2ZQTA

Crystal structure of a mutant pin1 peptidyl-prolyl cis-trans isomerase
Total Genus 47
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
47
sequence length
158
structure length
153
Chain Sequence
KLPPGWEKRMSRSSGRVYYFNHITNASQWERPSGGKNGQGEPARVRCSHLLVKHSQSRRPSSWRQEKITRTKEEALELINGYIQKIKSGEEDFESLASQFSDCSSAKARGDLGAFSRGQAQKPFEDASFALRTGEMSGPVFTDSGIHIILRTE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural studies on PIN1 mutants
rcsb
source organism Homo sapiens
molecule tags Isomerase
molecule keywords Peptidyl-prolyl cis-trans isomerase NIMA-interacting 1
total genus 47
structure length 153
sequence length 158
ec nomenclature ec 5.2.1.8: Peptidylprolyl isomerase.
pdb deposition date 2008-08-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00397 WW WW domain
A PF00639 Rotamase PPIC-type PPIASE domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.20.70.10 Mainly Beta Single Sheet Ubiquitin Ligase Nedd4; Chain: W; Ubiquitin Ligase Nedd4; Chain: W; 2zqtA01
3.10.50.40 Alpha Beta Roll Chitinase A; domain 3 Chitinase A; domain 3 2zqtA02
3UI4A 2XP3A 2L4JA 1FKHA 1FKFA 3TDBA 2Q5AA 3UQAA 5HW6A 5D75A 1FKBA 4JFJA 3UQBA 3KACA 3O5LA 5HTGA 5J6EA 3O5KA 4GIVA 4DRIA 2ZR4A 1KT0A 4G2PA 4ODOA 4U86A 4DT4A 1EYMA 4W9QA 4IQ2A 1W26A 4G50A 5DIVA 2YSBA 2AWGA 3NI6A 4JFMA 1WR7A 3JYJA 1P5QA 1EQ3A 3O5OA 2DMVA 1B6CA 1NMVA 4FAPA 5HKGA 1C9HA 3WH0A 3M85A 1D7IA 2KE0A 3PRBA 3KAHA 1EG4A 2FAPA 4C02B 3GPKA 5I98A 4ITZA 3IKDA 3LE4A 4IPXA 4R0XA 2JV4A 2ZQUA 2YSFA 2LJ4A 4DIPA 3NTPA 4O2TA 2L2SA 1FKIA 4W9OA 1M5YA 5BXJA 2D9FA 1QPFA 2KXQA 3CGMA 3CNGA 3RFWA 2MPHA 2PPOA 2VCDA 3I6CA 1ZK6A 1J6YA 2RUQA 2DJYA 2XPBA 1Q6UA 2JX8A 3MDYB 1JNTA 3H9RB 4DZ3A 3O5RA 3OOBA 2XP8A 4JFLA 4ODMA 1KT1A 4ODLA 4TW6A 3KABA 1JMQA 4TNSA 1L1PA 2M2AA 5HUAA 5CQ2A 2XP9A 2RSEA 2JMFA 2FKEA 2ITKA 3VAWA 4DH0A 2M8JA 2DG4A 2KO7A 2M8IA 1BL4A 1Y0OA 1J4IA 1D7HA 1K9QA 1FKKA 2KFWA 2M08A 2ZR5A 1F8AB 2LAJA 5B8IC 4QT3A 2ZQVA 1ROUA 1TK7A 2XP7A 4W9PA 4DRMA 2MNTA 2YSHA 4QIBA 2LKNA 2PV2A 4JFIA 4ODPA 2RUDA 4JFKA 4DRPA 3O5DA 1ROTA 2RUCA 1Q1CA 3PRDA 4TYOA 1FKDA 1NSGA 3KCEA 2XPAA 1TCOC 2EZ5W 3O5EA 3TCZA 1FKSA 1QPLA 2MF9A 1O6WA 3O5QA 5GPGA 1FKJA 1JNSA 3FAPA 3UI6A 1FKLA 3KZ7A 4U84A 4LAWA 4TW7A 2RURA 2Y78A 1R9HA 2RQSA 5DITA 3LUOA 1T11A 2LPVA 1QZ2A 3B7XA 1PINA 2JZVA 4REXA 2ZAJA 3UQIA 4DRNA 1K9RA 3NRKA 1YW5A 2KGJA 2PV1A 3JXVA 4JYSA 4TX0A 5HT1A 1FAPA 3M7NA 2DG3A 2PPPA 4ODNA 1PBKA 5HWBA 4FN2A 1NMWA 4DROA 3IKGA 1N1AA 2PBCA 2F21A 2UZ5A 4LAVA 4DZ2A 2MDIA 3PA7A 4J4OA 2MLZA 5HWCA 2PV3A 4MSPA 5DIUA 4E5RA 3UI5A 2DK7A 3KADA 1FKGA 3O5FA 2MLXA 1F40A 2DK1A 1FKTA 4QT2A 4DRKA 2XP4A 3IHZA 1ZCNA 1I5HW 2OFNA 3O5PA 1J4RA 4ODQA 3TC5A 2VN1A 2PPNA 1FKRA 2LGOA 1U79A 5AHTA 1J4HA 2XP5A 2M1IA 2F2DA 5HW8A 3O5JA 1YATA 1WMVA 2JXWA 1BKFA 1Q6HA 3O5GA 1D6OA 1Q6IA 2ZQSA 2KR7A 2M3OW 2K8IA 2MLYA 2YSIA 2DWVA 3ODKA 1A7XA 3O5MA 3O5IA 4N19A 1EG3A 5HW7A 2RE3A 2BA1A 2YSGA 4DRHA 2IF4A 3CGNA 4DRQA 1D7JA 3KAGA 4IQCA 2KI3A 3IK8A 3L4HA 1FJDA 4LAXA 1JVWA 2ZR6A 2N87A 4TW8A 3RGCA 1HXVA 2F4EA 3JYMA 4DRJA 4NNRA 4ODKA 3KAFA 4LAYA 4ODRA 4BF8A 2E45A 3KAIA 4GGQA 2DG9A 3EY6A 3UF8A 2XP6A 1FD9A 4U85A 4J4NA 2ZQTA 4MGVA
chains in the Genus database with same CATH superfamily
1FKFA 2DT0A 4ML4A 5D75A 2G8ZA 4JFJA 4Z2IA 1ZBWA 3AROA 3O5KA 4GIVA 1E9LA 2ZR4A 1KT0A 4IQ2A 4JFMA 3NI6A 1WR7A 3JYJA 1P5QA 1EQ3A 5U47A 1B6CA 1XRVA 1C9HA 1JCHB 3CHDA 3ARRA 3ARYA 1EG4A 4C02B 3GPKA 3LE4A 4IPXA 2ZQUA 1W9PA 2LJ4A 4DIPA 4S3KA 3G6MA 4A0TA 3ALGA 2Y8NB 4WJXA 1QPFA 2KXQA 2VCDA 1E6NA 2DJYA 1FFRA 3MDYB 4DZ3A 3WD2A 4TW6A 4ODLA 5HUAA 1H0IA 2DG4A 3WD0A 1J4IA 5B8IC 2DSVA 2ZR5A 2LAJA 3CHCA 4ZPTR 3FS8A 4JFKA 4MNLA 2DSZA 1ROTA 1Q1CA 3ARSA 3O5EA 4R5EA 5E64A 3TCZA 1FKSA 3O5QA 1FKJA 1UR9A 1LJYA 2RURA 4WK9A 2LPVA 2IUZA 1NWSA 3BMBA 2FDMA 3NRKA 2DSWA 2DG3A 4L72B 1NMWA 2F21A 2MDIA 3PA7A 2MLZA 2PV3A 4E5RA 3UI5A 3KADA 2MLXA 1FKTA 2XP4A 1GUVA 4ODQA 1J4RA 3TC5A 2QRVA 3B9AA 1ZBVA 2LGOA 1LL4A 2B31A 2M1IA 5E66A 2O92A 4PTMA 5E62A 3PQHA 2WM0A 1JNEA 2ZQSA 3O5MA 1NWUA 4N19A 4A0UA 3WQVA 1A7XA 2WLZA 3BXWA 2RE3A 2BA1A 4DRHA 3CGNA 2KI3A 1IX5A 1JVWA 2N87A 4KQZA 3JYMA 4NNRA 3KAFA 4ODRA 3KAIA 4GGQA 2DG9A 4HBOA 4J4NA 2ZQTA 3FY1A 1E6PA 3TDBA 4ZS6A 3UQBA 4LGXA 3B9DA 4MNJA 1NWTA 4DWSC 3G6LA 4ODOA 4G2PA 4DT4A 4W9QA 4G50A 2YSBA 1HJWA 3O5OA 4FAPA 1NMVA 2ETNA 2QF8A 3WIJA 3LKXB 3WH0A 3M85A 1D7IA 1XHGA 2KE0A 2FAPA 5JH8A 4ITZA 3MQHA 2JV4A 2A3AA 3NTPA 1KFWA 1FKIA 3RM4A 1M5YA 5BXJA 3CGMA 2O9OA 4QZVB 2XPBA 1K9TA 3OOBA 1KT1A 3ARQA 1JMQA 5CQ2A 2DT2A 3B9EA 2ESCA 2KO7A 2P4VA 1FKKA 1K9QA 1ROUA 3AS3A 1ITXA 4Z2LA 2YSHA 4QIBA 2RUDA 3ARTA 2A3CA 1HJVA 3O5DA 2PI6A 3PRDA 1LG1A 1FKDA 1NSGA 2EZ5W 1E15A 5GPGA 3GTYX 3FAPA 3RMEA 4REXA 2ZAJA 1FFQA 4DRNA 3JXVA 4TX0A 2PV1A 4Q22A 5HT1A 1FAPA 5HWBA 2YAJB 4ODNA 1PBKA 1N1AA 4P8XA 1NH6A 2DK7A 1FKGA 4Z2KA 1H0GA 4NZCA 4L3NA 4DRKA 3IHZA 1I5HW 4DWSD 3AS2A 1LL6A 4DWSA 2PPNA 1EIBA 5AHTA 2XP5A 3WL0A 1RP5A 3ARPA 1Q6HA 2B5UB 5E5WA 2F23A 2K8IA 1EHNA 2IF4A 4DRQA 3KAGA 4LAXA 2DSUA 2ZR6A 4TW8A 2F4EA 3W4RA 4ODKA 4LAYA 4BF8A 2E45A 3EY6A 1X6LA 1WNOA 1FD9A 4UDMA 1W1VA 2XP3A 2L4JA 3UQAA 1HKMA 2WAEA 2EULA 1SR0A 1FKBA 3KACA 4W5UA 1WAWA 4WKFA 5DO2A 4IT6A 3MCBB 1GRJA 3ALFA 4MTVA 3CHEA 5DIVA 3MCBA 1FLCA 2PN0A 4Q7NA 3WD4A 3CZ8A 4WKAA 3KAHA 5I98A 3B8SA 3IKDA 3WL1A 2YSFA 5DF0A 2A3EA 4O2TA 2L2SA 2D9FA 4P8WA 1ZBCA 2MPHA 2PPOA 5E65A 2RUQA 1Q6UA 3H9RB 2XP8A 1L1PA 2M2AA 2XP9A 1W1PA 2FKEA 2ITKA 4DH0A 2M8JA 4MNKA 2KFWA 1TR8A 2M8IA 1BL4A 1LQ0A 2M08A 1Y0OA 4QT3A 2ZQVA 1TK7A 3QOKA 2MNTA 2LKNA 2PV2A 5DEZA 4JFIA 4ZPWR 4ODPA 4DRPA 2WK2A 2XPAA 2G41A 4MAVA 1QPLA 4WIWA 3UI6A 1FKLA 3KZ7A 1ZU8A 4LAWA 2Y78A 1R9HA 2RQSA 1W1YA 1T11A 2WLYA 3MQGA 3UQIA 1YW5A 4JYSA 1J6YA 1HKKA 3M7NA 3WD3A 3IKGA 2PBCA 1X6NA 4LAVA 4MSPA 5DIUA 1OGGA 1F40A 3CHFA 4QT2A 1HJXA 2VN1A 1FKRA 3AS1A 5HW8A 3O5JA 1YATA 1WMVA 2JXWA 1BKFA 3OA5A 2MLYA 2YSIA 5HW7A 1HXVA 2YBUA 3WD1A 1FJDA 3L4HA 1CTNA 4P8UA 4AY1A 4WKHA 1UR8A 1D2KA 3UI4A 4IT4A 1FKHA 1GPFA 2Q5AA 5HW6A 3ARVA 3RM9A 1W9UA 3RM8A 3O5LA 5HTGA 3GU0A 5GPRA 1SYTA 4U86A 1EYMA 4NSBA 4MNMA 1W26A 1HKIA 2AWGA 2DMVA 5HKGA 3PRBA 3AQUA 4R0XA 3FSBA 1HKJA 4W9OA 3CNGA 3RFWA 3I6CA 1ZK6A 3ARUA 2JX8A 1JNTA 3O5RA 4JFLA 4ODMA 3KABA 4TNSA 4Z2GA 2RSEA 2JMFA 1OWQA 3VAWA 4DWSB 1NWRA 4DRIA 1D7HA 3WQWA 1O6IA 3PR9A 4KR0B 1F8AB 5HBFA 2XP7A 4W9PA 4DRMA 2WADA 3ARWA 3EIPA 1TFVA 4S3JA 4ZPVR 2RUCA 1E44A 4TYOA 3KCEA 1TCOC 2MF9A 1O6WA 1EDQA 1JNSA 2DT3A 3FXYA 4MPKA 4U84A 2YBTA 4TW7A 5DITA 3LUOA 4P8VA 1QZ2A 3AS0A 1PINA 1E6ZA 1GOIA 2JZVA 3B7XA 1K9RA 1W9VA 2KGJA 2PPPA 1JNDA 3FSCA 4FN2A 2OWOA 4DROA 4Z2HA 2UZ5A 4DZ2A 4HARA 5HWCA 4J4OA 1WB0A 3O5FA 1W1TA 2DK1A 1OGBA 1ZCNA 2OFNA 3O5PA 5GQBA 1U79A 3WKZA 1J4HA 1RD6A 2AOSA 4XAKA 2F2DA 2A3BA 2DT1A 3O5GA 1D6OA 1Q6IA 1E6RA 2KR7A 1LG2A 2M3OW 1ZL1A 2DWVA 3ODKA 4URIA 4Z2JA 3ARXA 3O5IA 1EG3A 2YSGA 3CH9A 1ZB5A 1D7JA 4IQCA 3IK8A 2OLHA 4GLXA 3RGCA 4DRJA 1VF8A 3PRAA 4HBEA 1LL7A 1ZBKA 3UF8A 2XP6A 4U85A 2DPEA 5J6EA 3ARZA 3LKXA 4MGVA
chains in the Genus database with same CATH topology
1FKFA 2DT0A 4ML4A 5D75A 2G8ZA 4JFJA 4Z2IA 1ZBWA 3AROA 3O5KA 4GIVA 1E9LA 2ZR4A 1KT0A 4IQ2A 4JFMA 3NI6A 1WR7A 3JYJA 1P5QA 1EQ3A 5U47A 1B6CA 1XRVA 1C9HA 3CHDA 3ARRA 3ARYA 1EG4A 4C02B 3GPKA 3LE4A 4IPXA 2ZQUA 1W9PA 2LJ4A 4DIPA 4S3KA 3G6MA 4A0TA 3ALGA 2Y8NB 4WJXA 1QPFA 2KXQA 2VCDA 1E6NA 2DJYA 1FFRA 3MDYB 4DZ3A 3WD2A 4TW6A 4ODLA 5HUAA 1H0IA 2DG4A 3WD0A 1J4IA 5B8IC 2DSVA 2ZR5A 2LAJA 3CHCA 4ZPTR 3FS8A 4JFKA 4MNLA 2DSZA 1ROTA 1Q1CA 3ARSA 3O5EA 4R5EA 5E64A 3TCZA 1FKSA 3O5QA 1FKJA 1UR9A 1LJYA 2RURA 4WK9A 2LPVA 2IUZA 1NWSA 2FDMA 3NRKA 2DSWA 2DG3A 4L72B 1NMWA 2F21A 2MDIA 3PA7A 2MLZA 2PV3A 4E5RA 3UI5A 3KADA 2MLXA 1FKTA 2XP4A 1GUVA 4ODQA 1J4RA 3TC5A 2QRVA 3B9AA 1ZBVA 2LGOA 1LL4A 2B31A 2M1IA 5E66A 2O92A 4PTMA 5E62A 3PQHA 2WM0A 1JNEA 2ZQSA 3O5MA 1NWUA 4N19A 4A0UA 3WQVA 1A7XA 2WLZA 3BXWA 2RE3A 2BA1A 4DRHA 3CGNA 2KI3A 1IX5A 1JVWA 2N87A 4KQZA 3JYMA 4NNRA 3KAFA 4ODRA 3KAIA 4GGQA 2DG9A 4HBOA 4J4NA 2ZQTA 3FY1A 1E6PA 3TDBA 4ZS6A 3UQBA 4LGXA 3B9DA 4MNJA 1NWTA 4DWSC 3G6LA 4ODOA 4G2PA 4DT4A 4W9QA 4G50A 2YSBA 1HJWA 3O5OA 4FAPA 1NMVA 2QF8A 3WIJA 3LKXB 3WH0A 3M85A 1D7IA 1XHGA 2KE0A 2FAPA 5JH8A 4ITZA 3MQHA 2JV4A 2A3AA 3NTPA 1KFWA 1FKIA 3RM4A 1M5YA 5BXJA 3CGMA 2O9OA 4QZVB 2XPBA 1K9TA 3OOBA 1KT1A 3ARQA 1JMQA 5CQ2A 2DT2A 3B9EA 2ESCA 2KO7A 1FKKA 1K9QA 1ROUA 3AS3A 1ITXA 4Z2LA 2YSHA 4QIBA 2RUDA 3ARTA 2A3CA 1HJVA 3O5DA 2PI6A 3PRDA 1LG1A 1FKDA 1NSGA 2EZ5W 1E15A 5GPGA 3FAPA 3RMEA 4REXA 2ZAJA 1FFQA 4DRNA 3JXVA 4TX0A 2PV1A 4Q22A 5HT1A 1FAPA 5HWBA 2YAJB 4ODNA 1PBKA 1N1AA 4P8XA 1NH6A 2DK7A 1FKGA 4Z2KA 1H0GA 4NZCA 4L3NA 4DRKA 3IHZA 1I5HW 4DWSD 3AS2A 1LL6A 4DWSA 2PPNA 1EIBA 5AHTA 2XP5A 3WL0A 1RP5A 3ARPA 1Q6HA 5E5WA 2K8IA 1EHNA 2IF4A 4DRQA 3KAGA 4LAXA 2DSUA 2ZR6A 4TW8A 2F4EA 3W4RA 4ODKA 4LAYA 4BF8A 2E45A 3EY6A 1X6LA 1WNOA 1FD9A 1W1VA 2XP3A 2L4JA 3UQAA 1HKMA 2WAEA 1SR0A 1FKBA 3KACA 4W5UA 1WAWA 4WKFA 5DO2A 4IT6A 3MCBB 3ALFA 4MTVA 3CHEA 5DIVA 3MCBA 1FLCA 4Q7NA 3WD4A 3CZ8A 4WKAA 3KAHA 5I98A 3B8SA 3IKDA 3WL1A 2YSFA 5DF0A 2A3EA 4O2TA 2L2SA 2D9FA 4P8WA 1ZBCA 2MPHA 2PPOA 5E65A 2RUQA 1Q6UA 3H9RB 2XP8A 1L1PA 2M2AA 2XP9A 1W1PA 2FKEA 2ITKA 4DH0A 2M8JA 4MNKA 2KFWA 1TR8A 2M8IA 1BL4A 1LQ0A 2M08A 1Y0OA 4QT3A 2ZQVA 1TK7A 3QOKA 2MNTA 2LKNA 2PV2A 5DEZA 4JFIA 4ZPWR 4ODPA 4DRPA 2WK2A 2XPAA 2G41A 4MAVA 1QPLA 4WIWA 3UI6A 1FKLA 3KZ7A 1ZU8A 4LAWA 2Y78A 1R9HA 2RQSA 1W1YA 1T11A 2WLYA 3MQGA 3UQIA 1YW5A 4JYSA 1J6YA 1HKKA 3M7NA 3WD3A 3IKGA 2PBCA 1X6NA 4LAVA 4MSPA 5DIUA 1OGGA 1F40A 3CHFA 4QT2A 1HJXA 2VN1A 1FKRA 3AS1A 5HW8A 3O5JA 1YATA 1WMVA 2JXWA 1BKFA 3OA5A 2MLYA 2YSIA 5HW7A 1HXVA 2YBUA 3WD1A 1FJDA 3L4HA 1CTNA 4P8UA 4AY1A 4WKHA 1UR8A 1D2KA 3UI4A 4IT4A 1FKHA 1GPFA 2Q5AA 5HW6A 3ARVA 3RM9A 1W9UA 3RM8A 3O5LA 5HTGA 5GPRA 1SYTA 4U86A 1EYMA 4NSBA 4MNMA 1W26A 1HKIA 2AWGA 2DMVA 5HKGA 3PRBA 3AQUA 4R0XA 3FSBA 1HKJA 4W9OA 3CNGA 3RFWA 3I6CA 1ZK6A 3ARUA 2JX8A 1JNTA 3O5RA 4JFLA 4ODMA 3KABA 4TNSA 4Z2GA 2RSEA 2JMFA 1OWQA 3VAWA 4DWSB 1NWRA 4DRIA 1D7HA 3WQWA 1O6IA 3PR9A 4KR0B 1F8AB 5HBFA 2XP7A 4W9PA 4DRMA 2WADA 3ARWA 1TFVA 4S3JA 4ZPVR 2RUCA 4TYOA 3KCEA 1TCOC 2MF9A 1O6WA 1EDQA 1JNSA 2DT3A 3FXYA 4MPKA 4U84A 2YBTA 4TW7A 5DITA 3LUOA 4P8VA 1QZ2A 3AS0A 1PINA 1E6ZA 1GOIA 2JZVA 3B7XA 1K9RA 1W9VA 2KGJA 2PPPA 1JNDA 3FSCA 4FN2A 2OWOA 4DROA 4Z2HA 2UZ5A 4DZ2A 4HARA 5HWCA 4J4OA 1WB0A 3O5FA 1W1TA 2DK1A 1OGBA 1ZCNA 2OFNA 3O5PA 5GQBA 1U79A 3WKZA 1J4HA 1RD6A 2AOSA 4XAKA 2F2DA 2A3BA 2DT1A 3O5GA 1D6OA 1Q6IA 1E6RA 2KR7A 1LG2A 2M3OW 1ZL1A 2DWVA 3ODKA 4URIA 4Z2JA 3ARXA 3O5IA 1EG3A 2YSGA 3CH9A 1ZB5A 1D7JA 4IQCA 3IK8A 2OLHA 4GLXA 3RGCA 4DRJA 1VF8A 3PRAA 4HBEA 1LL7A 1ZBKA 3UF8A 2XP6A 4U85A 2DPEA 5J6EA 3ARZA 3LKXA 4MGVA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3UI4 A;  2XP3 A;  2L4J A;  1FKH A;  1FKF A;  3TDB A;  2Q5A A;  3UQA A;  5HW6 A;  5D75 A;  1FKB A;  4JFJ A;  3UQB A;  3KAC A;  3O5L A;  5HTG A;  5J6E A;  3O5K A;  4GIV A;  4DRI A;  2ZR4 A;  1KT0 A;  4G2P A;  4ODO A;  4U86 A;  4DT4 A;  1EYM A;  4W9Q A;  4IQ2 A;  1W26 A;  4G50 A;  5DIV A;  2YSB A;  2AWG A;  3NI6 A;  4JFM A;  1WR7 A;  3JYJ A;  1P5Q A;  1EQ3 A;  3O5O A;  2DMV A;  1B6C A;  1NMV A;  4FAP A;  5HKG A;  1C9H A;  3WH0 A;  3M85 A;  1D7I A;  2KE0 A;  3PRB A;  3KAH A;  1EG4 A;  2FAP A;  4C02 B;  3GPK A;  5I98 A;  4ITZ A;  3IKD A;  3LE4 A;  4IPX A;  4R0X A;  2JV4 A;  2ZQU A;  2YSF A;  2LJ4 A;  4DIP A;  3NTP A;  4O2T A;  2L2S A;  1FKI A;  4W9O A;  1M5Y A;  5BXJ A;  2D9F A;  1QPF A;  2KXQ A;  3CGM A;  3CNG A;  3RFW A;  2MPH A;  2PPO A;  2VCD A;  3I6C A;  1ZK6 A;  1J6Y A;  2RUQ A;  2DJY A;  2XPB A;  1Q6U A;  2JX8 A;  3MDY B;  1JNT A;  3H9R B;  4DZ3 A;  3O5R A;  3OOB A;  2XP8 A;  4JFL A;  4ODM A;  1KT1 A;  4ODL A;  4TW6 A;  3KAB A;  1JMQ A;  4TNS A;  1L1P A;  2M2A A;  5HUA A;  5CQ2 A;  2XP9 A;  2RSE A;  2JMF A;  2FKE A;  2ITK A;  3VAW A;  4DH0 A;  2M8J A;  2DG4 A;  2KO7 A;  2M8I A;  1BL4 A;  1Y0O A;  1J4I A;  1D7H A;  1K9Q A;  1FKK A;  2KFW A;  2M08 A;  2ZR5 A;  1F8A B;  2LAJ A;  5B8I C;  4QT3 A;  2ZQV A;  1ROU A;  1TK7 A;  2XP7 A;  4W9P A;  4DRM A;  2MNT A;  2YSH A;  4QIB A;  2LKN A;  2PV2 A;  4JFI A;  4ODP A;  2RUD A;  4JFK A;  4DRP A;  3O5D A;  1ROT A;  2RUC A;  1Q1C A;  3PRD A;  4TYO A;  1FKD A;  1NSG A;  3KCE A;  2XPA A;  1TCO C;  2EZ5 W;  3O5E A;  3TCZ A;  1FKS A;  1QPL A;  2MF9 A;  1O6W A;  3O5Q A;  5GPG A;  1FKJ A;  1JNS A;  3FAP A;  3UI6 A;  1FKL A;  3KZ7 A;  4U84 A;  4LAW A;  4TW7 A;  2RUR A;  2Y78 A;  1R9H A;  2RQS A;  5DIT A;  3LUO A;  1T11 A;  2LPV A;  1QZ2 A;  3B7X A;  1PIN A;  2JZV A;  4REX A;  2ZAJ A;  3UQI A;  4DRN A;  1K9R A;  3NRK A;  1YW5 A;  2KGJ A;  2PV1 A;  3JXV A;  4JYS A;  4TX0 A;  5HT1 A;  1FAP A;  3M7N A;  2DG3 A;  2PPP A;  4ODN A;  1PBK A;  5HWB A;  4FN2 A;  1NMW A;  4DRO A;  3IKG A;  1N1A A;  2PBC A;  2F21 A;  2UZ5 A;  4LAV A;  4DZ2 A;  2MDI A;  3PA7 A;  4J4O A;  2MLZ A;  5HWC A;  2PV3 A;  4MSP A;  5DIU A;  4E5R A;  3UI5 A;  2DK7 A;  3KAD A;  1FKG A;  3O5F A;  2MLX A;  1F40 A;  2DK1 A;  1FKT A;  4QT2 A;  4DRK A;  2XP4 A;  3IHZ A;  1ZCN A;  1I5H W;  2OFN A;  3O5P A;  1J4R A;  4ODQ A;  3TC5 A;  2VN1 A;  2PPN A;  1FKR A;  2LGO A;  1U79 A;  5AHT A;  1J4H A;  2XP5 A;  2M1I A;  2F2D A;  5HW8 A;  3O5J A;  1YAT A;  1WMV A;  2JXW A;  1BKF A;  1Q6H A;  3O5G A;  1D6O A;  1Q6I A;  2ZQS A;  2KR7 A;  2M3O W;  2K8I A;  2MLY A;  2YSI A;  2DWV A;  3ODK A;  1A7X A;  3O5M A;  3O5I A;  4N19 A;  1EG3 A;  5HW7 A;  2RE3 A;  2BA1 A;  2YSG A;  4DRH A;  2IF4 A;  3CGN A;  4DRQ A;  1D7J A;  3KAG A;  4IQC A;  2KI3 A;  3IK8 A;  3L4H A;  1FJD A;  4LAX A;  1JVW A;  2ZR6 A;  2N87 A;  4TW8 A;  3RGC A;  1HXV A;  2F4E A;  3JYM A;  4DRJ A;  4NNR A;  4ODK A;  3KAF A;  4LAY A;  4ODR A;  4BF8 A;  2E45 A;  3KAI A;  4GGQ A;  2DG9 A;  3EY6 A;  3UF8 A;  2XP6 A;  1FD9 A;  4U85 A;  4J4N A;  2ZQT A;  4MGV A; 
#chains in the Genus database with same CATH topology
 1FKF A;  2DT0 A;  4ML4 A;  5D75 A;  2G8Z A;  4JFJ A;  4Z2I A;  1ZBW A;  3ARO A;  3O5K A;  4GIV A;  1E9L A;  2ZR4 A;  1KT0 A;  4IQ2 A;  4JFM A;  3NI6 A;  1WR7 A;  3JYJ A;  1P5Q A;  1EQ3 A;  5U47 A;  1B6C A;  1XRV A;  1C9H A;  1JCH B;  3CHD A;  3ARR A;  3ARY A;  1EG4 A;  4C02 B;  3GPK A;  3LE4 A;  4IPX A;  2ZQU A;  1W9P A;  2LJ4 A;  4DIP A;  4S3K A;  3G6M A;  4A0T A;  3ALG A;  2Y8N B;  4WJX A;  1QPF A;  2KXQ A;  2VCD A;  1E6N A;  2DJY A;  1FFR A;  3MDY B;  4DZ3 A;  3WD2 A;  4TW6 A;  4ODL A;  5HUA A;  1H0I A;  2DG4 A;  3WD0 A;  1J4I A;  5B8I C;  2DSV A;  2ZR5 A;  2LAJ A;  3CHC A;  4ZPT R;  3FS8 A;  4JFK A;  4MNL A;  2DSZ A;  1ROT A;  1Q1C A;  3ARS A;  3O5E A;  4R5E A;  5E64 A;  3TCZ A;  1FKS A;  3O5Q A;  1FKJ A;  1UR9 A;  1LJY A;  2RUR A;  4WK9 A;  2LPV A;  2IUZ A;  1NWS A;  3BMB A;  2FDM A;  3NRK A;  2DSW A;  2DG3 A;  4L72 B;  1NMW A;  2F21 A;  2MDI A;  3PA7 A;  2MLZ A;  2PV3 A;  4E5R A;  3UI5 A;  3KAD A;  2MLX A;  1FKT A;  2XP4 A;  1GUV A;  4ODQ A;  1J4R A;  3TC5 A;  2QRV A;  3B9A A;  1ZBV A;  2LGO A;  1LL4 A;  2B31 A;  2M1I A;  5E66 A;  2O92 A;  4PTM A;  5E62 A;  3PQH A;  2WM0 A;  1JNE A;  2ZQS A;  3O5M A;  1NWU A;  4N19 A;  4A0U A;  3WQV A;  1A7X A;  2WLZ A;  3BXW A;  2RE3 A;  2BA1 A;  4DRH A;  3CGN A;  2KI3 A;  1IX5 A;  1JVW A;  2N87 A;  4KQZ A;  3JYM A;  4NNR A;  3KAF A;  4ODR A;  3KAI A;  4GGQ A;  2DG9 A;  4HBO A;  4J4N A;  2ZQT A;  3FY1 A;  1E6P A;  3TDB A;  4ZS6 A;  3UQB A;  4LGX A;  3B9D A;  4MNJ A;  1NWT A;  4DWS C;  3G6L A;  4ODO A;  4G2P A;  4DT4 A;  4W9Q A;  4G50 A;  2YSB A;  1HJW A;  3O5O A;  4FAP A;  1NMV A;  2ETN A;  2QF8 A;  3WIJ A;  3LKX B;  3WH0 A;  3M85 A;  1D7I A;  1XHG A;  2KE0 A;  2FAP A;  5JH8 A;  4ITZ A;  3MQH A;  2JV4 A;  2A3A A;  3NTP A;  1KFW A;  1FKI A;  3RM4 A;  1M5Y A;  5BXJ A;  3CGM A;  2O9O A;  4QZV B;  2XPB A;  1K9T A;  3OOB A;  1KT1 A;  3ARQ A;  1JMQ A;  5CQ2 A;  2DT2 A;  3B9E A;  2ESC A;  2KO7 A;  2P4V A;  1FKK A;  1K9Q A;  1ROU A;  3AS3 A;  1ITX A;  4Z2L A;  2YSH A;  4QIB A;  2RUD A;  3ART A;  2A3C A;  1HJV A;  3O5D A;  2PI6 A;  3PRD A;  1LG1 A;  1FKD A;  1NSG A;  2EZ5 W;  1E15 A;  5GPG A;  3GTY X;  3FAP A;  3RME A;  4REX A;  2ZAJ A;  1FFQ A;  4DRN A;  3JXV A;  4TX0 A;  2PV1 A;  4Q22 A;  5HT1 A;  1FAP A;  5HWB A;  2YAJ B;  4ODN A;  1PBK A;  1N1A A;  4P8X A;  1NH6 A;  2DK7 A;  1FKG A;  4Z2K A;  1H0G A;  4NZC A;  4L3N A;  4DRK A;  3IHZ A;  1I5H W;  4DWS D;  3AS2 A;  1LL6 A;  4DWS A;  2PPN A;  1EIB A;  5AHT A;  2XP5 A;  3WL0 A;  1RP5 A;  3ARP A;  1Q6H A;  2B5U B;  5E5W A;  2F23 A;  2K8I A;  1EHN A;  2IF4 A;  4DRQ A;  3KAG A;  4LAX A;  2DSU A;  2ZR6 A;  4TW8 A;  2F4E A;  3W4R A;  4ODK A;  4LAY A;  4BF8 A;  2E45 A;  3EY6 A;  1X6L A;  1WNO A;  1FD9 A;  4UDM A;  1W1V A;  2XP3 A;  2L4J A;  3UQA A;  1HKM A;  2WAE A;  2EUL A;  1SR0 A;  1FKB A;  3KAC A;  4W5U A;  1WAW A;  4WKF A;  5DO2 A;  4IT6 A;  3MCB B;  1GRJ A;  3ALF A;  4MTV A;  3CHE A;  5DIV A;  3MCB A;  1FLC A;  2PN0 A;  4Q7N A;  3WD4 A;  3CZ8 A;  4WKA A;  3KAH A;  5I98 A;  3B8S A;  3IKD A;  3WL1 A;  2YSF A;  5DF0 A;  2A3E A;  4O2T A;  2L2S A;  2D9F A;  4P8W A;  1ZBC A;  2MPH A;  2PPO A;  5E65 A;  2RUQ A;  1Q6U A;  3H9R B;  2XP8 A;  1L1P A;  2M2A A;  2XP9 A;  1W1P A;  2FKE A;  2ITK A;  4DH0 A;  2M8J A;  4MNK A;  2KFW A;  1TR8 A;  2M8I A;  1BL4 A;  1LQ0 A;  2M08 A;  1Y0O A;  4QT3 A;  2ZQV A;  1TK7 A;  3QOK A;  2MNT A;  2LKN A;  2PV2 A;  5DEZ A;  4JFI A;  4ZPW R;  4ODP A;  4DRP A;  2WK2 A;  2XPA A;  2G41 A;  4MAV A;  1QPL A;  4WIW A;  3UI6 A;  1FKL A;  3KZ7 A;  1ZU8 A;  4LAW A;  2Y78 A;  1R9H A;  2RQS A;  1W1Y A;  1T11 A;  2WLY A;  3MQG A;  3UQI A;  1YW5 A;  4JYS A;  1J6Y A;  1HKK A;  3M7N A;  3WD3 A;  3IKG A;  2PBC A;  1X6N A;  4LAV A;  4MSP A;  5DIU A;  1OGG A;  1F40 A;  3CHF A;  4QT2 A;  1HJX A;  2VN1 A;  1FKR A;  3AS1 A;  5HW8 A;  3O5J A;  1YAT A;  1WMV A;  2JXW A;  1BKF A;  3OA5 A;  2MLY A;  2YSI A;  5HW7 A;  1HXV A;  2YBU A;  3WD1 A;  1FJD A;  3L4H A;  1CTN A;  4P8U A;  4AY1 A;  4WKH A;  1UR8 A;  1D2K A;  3UI4 A;  4IT4 A;  1FKH A;  1GPF A;  2Q5A A;  5HW6 A;  3ARV A;  3RM9 A;  1W9U A;  3RM8 A;  3O5L A;  5HTG A;  3GU0 A;  5GPR A;  1SYT A;  4U86 A;  1EYM A;  4NSB A;  4MNM A;  1W26 A;  1HKI A;  2AWG A;  2DMV A;  5HKG A;  3PRB A;  3AQU A;  4R0X A;  3FSB A;  1HKJ A;  4W9O A;  3CNG A;  3RFW A;  3I6C A;  1ZK6 A;  3ARU A;  2JX8 A;  1JNT A;  3O5R A;  4JFL A;  4ODM A;  3KAB A;  4TNS A;  4Z2G A;  2RSE A;  2JMF A;  1OWQ A;  3VAW A;  4DWS B;  1NWR A;  4DRI A;  1D7H A;  3WQW A;  1O6I A;  3PR9 A;  4KR0 B;  1F8A B;  5HBF A;  2XP7 A;  4W9P A;  4DRM A;  2WAD A;  3ARW A;  3EIP A;  1TFV A;  4S3J A;  4ZPV R;  2RUC A;  1E44 A;  4TYO A;  3KCE A;  1TCO C;  2MF9 A;  1O6W A;  1EDQ A;  1JNS A;  2DT3 A;  3FXY A;  4MPK A;  4U84 A;  2YBT A;  4TW7 A;  5DIT A;  3LUO A;  4P8V A;  1QZ2 A;  3AS0 A;  1PIN A;  1E6Z A;  1GOI A;  2JZV A;  3B7X A;  1K9R A;  1W9V A;  2KGJ A;  2PPP A;  1JND A;  3FSC A;  4FN2 A;  2OWO A;  4DRO A;  4Z2H A;  2UZ5 A;  4DZ2 A;  4HAR A;  5HWC A;  4J4O A;  1WB0 A;  3O5F A;  1W1T A;  2DK1 A;  1OGB A;  1ZCN A;  2OFN A;  3O5P A;  5GQB A;  1U79 A;  3WKZ A;  1J4H A;  1RD6 A;  2AOS A;  4XAK A;  2F2D A;  2A3B A;  2DT1 A;  3O5G A;  1D6O A;  1Q6I A;  1E6R A;  2KR7 A;  1LG2 A;  2M3O W;  1ZL1 A;  2DWV A;  3ODK A;  4URI A;  4Z2J A;  3ARX A;  3O5I A;  1EG3 A;  2YSG A;  3CH9 A;  1ZB5 A;  1D7J A;  4IQC A;  3IK8 A;  2OLH A;  4GLX A;  3RGC A;  4DRJ A;  1VF8 A;  3PRA A;  4HBE A;  1LL7 A;  1ZBK A;  3UF8 A;  2XP6 A;  4U85 A;  2DPE A;  5J6E A;  3ARZ A;  3LKX A;  4MGV A; 
#chains in the Genus database with same CATH homology
 1FKF A;  2DT0 A;  4ML4 A;  5D75 A;  2G8Z A;  4JFJ A;  4Z2I A;  1ZBW A;  3ARO A;  3O5K A;  4GIV A;  1E9L A;  2ZR4 A;  1KT0 A;  4IQ2 A;  4JFM A;  3NI6 A;  1WR7 A;  3JYJ A;  1P5Q A;  1EQ3 A;  5U47 A;  1B6C A;  1XRV A;  1C9H A;  3CHD A;  3ARR A;  3ARY A;  1EG4 A;  4C02 B;  3GPK A;  3LE4 A;  4IPX A;  2ZQU A;  1W9P A;  2LJ4 A;  4DIP A;  4S3K A;  3G6M A;  4A0T A;  3ALG A;  2Y8N B;  4WJX A;  1QPF A;  2KXQ A;  2VCD A;  1E6N A;  2DJY A;  1FFR A;  3MDY B;  4DZ3 A;  3WD2 A;  4TW6 A;  4ODL A;  5HUA A;  1H0I A;  2DG4 A;  3WD0 A;  1J4I A;  5B8I C;  2DSV A;  2ZR5 A;  2LAJ A;  3CHC A;  4ZPT R;  3FS8 A;  4JFK A;  4MNL A;  2DSZ A;  1ROT A;  1Q1C A;  3ARS A;  3O5E A;  4R5E A;  5E64 A;  3TCZ A;  1FKS A;  3O5Q A;  1FKJ A;  1UR9 A;  1LJY A;  2RUR A;  4WK9 A;  2LPV A;  2IUZ A;  1NWS A;  2FDM A;  3NRK A;  2DSW A;  2DG3 A;  4L72 B;  1NMW A;  2F21 A;  2MDI A;  3PA7 A;  2MLZ A;  2PV3 A;  4E5R A;  3UI5 A;  3KAD A;  2MLX A;  1FKT A;  2XP4 A;  1GUV A;  4ODQ A;  1J4R A;  3TC5 A;  2QRV A;  3B9A A;  1ZBV A;  2LGO A;  1LL4 A;  2B31 A;  2M1I A;  5E66 A;  2O92 A;  4PTM A;  5E62 A;  3PQH A;  2WM0 A;  1JNE A;  2ZQS A;  3O5M A;  1NWU A;  4N19 A;  4A0U A;  3WQV A;  1A7X A;  2WLZ A;  3BXW A;  2RE3 A;  2BA1 A;  4DRH A;  3CGN A;  2KI3 A;  1IX5 A;  1JVW A;  2N87 A;  4KQZ A;  3JYM A;  4NNR A;  3KAF A;  4ODR A;  3KAI A;  4GGQ A;  2DG9 A;  4HBO A;  4J4N A;  2ZQT A;  3FY1 A;  1E6P A;  3TDB A;  4ZS6 A;  3UQB A;  4LGX A;  3B9D A;  4MNJ A;  1NWT A;  4DWS C;  3G6L A;  4ODO A;  4G2P A;  4DT4 A;  4W9Q A;  4G50 A;  2YSB A;  1HJW A;  3O5O A;  4FAP A;  1NMV A;  2QF8 A;  3WIJ A;  3LKX B;  3WH0 A;  3M85 A;  1D7I A;  1XHG A;  2KE0 A;  2FAP A;  5JH8 A;  4ITZ A;  3MQH A;  2JV4 A;  2A3A A;  3NTP A;  1KFW A;  1FKI A;  3RM4 A;  1M5Y A;  5BXJ A;  3CGM A;  2O9O A;  4QZV B;  2XPB A;  1K9T A;  3OOB A;  1KT1 A;  3ARQ A;  1JMQ A;  5CQ2 A;  2DT2 A;  3B9E A;  2ESC A;  2KO7 A;  1FKK A;  1K9Q A;  1ROU A;  3AS3 A;  1ITX A;  4Z2L A;  2YSH A;  4QIB A;  2RUD A;  3ART A;  2A3C A;  1HJV A;  3O5D A;  2PI6 A;  3PRD A;  1LG1 A;  1FKD A;  1NSG A;  2EZ5 W;  1E15 A;  5GPG A;  3FAP A;  3RME A;  4REX A;  2ZAJ A;  1FFQ A;  4DRN A;  3JXV A;  4TX0 A;  2PV1 A;  4Q22 A;  5HT1 A;  1FAP A;  5HWB A;  2YAJ B;  4ODN A;  1PBK A;  1N1A A;  4P8X A;  1NH6 A;  2DK7 A;  1FKG A;  4Z2K A;  1H0G A;  4NZC A;  4L3N A;  4DRK A;  3IHZ A;  1I5H W;  4DWS D;  3AS2 A;  1LL6 A;  4DWS A;  2PPN A;  1EIB A;  5AHT A;  2XP5 A;  3WL0 A;  1RP5 A;  3ARP A;  1Q6H A;  5E5W A;  2K8I A;  1EHN A;  2IF4 A;  4DRQ A;  3KAG A;  4LAX A;  2DSU A;  2ZR6 A;  4TW8 A;  2F4E A;  3W4R A;  4ODK A;  4LAY A;  4BF8 A;  2E45 A;  3EY6 A;  1X6L A;  1WNO A;  1FD9 A;  1W1V A;  2XP3 A;  2L4J A;  3UQA A;  1HKM A;  2WAE A;  1SR0 A;  1FKB A;  3KAC A;  4W5U A;  1WAW A;  4WKF A;  5DO2 A;  4IT6 A;  3MCB B;  3ALF A;  4MTV A;  3CHE A;  5DIV A;  3MCB A;  1FLC A;  4Q7N A;  3WD4 A;  3CZ8 A;  4WKA A;  3KAH A;  5I98 A;  3B8S A;  3IKD A;  3WL1 A;  2YSF A;  5DF0 A;  2A3E A;  4O2T A;  2L2S A;  2D9F A;  4P8W A;  1ZBC A;  2MPH A;  2PPO A;  5E65 A;  2RUQ A;  1Q6U A;  3H9R B;  2XP8 A;  1L1P A;  2M2A A;  2XP9 A;  1W1P A;  2FKE A;  2ITK A;  4DH0 A;  2M8J A;  4MNK A;  2KFW A;  1TR8 A;  2M8I A;  1BL4 A;  1LQ0 A;  2M08 A;  1Y0O A;  4QT3 A;  2ZQV A;  1TK7 A;  3QOK A;  2MNT A;  2LKN A;  2PV2 A;  5DEZ A;  4JFI A;  4ZPW R;  4ODP A;  4DRP A;  2WK2 A;  2XPA A;  2G41 A;  4MAV A;  1QPL A;  4WIW A;  3UI6 A;  1FKL A;  3KZ7 A;  1ZU8 A;  4LAW A;  2Y78 A;  1R9H A;  2RQS A;  1W1Y A;  1T11 A;  2WLY A;  3MQG A;  3UQI A;  1YW5 A;  4JYS A;  1J6Y A;  1HKK A;  3M7N A;  3WD3 A;  3IKG A;  2PBC A;  1X6N A;  4LAV A;  4MSP A;  5DIU A;  1OGG A;  1F40 A;  3CHF A;  4QT2 A;  1HJX A;  2VN1 A;  1FKR A;  3AS1 A;  5HW8 A;  3O5J A;  1YAT A;  1WMV A;  2JXW A;  1BKF A;  3OA5 A;  2MLY A;  2YSI A;  5HW7 A;  1HXV A;  2YBU A;  3WD1 A;  1FJD A;  3L4H A;  1CTN A;  4P8U A;  4AY1 A;  4WKH A;  1UR8 A;  1D2K A;  3UI4 A;  4IT4 A;  1FKH A;  1GPF A;  2Q5A A;  5HW6 A;  3ARV A;  3RM9 A;  1W9U A;  3RM8 A;  3O5L A;  5HTG A;  5GPR A;  1SYT A;  4U86 A;  1EYM A;  4NSB A;  4MNM A;  1W26 A;  1HKI A;  2AWG A;  2DMV A;  5HKG A;  3PRB A;  3AQU A;  4R0X A;  3FSB A;  1HKJ A;  4W9O A;  3CNG A;  3RFW A;  3I6C A;  1ZK6 A;  3ARU A;  2JX8 A;  1JNT A;  3O5R A;  4JFL A;  4ODM A;  3KAB A;  4TNS A;  4Z2G A;  2RSE A;  2JMF A;  1OWQ A;  3VAW A;  4DWS B;  1NWR A;  4DRI A;  1D7H A;  3WQW A;  1O6I A;  3PR9 A;  4KR0 B;  1F8A B;  5HBF A;  2XP7 A;  4W9P A;  4DRM A;  2WAD A;  3ARW A;  1TFV A;  4S3J A;  4ZPV R;  2RUC A;  4TYO A;  3KCE A;  1TCO C;  2MF9 A;  1O6W A;  1EDQ A;  1JNS A;  2DT3 A;  3FXY A;  4MPK A;  4U84 A;  2YBT A;  4TW7 A;  5DIT A;  3LUO A;  4P8V A;  1QZ2 A;  3AS0 A;  1PIN A;  1E6Z A;  1GOI A;  2JZV A;  3B7X A;  1K9R A;  1W9V A;  2KGJ A;  2PPP A;  1JND A;  3FSC A;  4FN2 A;  2OWO A;  4DRO A;  4Z2H A;  2UZ5 A;  4DZ2 A;  4HAR A;  5HWC A;  4J4O A;  1WB0 A;  3O5F A;  1W1T A;  2DK1 A;  1OGB A;  1ZCN A;  2OFN A;  3O5P A;  5GQB A;  1U79 A;  3WKZ A;  1J4H A;  1RD6 A;  2AOS A;  4XAK A;  2F2D A;  2A3B A;  2DT1 A;  3O5G A;  1D6O A;  1Q6I A;  1E6R A;  2KR7 A;  1LG2 A;  2M3O W;  1ZL1 A;  2DWV A;  3ODK A;  4URI A;  4Z2J A;  3ARX A;  3O5I A;  1EG3 A;  2YSG A;  3CH9 A;  1ZB5 A;  1D7J A;  4IQC A;  3IK8 A;  2OLH A;  4GLX A;  3RGC A;  4DRJ A;  1VF8 A;  3PRA A;  4HBE A;  1LL7 A;  1ZBK A;  3UF8 A;  2XP6 A;  4U85 A;  2DPE A;  5J6E A;  3ARZ A;  3LKX A;  4MGV A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...