D6OA 4ODQA 3ARVA 2XP8A 1ZBCA 2PPNA 2M1IA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2DK1 A;  3KZ7 A;  4IQ2 A;  4G2P A;  1FKK A;  2FKE A;  4GIV A;  3UQA A;  1Q6H A;  1FJD A;  2MDI A;  2N87 A;  2DMV A;  5DIV A;  1ZCN A;  3KAB A;  3NI6 A;  4E5R A;  2PPP A;  1FKH A;  2MLZ A;  2ZQS A;  1FKI A;  4FAP A;  3O5P A;  2K8I A;  3ODK A;  4DRQ A;  5HW7 A;  4IPX A;  4ODO A;  4O2T A;  1HXV A;  5DIU A;  5DIT A;  4N19 A;  2ZR4 A;  4DRM A;  5HW8 A;  1PBK A;  1TCO C;  1FKL A;  1D7J A;  2RQS A;  4ITZ A;  1FAP A;  3TCZ A;  1FKF A;  1PIN A;  1W26 A;  3UQB A;  2LJ4 A;  1NSG A;  4JFM A;  2RUD A;  1O6W A;  2F4E A;  5I98 A;  3NRK A;  2DWV A;  4TX0 A;  2XP3 A;  1N1A A;  4ODL A;  2RSE A;  4JFJ A;  2F21 A;  4DRH A;  4QT2 A;  1WR7 A;  4ODP A;  1P5Q A;  1T11 A;  1R9H A;  1NMV A;  1I5H W;  2E45 A;  1ROU A;  4DZ2 A;  1EYM A;  2XP4 A;  2YSH A;  2ZQU A;  2MLY A;  1FKD A;  2ZR5 A;  2JV4 A;  2Q5A A;  1YW5 A;  1JVW A;  2JX8 A;  1FKT A;  2RE3 A;  2DG4 A;  1Q6U A;  1J6Y A;  4LAY A;  4DH0 A;  2YSF A;  2DG3 A;  4TW8 A;  2KO7 A;  2XPB A;  2XPA A;  5CQ2 A;  2FAP A;  4W9Q A;  3O5Q A;  2XP5 A;  2JZV A;  2PV1 A;  1QPL A;  3TC5 A;  3O5F A;  2PPO A;  2L4J A;  4J4O A;  3UQI A;  2L2S A;  4ODR A;  3H9R B;  2MF9 A;  4TYO A;  4LAV A;  1JNT A;  2OFN A;  4MSP A;  2ZQV A;  2XP7 A;  4J4N A;  4ODK A;  1B6C A;  3JYM A;  5HKG A;  4REX A;  4QIB A;  1KT0 A;  1ZK6 A;  1YAT A;  1Y0O A;  1BL4 A;  4W9P A;  3IHZ A;  2YSI A;  3M85 A;  4NNR A;  2M08 A;  3IKD A;  2D9F A;  2VN1 A;  3JXV A;  2M8J A;  1J4R A;  3KAI A;  4DRI A;  2PV3 A;  3UI5 A;  3O5G A;  2KGJ A;  2KE0 A;  4JYS A;  3O5E A;  1NMW A;  1EG4 A;  4IQC A;  1J4H A;  2LPV A;  1FD9 A;  2PBC A;  2IF4 A;  2VCD A;  5B8I C;  2ZR6 A;  3IKG A;  4ODN A;  2KI3 A;  5HUA A;  3O5K A;  2BA1 A;  4U85 A;  5HT1 A;  1Q1C A;  3KAC A;  2RUC A;  3B7X A;  1EQ3 A;  3NTP A;  1JNS A;  2ZAJ A;  1U79 A;  1QPF A;  3GPK A;  4DRO A;  5GPG A;  2DJY A;  5J6E A;  2KFW A;  1EG3 A;  3KAG A;  1F8A B;  3TDB A;  3EY6 A;  5HTG A;  4DRN A;  1ROT A;  3O5R A;  2LGO A;  2DG9 A;  4DRP A;  2M2A A;  2XP6 A;  4LAX A;  4FN2 A;  2YSG A;  5HWC A;  3IK8 A;  4U86 A;  1K9R A;  3O5O A;  1FKR A;  4C02 B;  4G50 A;  3PA7 A;  3UI6 A;  3KAD A;  3I6C A;  1FKG A;  3FAP A;  3O5D A;  5D75 A;  2F2D A;  1JMQ A;  3MDY B;  4W9O A;  1KT1 A;  3KAH A;  3WH0 A;  4DT4 A;  3PRB A;  4R0X A;  2PV2 A;  4JFI A;  2M3O W;  2UZ5 A;  2RUQ A;  2MPH A;  5BXJ A;  2JMF A;  3KAF A;  1QZ2 A;  2AWG A;  1F40 A;  4BF8 A;  3RGC A;  1FKJ A;  5HWB A;  3LUO A;  4DZ3 A;  2YSB A;  1D7I A;  2XP9 A;  3O5J A;  3UF8 A;  1BKF A;  2Y78 A;  4JFL A;  1TK7 A;  1J4I A;  1FKS A;  3VAW A;  1K9Q A;  1L1P A;  2MNT A;  3L4H A;  4DRK A;  4GGQ A;  4U84 A;  4ODM A;  2EZ5 W;  3UI4 A;  4DIP A;  4TW6 A;  1A7X A;  1M5Y A;  4TNS A;  3LE4 A;  1D7H A;  3RFW A;  1Q6I A;  5HW6 A;  3O5L A;  2DK7 A;  3CNG A;  3O5I A;  3O5M A;  1WMV A;  4LAW A;  2RUR A;  2LAJ A;  3PRD A;  3CGM A;  2MLX A;  1C9H A;  3OOB A;  2ITK A;  3KCE A;  2LKN A;  4QT3 A;  4JFK A;  4DRJ A;  3JYJ A;  3M7N A;  4MGV A;  1FKB A;  2ZQT A;  2JXW A;  2KR7 A;  4TW7 A;  2M8I A;  2KXQ A;  5AHT A;  3CGN A;  1D6O A;  4ODQ A;  2XP8 A;  2PPN A;  2M1I A; 
#chains in the Genus database with same CATH topology
 2DK1 A;  3KZ7 A;  1E44 A;  1HKK A;  4IQ2 A;  4G2P A;  4L3N A;  1FKK A;  2FKE A;  3W4R A;  4GIV A;  1H0I A;  3UQA A;  3ARQ A;  4MNM A;  3PR9 A;  3WD4 A;  1Q6H A;  1FJD A;  2MDI A;  1GPF A;  4DWS C;  2N87 A;  2B31 A;  2DMV A;  5DIV A;  4HAR A;  1ZCN A;  3KAB A;  3BMB A;  1E6N A;  3NI6 A;  4E5R A;  2PPP A;  1FKH A;  2MLZ A;  4P8X A;  2ZQS A;  1FKI A;  2B5U B;  4FAP A;  3PQH A;  3O5P A;  2K8I A;  3RM9 A;  3ODK A;  4DRQ A;  5HW7 A;  2DSW A;  4IPX A;  4ODO A;  4ZPT R;  4HBO A;  4O2T A;  1HXV A;  2DPE A;  1NWS A;  3AQU A;  1LL7 A;  5DIU A;  4IT6 A;  5DIT A;  4N19 A;  2ZR4 A;  1OWQ A;  1ZL1 A;  4DRM A;  4KR0 B;  5HW8 A;  4PTM A;  1PBK A;  1TCO C;  1XRV A;  1FKL A;  1D7J A;  3MQG A;  3PRA A;  3G6M A;  4R5E A;  1E6R A;  2RQS A;  1FAP A;  3TCZ A;  1FKF A;  1PIN A;  1W26 A;  2ETN A;  2LJ4 A;  4ITZ A;  1SR0 A;  5GPR A;  1W1Y A;  5U47 A;  1LJY A;  1NSG A;  4MNK A;  4P8U A;  1W9P A;  4AY1 A;  4P8W A;  1FLC A;  4JFM A;  2RUD A;  4P8V A;  3RME A;  1O6W A;  4KQZ A;  2F4E A;  4WKF A;  3NRK A;  3WD2 A;  5I98 A;  2DWV A;  3ARY A;  4TX0 A;  2WM0 A;  2XP3 A;  1N1A A;  1NH6 A;  4ODL A;  2DT0 A;  4UDM A;  2G8Z A;  5E5W A;  2RSE A;  1JNE A;  4JFJ A;  2F21 A;  2A3B A;  4DRH A;  4QT2 A;  1WR7 A;  4ODP A;  1P5Q A;  1T11 A;  1R9H A;  1NMV A;  4Z2J A;  1I5H W;  2E45 A;  1ZBK A;  1ROU A;  4DZ2 A;  3FS8 A;  4MNJ A;  1EYM A;  2QRV A;  2EUL A;  2XP4 A;  2YSH A;  3ARX A;  5DEZ A;  2ZQU A;  4WKA A;  1HKM A;  2MLY A;  3CH9 A;  1FKD A;  2ZR5 A;  2JV4 A;  2Q5A A;  1YW5 A;  2P4V A;  1WB0 A;  3ARW A;  5GQB A;  1JVW A;  2JX8 A;  1XHG A;  1FKT A;  2RE3 A;  4Z2L A;  2DG4 A;  1Q6U A;  1J6Y A;  1ZB5 A;  4LAY A;  1RP5 A;  1KFW A;  4DH0 A;  2YSF A;  2DG3 A;  4TW8 A;  2KO7 A;  2XPB A;  2A3E A;  2WAE A;  3ARO A;  4URI A;  3OA5 A;  2XPA A;  5CQ2 A;  2FAP A;  4W9Q A;  3O5Q A;  4Q22 A;  2XP5 A;  2JZV A;  5DF0 A;  2PV1 A;  1QPL A;  1W9U A;  3TC5 A;  3ALG A;  3WQW A;  3O5F A;  2PPO A;  4MNL A;  2L4J A;  4J4O A;  3UQI A;  3UQB A;  2G41 A;  1ZU8 A;  1JND A;  3AS0 A;  1W9V A;  2WLZ A;  2YAJ B;  2L2S A;  3WD1 A;  3B9A A;  4ODR A;  3H9R B;  1X6N A;  3EIP A;  2MF9 A;  4TYO A;  4LAV A;  1JNT A;  2OFN A;  2Y8N B;  4MSP A;  2ZQV A;  2XP7 A;  4J4N A;  3ARU A;  4ODK A;  1B6C A;  3JYM A;  5HKG A;  4REX A;  1HKI A;  2OLH A;  4QIB A;  1VF8 A;  1KT0 A;  4IT4 A;  5E62 A;  1ZK6 A;  4S3J A;  3RM4 A;  1YAT A;  1HJW A;  1Y0O A;  1BL4 A;  3AS3 A;  1OGB A;  4W9P A;  1NWU A;  3LKX B;  2YSI A;  3M85 A;  2A3C A;  3IHZ A;  4NNR A;  2M08 A;  3IKD A;  3WQV A;  2D9F A;  2VN1 A;  3JXV A;  2M8J A;  1LL6 A;  1J4R A;  3KAI A;  4DRI A;  2PV3 A;  2PN0 A;  4DWS B;  3UI5 A;  3O5G A;  1NWR A;  2KGJ A;  3ARZ A;  2KE0 A;  4JYS A;  2PI6 A;  3O5E A;  1NMW A;  1EG4 A;  4DWS A;  4IQC A;  1FFR A;  1GOI A;  1UR8 A;  1LG2 A;  1J4H A;  2LPV A;  1FD9 A;  2PBC A;  3ART A;  2IF4 A;  3WL1 A;  1GUV A;  4WIW A;  2VCD A;  5B8I C;  2ZR6 A;  3IKG A;  4ODN A;  2KI3 A;  5HUA A;  3O5K A;  1X6L A;  2BA1 A;  4NZC A;  5HBF A;  4U85 A;  1ZBV A;  4W5U A;  5HT1 A;  1Q1C A;  2IUZ A;  1GRJ A;  1O6I A;  1TFV A;  1HJV A;  4ML4 A;  3KAC A;  1EIB A;  2RUC A;  3B7X A;  1EQ3 A;  3NTP A;  4WJX A;  3B9E A;  1JNS A;  2ZAJ A;  1D2K A;  1QPF A;  1U79 A;  3GPK A;  4DRO A;  3BXW A;  3FSC A;  5GPG A;  1ITX A;  2DJY A;  5J6E A;  2KFW A;  4GLX A;  2WK2 A;  3WD3 A;  1EG3 A;  3KAG A;  1EDQ A;  2O9O A;  1FFQ A;  1F8A B;  4L72 B;  3TDB A;  3EY6 A;  1H0G A;  3FSB A;  1LQ0 A;  3ALF A;  5HTG A;  4DRN A;  1ROT A;  2DT1 A;  3O5R A;  2LGO A;  2DG9 A;  5JH8 A;  1HKJ A;  4DRP A;  3CHC A;  2M2A A;  2XP6 A;  4LAX A;  4FN2 A;  4MAV A;  2YSG A;  1CTN A;  5HWC A;  3IK8 A;  4U86 A;  1K9R A;  4XAK A;  3O5O A;  1FKR A;  4C02 B;  4G50 A;  5DO2 A;  3PA7 A;  3UI6 A;  2YBT A;  2ESC A;  3KAD A;  1HJX A;  2DSU A;  3I6C A;  1FKG A;  3FAP A;  1OGG A;  3O5D A;  5D75 A;  2F2D A;  1JMQ A;  3MDY B;  4W9O A;  1KT1 A;  3KAH A;  3WH0 A;  4DT4 A;  1ZBW A;  3WD0 A;  3PRB A;  4R0X A;  4DWS D;  2WAD A;  4A0T A;  2PV2 A;  3CHD A;  1W1P A;  4JFI A;  2M3O W;  2UZ5 A;  2RUQ A;  1E9L A;  5E65 A;  2MPH A;  5BXJ A;  2JMF A;  3KAF A;  1QZ2 A;  2AWG A;  3FXY A;  1F40 A;  4BF8 A;  3RGC A;  1FKJ A;  1W1T A;  2A3A A;  5HWB A;  3CHE A;  3LUO A;  4DZ3 A;  4ZPW R;  2YSB A;  1E6Z A;  1D7I A;  2XP9 A;  2DT3 A;  3O5J A;  3AS2 A;  4A0U A;  3UF8 A;  2AOS A;  4Z2K A;  1BKF A;  2Y78 A;  4JFL A;  1TK7 A;  3FY1 A;  1J4I A;  3MQH A;  3LKX A;  1FKS A;  2O92 A;  3GTY X;  1WNO A;  3VAW A;  4Z2H A;  1K9Q A;  1RD6 A;  1L1P A;  2MNT A;  3L4H A;  4DRK A;  3ARS A;  2OWO A;  4GGQ A;  4U84 A;  4ODM A;  3CZ8 A;  2EZ5 W;  2DT2 A;  4ZPV R;  3UI4 A;  4DIP A;  3G6L A;  4TW6 A;  2FDM A;  1A7X A;  1M5Y A;  4TNS A;  3LE4 A;  1LL4 A;  4NSB A;  3WL0 A;  1D7H A;  3RFW A;  1Q6I A;  5HW6 A;  3ARR A;  1E15 A;  4WK9 A;  2DSV A;  3O5L A;  2DK7 A;  3CNG A;  3O5I A;  5E66 A;  1LG1 A;  4HBE A;  4MPK A;  3O5M A;  1WMV A;  4LAW A;  2RUR A;  1EHN A;  2LAJ A;  3WIJ A;  3PRD A;  4LGX A;  3CGM A;  1JCH B;  2MLX A;  4WKH A;  1C9H A;  3OOB A;  2WLY A;  1WAW A;  4Q7N A;  1TR8 A;  2DSZ A;  3ARP A;  4S3K A;  2ITK A;  1K9T A;  3KCE A;  1IX5 A;  3RM8 A;  2LKN A;  4QT3 A;  4JFK A;  4MTV A;  1SYT A;  1E6P A;  3AS1 A;  3QOK A;  4DRJ A;  2QF8 A;  3JYJ A;  3WKZ A;  5E64 A;  3MCB B;  4QZV B;  3M7N A;  2YBU A;  4MGV A;  1FKB A;  2ZQT A;  2JXW A;  2KR7 A;  4Z2G A;  4TW7 A;  3MCB A;  2M8I A;  2KXQ A;  2F23 A;  3CHF A;  5AHT A;  4ZS6 A;  3CGN A;  1NWT A;  1UR9 A;  1W1V A;  3B9D A;  4Z2I A;  3B8S A;  1D6O A;  4ODQ A;  3ARV A;  2XP8 A;  1ZBC A;  2PPN A;  2M1I A;  3GU0 A; 
#chains in the Genus database with same CATH homology
 2DK1 A;  3KZ7 A;  1HKK A;  4IQ2 A;  4G2P A;  4L3N A;  1FKK A;  2FKE A;  3W4R A;  4GIV A;  1H0I A;  3UQA A;  3ARQ A;  4MNM A;  3PR9 A;  3WD4 A;  1Q6H A;  1FJD A;  2MDI A;  1GPF A;  4DWS C;  2N87 A;  2B31 A;  2DMV A;  5DIV A;  4HAR A;  1ZCN A;  3KAB A;  1E6N A;  3NI6 A;  4E5R A;  2PPP A;  1FKH A;  2MLZ A;  4P8X A;  2ZQS A;  1FKI A;  4FAP A;  3PQH A;  3O5P A;  2K8I A;  3RM9 A;  3ODK A;  4DRQ A;  5HW7 A;  2DSW A;  4IPX A;  4ODO A;  4ZPT R;  4HBO A;  4O2T A;  1HXV A;  2DPE A;  1NWS A;  3AQU A;  1LL7 A;  5DIU A;  4IT6 A;  5DIT A;  4N19 A;  2ZR4 A;  1OWQ A;  1ZL1 A;  4DRM A;  4KR0 B;  5HW8 A;  4PTM A;  1PBK A;  1TCO C;  1XRV A;  1FKL A;  1D7J A;  3MQG A;  3PRA A;  3G6M A;  4R5E A;  1E6R A;  2RQS A;  1FAP A;  3TCZ A;  1FKF A;  1PIN A;  1W26 A;  4ITZ A;  2LJ4 A;  3UQB A;  1SR0 A;  5GPR A;  1W1Y A;  5U47 A;  1LJY A;  1NSG A;  4MNK A;  4P8U A;  1W9P A;  4AY1 A;  4P8W A;  1FLC A;  4JFM A;  2RUD A;  4P8V A;  3RME A;  1O6W A;  4KQZ A;  2F4E A;  4WKF A;  3NRK A;  3WD2 A;  5I98 A;  2DWV A;  3ARY A;  4TX0 A;  2WM0 A;  2XP3 A;  1N1A A;  1NH6 A;  4ODL A;  2DT0 A;  2G8Z A;  5E5W A;  2RSE A;  1JNE A;  4JFJ A;  2F21 A;  2A3B A;  4DRH A;  4QT2 A;  1WR7 A;  4ODP A;  1P5Q A;  1T11 A;  1R9H A;  1NMV A;  4Z2J A;  1I5H W;  2E45 A;  1ZBK A;  1ROU A;  4DZ2 A;  3FS8 A;  4MNJ A;  1EYM A;  2QRV A;  2XP4 A;  2YSH A;  3ARX A;  5DEZ A;  2ZQU A;  4WKA A;  1HKM A;  2MLY A;  3CH9 A;  1FKD A;  2ZR5 A;  2JV4 A;  2Q5A A;  1YW5 A;  1WB0 A;  3ARW A;  5GQB A;  1JVW A;  2JX8 A;  1XHG A;  1FKT A;  2RE3 A;  4Z2L A;  2DG4 A;  1Q6U A;  1J6Y A;  1ZB5 A;  4LAY A;  1RP5 A;  1KFW A;  4DH0 A;  2YSF A;  2DG3 A;  4TW8 A;  2KO7 A;  2XPB A;  2A3E A;  2WAE A;  3ARO A;  4URI A;  3OA5 A;  2XPA A;  5CQ2 A;  2FAP A;  4W9Q A;  3O5Q A;  4Q22 A;  2XP5 A;  2JZV A;  5DF0 A;  2PV1 A;  1QPL A;  1W9U A;  3TC5 A;  3ALG A;  3WQW A;  3O5F A;  2PPO A;  4MNL A;  2L4J A;  4J4O A;  3UQI A;  2G41 A;  1ZU8 A;  1JND A;  3AS0 A;  1W9V A;  2WLZ A;  2YAJ B;  2L2S A;  3WD1 A;  3B9A A;  4ODR A;  3H9R B;  1X6N A;  2MF9 A;  4TYO A;  4LAV A;  1JNT A;  2OFN A;  2Y8N B;  4MSP A;  2ZQV A;  2XP7 A;  4J4N A;  3ARU A;  4ODK A;  1B6C A;  3JYM A;  5HKG A;  4REX A;  1HKI A;  2OLH A;  4QIB A;  1VF8 A;  1KT0 A;  4IT4 A;  5E62 A;  1ZK6 A;  4S3J A;  3RM4 A;  1YAT A;  1HJW A;  1Y0O A;  1BL4 A;  3AS3 A;  1OGB A;  4W9P A;  1NWU A;  3LKX B;  2YSI A;  3M85 A;  2A3C A;  3IHZ A;  4NNR A;  2M08 A;  3IKD A;  3WQV A;  2D9F A;  2VN1 A;  3JXV A;  2M8J A;  1LL6 A;  1J4R A;  3KAI A;  4DRI A;  2PV3 A;  4DWS B;  3UI5 A;  3O5G A;  1NWR A;  2KGJ A;  3ARZ A;  2KE0 A;  4JYS A;  2PI6 A;  3O5E A;  1NMW A;  1EG4 A;  4DWS A;  4IQC A;  1FFR A;  1GOI A;  1UR8 A;  1LG2 A;  1J4H A;  2LPV A;  1FD9 A;  2PBC A;  3ART A;  2IF4 A;  3WL1 A;  1GUV A;  4WIW A;  2VCD A;  5B8I C;  2ZR6 A;  3IKG A;  4ODN A;  2KI3 A;  5HUA A;  3O5K A;  1X6L A;  2BA1 A;  4NZC A;  5HBF A;  4U85 A;  1ZBV A;  4W5U A;  5HT1 A;  1Q1C A;  2IUZ A;  1O6I A;  1TFV A;  1HJV A;  4ML4 A;  3KAC A;  1EIB A;  2RUC A;  3B7X A;  1EQ3 A;  3NTP A;  4WJX A;  3B9E A;  1JNS A;  2ZAJ A;  1D2K A;  1QPF A;  1U79 A;  3GPK A;  4DRO A;  3BXW A;  3FSC A;  5GPG A;  1ITX A;  2DJY A;  5J6E A;  2KFW A;  4GLX A;  2WK2 A;  3WD3 A;  1EG3 A;  3KAG A;  1EDQ A;  2O9O A;  1FFQ A;  1F8A B;  4L72 B;  3TDB A;  3EY6 A;  1H0G A;  3FSB A;  1LQ0 A;  3ALF A;  5HTG A;  4DRN A;  1ROT A;  2DT1 A;  3O5R A;  2LGO A;  2DG9 A;  5JH8 A;  1HKJ A;  4DRP A;  3CHC A;  2M2A A;  2XP6 A;  4LAX A;  4FN2 A;  4MAV A;  2YSG A;  1CTN A;  5HWC A;  3IK8 A;  4U86 A;  1K9R A;  4XAK A;  3O5O A;  1FKR A;  4C02 B;  4G50 A;  5DO2 A;  3PA7 A;  3UI6 A;  2YBT A;  2ESC A;  3KAD A;  1HJX A;  2DSU A;  3I6C A;  1FKG A;  3FAP A;  1OGG A;  3O5D A;  5D75 A;  2F2D A;  1JMQ A;  3MDY B;  4W9O A;  1KT1 A;  3KAH A;  3WH0 A;  4DT4 A;  1ZBW A;  3WD0 A;  3PRB A;  4R0X A;  4DWS D;  2WAD A;  4A0T A;  2PV2 A;  3CHD A;  1W1P A;  4JFI A;  2M3O W;  2UZ5 A;  2RUQ A;  1E9L A;  5E65 A;  2MPH A;  5BXJ A;  2JMF A;  3KAF A;  1QZ2 A;  2AWG A;  3FXY A;  1F40 A;  4BF8 A;  3RGC A;  1FKJ A;  1W1T A;  2A3A A;  5HWB A;  3CHE A;  3LUO A;  4DZ3 A;  4ZPW R;  2YSB A;  1E6Z A;  1D7I A;  2XP9 A;  2DT3 A;  3O5J A;  3AS2 A;  4A0U A;  3UF8 A;  2AOS A;  4Z2K A;  1BKF A;  2Y78 A;  4JFL A;  1TK7 A;  3FY1 A;  1J4I A;  3MQH A;  3LKX A;  1FKS A;  2O92 A;  1WNO A;  3VAW A;  4Z2H A;  1K9Q A;  1RD6 A;  1L1P A;  2MNT A;  3L4H A;  4DRK A;  3ARS A;  2OWO A;  4GGQ A;  4U84 A;  4ODM A;  3CZ8 A;  2EZ5 W;  2DT2 A;  4ZPV R;  3UI4 A;  4DIP A;  3G6L A;  4TW6 A;  2FDM A;  1A7X A;  1M5Y A;  4TNS A;  3LE4 A;  1LL4 A;  4NSB A;  3WL0 A;  1D7H A;  3RFW A;  1Q6I A;  5HW6 A;  3ARR A;  1E15 A;  4WK9 A;  2DSV A;  3O5L A;  2DK7 A;  3CNG A;  3O5I A;  5E66 A;  1LG1 A;  4HBE A;  4MPK A;  3O5M A;  1WMV A;  4LAW A;  2RUR A;  1EHN A;  2LAJ A;  3WIJ A;  3PRD A;  4LGX A;  3CGM A;  2MLX A;  4WKH A;  1C9H A;  3OOB A;  2WLY A;  1WAW A;  4Q7N A;  1TR8 A;  2DSZ A;  3ARP A;  4S3K A;  2ITK A;  1K9T A;  3KCE A;  1IX5 A;  3RM8 A;  2LKN A;  4QT3 A;  4JFK A;  4MTV A;  1SYT A;  1E6P A;  3AS1 A;  3QOK A;  4DRJ A;  2QF8 A;  3JYJ A;  3WKZ A;  5E64 A;  3MCB B;  4QZV B;  3M7N A;  2YBU A;  4MGV A;  1FKB A;  2ZQT A;  2JXW A;  2KR7 A;  4Z2G A;  4TW7 A;  3MCB A;  2M8I A;  2KXQ A;  3CHF A;  5AHT A;  4ZS6 A;  3CGN A;  1NWT A;  1UR9 A;  1W1V A;  3B9D A;  4Z2I A;  3B8S A;  1D6O A;  4ODQ A;  3ARV A;  2XP8 A;  1ZBC A;  2PPN A;  2M1I A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...