2ZQTA

Crystal structure of a mutant pin1 peptidyl-prolyl cis-trans isomerase
Total Genus 47
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
47
sequence length
158
structure length
153
Chain Sequence
b'KLPPGWEKRMSRSSGRVYYFNHITNASQWERPSGGKNGQGEPARVRCSHLLVKHSQSRRPSSWRQEKITRTKEEALELINGYIQKIKSGEEDFESLASQFSDCSSAKARGDLGAFSRGQAQKPFEDASFALRTGEMSGPVFTDSGIHIILRTE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Peptidyl-prolyl cis-trans isomerase NIMA-interacting 1
publication title Structural studies on PIN1 mutants
rcsb
source organism Homo sapiens
molecule tags Isomerase
total genus 47
structure length 153
sequence length 158
ec nomenclature ec 5.2.1.8: Peptidylprolyl isomerase.
pdb deposition date 2008-08-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00397 WW WW domain
A PF00639 Rotamase PPIC-type PPIASE domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.20.70.10 Mainly Beta Single Sheet Ubiquitin Ligase Nedd4; Chain: W; Ubiquitin Ligase Nedd4; Chain: W; 2zqtA01
3.10.50.40 Alpha Beta Roll Chitinase A; domain 3 Chitinase A; domain 3 2zqtA02
1FJDA 1JVWA 3O5DA 2ZQTA 4DIPA 4DZ3A 5I98A 1EG4A 2F21A 3JYMA 2VCDA 1B6CA 2ZQSA 3M85A 1N1AA 4ODOA 2EZ5W 2JV4A 1FKRA 4U85A 2RQSA 4DRQA 4W9OA 3UQAA 2JX8A 1Q1CA 2ZAJA 2XP9A 1WR7A 3O5JA 1PBKA 1W26A 2XP4A 4JFJA 2M2AA 2RURA 2D9FA 3O5PA 2MLYA 1ROUA 5B8IC 4GIVA 3RFWA 2RSEA 3UI4A 4G50A 2BA1A 2KGJA 3TCZA 1K9RA 1NMWA 3KACA 4LAXA 1QZ2A 3PRDA 2M8JA 3O5KA 4U84A 3KAHA 4G2PA 1YATA 3IKGA 2RUCA 1FKSA 1Y0OA 1NSGA 2FAPA 3JYJA 2MPHA 1F8AB 2ZR4A 3FAPA 2MLZA 2KO7A 2MNTA 4NNRA 5D75A 2XP7A 3CNGA 1ZCNA 4O2TA 2ZR5A 1JNSA 1K9QA 1ROTA 1EG3A 4TYOA 1EQ3A 1ZK6A 4GGQA 4DRNA 1D7JA 2DJYA 2LKNA 2DG9A 2PV3A 3GPKA 4DT4A 1Q6IA 3JXVA 3KZ7A 5DITA 1I5HW 1FD9A 4DRIA 5HT1A 4MSPA 1L1PA 2MLXA 4LAYA 3UI5A 1J4HA 1PINA 2LPVA 2JMFA 2JZVA 4LAWA 1TCOC 4ITZA 1JNTA 3TC5A 5HW8A 5HTGA 2PV2A 4DRPA 2F4EA 3O5IA 3NTPA 1TK7A 3O5LA 4DRMA 4ODQA 1Q6UA 4QIBA 1BL4A 2RUQA 3IHZA 3TDBA 1J4IA 2K8IA 4QT2A 1M5YA 2YSGA 1D7HA 4DROA 1WMVA 4ODKA 2DG3A 3EY6A 1QPLA 2OFNA 3L4HA 4JFMA 5CQ2A 4TX0A 3B7XA 1J6YA 2M8IA 1FAPA 5HUAA 4J4OA 2F2DA 2MF9A 1C9HA 2M3OW 3ODKA 2Q5AA 5BXJA 4MGVA 2XPAA 3KABA 2IF4A 2XP8A 3VAWA 1D6OA 3KAGA 3KCEA 4R0XA 2KI3A 2PPOA 3M7NA 4JYSA 1EYMA 4LAVA 2KR7A 2PPNA 2UZ5A 2XP5A 1QPFA 5GPGA 4ODRA 2E45A 3OOBA 1FKKA 3RGCA 1FKGA 4W9PA 2FKEA 4ODMA 2YSBA 1U79A 3UI6A 3O5QA 2YSHA 2DG4A 1J4RA 5HKGA 4JFKA 4DH0A 1T11A 2LGOA 1HXVA 4BF8A 4ODLA 2XPBA 4FN2A 5HW7A 4IPXA 4JFLA 5DIVA 2LJ4A 1FKBA 2KE0A 4IQCA 2L2SA 3LUOA 3O5GA 5J6EA 2N87A 2ZR6A 2ITKA 1FKLA 2VN1A 2XP6A 5HW6A 1D7IA 2DK7A 4J4NA 4ODNA 3UF8A 3O5EA 3H9RB 2DMVA 2LAJA 4E5RA 1FKTA 3KAIA 3PRBA 2ZQUA 3KADA 4TW8A 2RE3A 1O6WA 4C02B 3CGNA 1FKIA 1R9HA 1JMQA 4TNSA 2YSFA 3O5FA 4DRHA 1FKJA 2KXQA 3UQBA 2DK1A 5AHTA 2YSIA 2ZQVA 3MDYB 4QT3A 1KT0A 1FKHA 2Y78A 2MDIA 4FAPA 2PBCA 4TW6A 2PPPA 4DZ2A 5DIUA 5HWCA 2DWVA 2AWGA 3CGMA 4ODPA 3WH0A 1KT1A 1YW5A 1FKDA 3O5RA 5HWBA 2M08A 3I6CA 4DRJA 4JFIA 4W9QA 3KAFA 3UQIA 3NRKA 2RUDA 2XP3A 1BKFA 3NI6A 4DRKA 4U86A 3PA7A 1F40A 1A7XA 4IQ2A 2L4JA 1FKFA 3LE4A 1P5QA 2M1IA 1Q6HA 2KFWA 2JXWA 3IKDA 2PV1A 3O5MA 4N19A 4REXA 4TW7A 1NMVA 3IK8A 3O5OA
chains in the Genus database with same CATH superfamily
1FJDA 4R5EA 3LKXB 1GRJA 1JVWA 3O5DA 2B31A 2ZQTA 4DIPA 4DZ3A 4NSBA 5I98A 1EG4A 3WKZA 2F21A 4XAKA 3JYMA 2VCDA 4ZPVR 1B6CA 2ZQSA 1XHGA 3M85A 1ZBKA 1N1AA 4ODOA 2EZ5W 2JV4A 1FKRA 2DT3A 4Z2GA 4U85A 2RQSA 4DRQA 4W9OA 1E6ZA 3UQAA 2JX8A 1Q1CA 2ZAJA 1HJVA 2XP9A 1WR7A 3ALGA 3ARSA 2DT2A 3O5JA 1PBKA 1W26A 1E6RA 2XP4A 1EIBA 4JFJA 2M2AA 3ARPA 2RURA 2D9FA 3BMBA 3O5PA 2MLYA 1ROUA 5B8IC 4GIVA 1LG2A 3RFWA 3MQGA 1ZBWA 4WKAA 1E6PA 2RSEA 3UI4A 4G50A 2BA1A 4HBOA 3O5OA 2KGJA 3TCZA 1K9RA 1NMWA 1LG1A 3CH9A 3KACA 4LAXA 2WK2A 1QZ2A 3PRDA 5DEZA 2M8JA 2F23A 5DO2A 3O5KA 4U84A 1D2KA 2DPEA 3KAHA 4G2PA 1YATA 3IKGA 4L3NA 2RUCA 1EHNA 2DT1A 1FKSA 1Y0OA 4DWSD 1NSGA 1E9LA 2FAPA 3JYJA 4AY1A 1WAWA 4NZCA 1HKKA 1NWSA 1LL6A 1JNDA 3GU0A 5GQBA 4WIWA 2MPHA 1FFRA 3B9DA 1F8AB 2ZR4A 1W1PA 3CHEA 3FAPA 1LQ0A 3ARYA 2MLZA 4L72B 4A0TA 2KO7A 2DSVA 3ARQA 2MNTA 4NNRA 5D75A 2XP7A 3CNGA 1HJXA 1ZCNA 4O2TA 3WL0A 3ARRA 2EULA 2ZR5A 1TFVA 3QOKA 1O6IA 4ZPTR 1JNSA 1K9QA 1ROTA 1EG3A 3ARVA 4IT6A 4PTMA 1RP5A 4TYOA 1EQ3A 1EDQA 1ZK6A 4GGQA 5JH8A 4DRNA 1D7JA 2DJYA 1W1YA 1ZU8A 3FY1A 2YBUA 1FFQA 4P8XA 2LKNA 2DG9A 2PV3A 3GPKA 4Q22A 4DT4A 1Q6IA 2PI6A 3FXYA 3JXVA 3KZ7A 3PQHA 5DITA 3CZ8A 1I5HW 1FD9A 4DRIA 5HT1A 4MSPA 1L1PA 2MLXA 4LAYA 3UI5A 4Z2KA 1J4HA 1H0GA 1PINA 2P4VA 4Q7NA 2LPVA 2JMFA 3MCBB 2JZVA 3ALFA 2FDMA 4LAWA 3FS8A 1TCOC 4ITZA 1OGBA 1JNTA 2ESCA 3TC5A 4Z2IA 5HW8A 5HTGA 1H0IA 2PV2A 4DRPA 2G41A 3W4RA 1ZBCA 3OA5A 1JCHB 3B9AA 1HKJA 2F4EA 1FLCA 3O5IA 4LGXA 3NTPA 1TK7A 3O5LA 4DRMA 4ODQA 1Q6UA 4QIBA 1BL4A 2B5UB 2RUQA 3WQWA 3IHZA 3TDBA 1J4IA 4MNJA 2K8IA 1GPFA 4QT2A 1M5YA 2YSGA 1W9VA 1D7HA 4DROA 1WMVA 4P8VA 2A3BA 4ODKA 2DG3A 3EY6A 3MQHA 1E15A 1QPLA 2OFNA 3L4HA 2A3AA 5CQ2A 4JFMA 4TX0A 4WKFA 3B7XA 1J6YA 2M8IA 3AQUA 1NWRA 1FAPA 5HUAA 4J4OA 1UR9A 2ETNA 2F2DA 1WNOA 2MF9A 4A0UA 2M3OW 3ODKA 1NWTA 2Q5AA 5BXJA 4MGVA 2XPAA 3B8SA 5E62A 3KABA 1HKIA 3RM8A 2A3CA 2IF4A 2XP8A 3VAWA 3ARZA 1D6OA 5E66A 3KAGA 1VF8A 4WJXA 3KCEA 4R0XA 2KI3A 2PPOA 5E64A 4S3JA 3M7NA 4JYSA 1EYMA 3GTYX 3AS3A 4S3KA 4LAVA 2KR7A 4WKHA 1W9UA 2PPNA 2UZ5A 3WQVA 3WD1A 2XP5A 3B9EA 3FSCA 3WD2A 1K9TA 1QPFA 5GPGA 4ODRA 1W1TA 4UDMA 3ARXA 2E45A 3OOBA 4DWSA 2YAJB 2WM0A 4MNKA 1FKKA 1RD6A 3RGCA 1X6LA 2DT0A 1FKGA 2WLYA 3RMEA 4KR0B 1TR8A 2QF8A 3ARWA 2QRVA 4W9PA 2FKEA 2DSZA 1XRVA 2DSUA 4IT4A 4ODMA 2YSBA 1U79A 1W9PA 3UI6A 4GLXA 3O5QA 2YSHA 3G6LA 2DG4A 1J4RA 5HKGA 4JFKA 2O92A 4DH0A 1T11A 1ZL1A 2LGOA 1HXVA 4BF8A 5HBFA 4ODLA 2XPBA 4FN2A 5HW7A 4IPXA 4JFLA 3PR9A 5DIVA 2LJ4A 1FKBA 2KE0A 3ARTA 4IQCA 4MNMA 4MPKA 2O9OA 2L2SA 3LUOA 3O5GA 3RM9A 1HJWA 4DWSC 3CHCA 5J6EA 2N87A 4WK9A 2ZR6A 2ITKA 1JNEA 1FKLA 2VN1A 2XP6A 5HW6A 1D7IA 2DK7A 5GPRA 4W5UA 4J4NA 4ODNA 2DSWA 5U47A 2PN0A 3UF8A 3O5EA 3CHDA 4HARA 3AROA 4MNLA 1GUVA 3H9RB 2DMVA 2LAJA 2WAEA 4E5RA 1FKTA 3KAIA 3PRBA 2ZQUA 3KADA 4TW8A 2RE3A 1GOIA 4Z2JA 1WB0A 1O6WA 3LKXA 1LL7A 3AS1A 4C02B 1E44A 4URIA 4QZVB 3WL1A 3CGNA 1FKIA 1R9HA 3FSBA 1JMQA 4P8UA 4ZS6A 2AOSA 1OGGA 2YSFA 3O5FA 4TNSA 1ZBVA 4DRHA 1FKJA 2KXQA 1LL4A 3MCBA 3UQBA 2DK1A 5AHTA 4ML4A 2YSIA 2ZQVA 3MDYB 4QT3A 1KT0A 1FKHA 1W1VA 2Y78A 4Z2HA 2MDIA 4FAPA 2PBCA 1UR8A 4DWSB 4TW6A 3WD3A 2PPPA 1KFWA 4DZ2A 5DIUA 5DF0A 5HWCA 2DWVA 2AWGA 3CGMA 3PRAA 4Z2LA 3RM4A 4ODPA 3WH0A 1E6NA 1NH6A 1KT1A 1YW5A 1FKDA 3O5RA 2Y8NB 4MAVA 1ITXA 5HWBA 2YBTA 2M08A 3I6CA 4P8WA 2OLHA 4DRJA 2WADA 4JFIA 3CHFA 3WD0A 4MTVA 1OWQA 4W9QA 3KAFA 4HBEA 5E5WA 3UQIA 1SYTA 3G6MA 1HKMA 3NRKA 2RUDA 2XP3A 1BKFA 3NI6A 3BXWA 3AS0A 1ZB5A 2G8ZA 4DRKA 4U86A 3PA7A 1F40A 2WLZA 1A7XA 4IQ2A 2L4JA 5E65A 1FKFA 3LE4A 1P5QA 1SR0A 2OWOA 2M1IA 1Q6HA 4ZPWR 3WD4A 1X6NA 4KQZA 2KFWA 2JXWA 3IKDA 2PV1A 2IUZA 3O5MA 3ARUA 1IX5A 4N19A 3AS2A 4REXA 4TW7A 1LJYA 3EIPA 1NWUA 1CTNA 1NMVA 2A3EA 3IK8A 3WIJA 1C9HA
chains in the Genus database with same CATH topology
1FJDA 4R5EA 3LKXB 1JVWA 3O5DA 2B31A 2ZQTA 4DIPA 4DZ3A 4NSBA 5I98A 1EG4A 3WKZA 2F21A 4XAKA 3JYMA 2VCDA 4ZPVR 1B6CA 2ZQSA 1XHGA 3M85A 1ZBKA 1N1AA 4ODOA 2EZ5W 2JV4A 1FKRA 2DT3A 4Z2GA 4U85A 2RQSA 4DRQA 4W9OA 1E6ZA 3UQAA 2JX8A 1Q1CA 2ZAJA 1HJVA 2XP9A 1WR7A 3ALGA 3ARSA 2DT2A 3O5JA 1PBKA 1W26A 1E6RA 2XP4A 1EIBA 4JFJA 2M2AA 3ARPA 2RURA 2D9FA 3O5PA 2MLYA 1ROUA 5B8IC 4GIVA 1LG2A 3RFWA 3MQGA 1ZBWA 4WKAA 1E6PA 2RSEA 3UI4A 4G50A 2BA1A 4HBOA 3O5OA 2KGJA 3TCZA 1K9RA 1NMWA 1LG1A 3CH9A 3KACA 4LAXA 2WK2A 1QZ2A 3PRDA 5DEZA 2M8JA 5DO2A 3O5KA 4U84A 1D2KA 2DPEA 3KAHA 4G2PA 1YATA 3IKGA 4L3NA 2RUCA 1EHNA 2DT1A 1FKSA 1Y0OA 4DWSD 1NSGA 1E9LA 2FAPA 3JYJA 4AY1A 1WAWA 4NZCA 1HKKA 1NWSA 1LL6A 1JNDA 5GQBA 4WIWA 2MPHA 1FFRA 3B9DA 1F8AB 2ZR4A 1W1PA 3CHEA 3FAPA 1LQ0A 3ARYA 2MLZA 4L72B 4A0TA 2KO7A 2DSVA 3ARQA 2MNTA 4NNRA 5D75A 2XP7A 3CNGA 1HJXA 1ZCNA 4O2TA 3WL0A 3ARRA 2ZR5A 1TFVA 3QOKA 1O6IA 4ZPTR 1JNSA 1K9QA 1ROTA 1EG3A 3ARVA 4IT6A 4PTMA 1RP5A 4TYOA 1EQ3A 1EDQA 1ZK6A 4GGQA 5JH8A 4DRNA 1D7JA 2DJYA 1W1YA 1ZU8A 3FY1A 2YBUA 1FFQA 4P8XA 2LKNA 2DG9A 2PV3A 3GPKA 4Q22A 4DT4A 1Q6IA 2PI6A 3FXYA 3JXVA 3KZ7A 3PQHA 5DITA 3CZ8A 1I5HW 1FD9A 4DRIA 5HT1A 4MSPA 1L1PA 2MLXA 4LAYA 3UI5A 4Z2KA 1J4HA 1H0GA 1PINA 4Q7NA 2LPVA 2JMFA 3MCBB 2JZVA 3ALFA 2FDMA 4LAWA 3FS8A 1TCOC 4ITZA 1OGBA 1JNTA 2ESCA 3TC5A 4Z2IA 5HW8A 5HTGA 1H0IA 2PV2A 4DRPA 2G41A 3W4RA 1ZBCA 3OA5A 3B9AA 1HKJA 2F4EA 1FLCA 3O5IA 4LGXA 3NTPA 1TK7A 3O5LA 4DRMA 4ODQA 1Q6UA 4QIBA 1BL4A 2RUQA 3WQWA 3IHZA 3TDBA 1J4IA 4MNJA 2K8IA 1GPFA 4QT2A 1M5YA 2YSGA 1W9VA 1D7HA 4DROA 1WMVA 4P8VA 2A3BA 4ODKA 2DG3A 3EY6A 3MQHA 1E15A 1QPLA 2OFNA 3L4HA 2A3AA 5CQ2A 4JFMA 4TX0A 4WKFA 3B7XA 1J6YA 2M8IA 3AQUA 1NWRA 1FAPA 5HUAA 4J4OA 1UR9A 2F2DA 1WNOA 2MF9A 4A0UA 2M3OW 3ODKA 1NWTA 2Q5AA 5BXJA 4MGVA 2XPAA 3B8SA 5E62A 3KABA 1HKIA 3RM8A 2A3CA 2IF4A 2XP8A 3VAWA 3ARZA 1D6OA 5E66A 3KAGA 1VF8A 4WJXA 3KCEA 4R0XA 2KI3A 2PPOA 5E64A 4S3JA 3M7NA 4JYSA 1EYMA 3AS3A 4S3KA 4LAVA 2KR7A 4WKHA 1W9UA 2PPNA 2UZ5A 3WQVA 3WD1A 2XP5A 3B9EA 3FSCA 3WD2A 1K9TA 1QPFA 5GPGA 4ODRA 1W1TA 3ARXA 2E45A 3OOBA 4DWSA 2YAJB 2WM0A 4MNKA 1FKKA 1RD6A 3RGCA 1X6LA 2DT0A 1FKGA 2WLYA 3RMEA 4KR0B 1TR8A 2QF8A 3ARWA 2QRVA 4W9PA 2FKEA 2DSZA 1XRVA 2DSUA 4IT4A 4ODMA 2YSBA 1U79A 1W9PA 3UI6A 4GLXA 3O5QA 2YSHA 3G6LA 2DG4A 1J4RA 5HKGA 4JFKA 2O92A 4DH0A 1T11A 1ZL1A 2LGOA 1HXVA 4BF8A 5HBFA 4ODLA 2XPBA 4FN2A 5HW7A 4IPXA 4JFLA 3PR9A 5DIVA 2LJ4A 1FKBA 2KE0A 3ARTA 4IQCA 4MNMA 4MPKA 2O9OA 2L2SA 3LUOA 3O5GA 3RM9A 1HJWA 4DWSC 3CHCA 5J6EA 2N87A 4WK9A 2ZR6A 2ITKA 1JNEA 1FKLA 2VN1A 2XP6A 5HW6A 1D7IA 2DK7A 5GPRA 4W5UA 4J4NA 4ODNA 2DSWA 5U47A 3UF8A 3O5EA 3CHDA 4HARA 3AROA 4MNLA 1GUVA 3H9RB 2DMVA 2LAJA 2WAEA 4E5RA 1FKTA 3KAIA 3PRBA 2ZQUA 3KADA 4TW8A 2RE3A 1GOIA 4Z2JA 1WB0A 1O6WA 3LKXA 1LL7A 3AS1A 4C02B 4URIA 4QZVB 3WL1A 3CGNA 1FKIA 1R9HA 3FSBA 1JMQA 4P8UA 4ZS6A 2AOSA 1OGGA 2YSFA 3O5FA 4TNSA 1ZBVA 4DRHA 1FKJA 2KXQA 1LL4A 3MCBA 3UQBA 2DK1A 5AHTA 4ML4A 2YSIA 2ZQVA 3MDYB 4QT3A 1KT0A 1FKHA 1W1VA 2Y78A 4Z2HA 2MDIA 4FAPA 2PBCA 1UR8A 4DWSB 4TW6A 3WD3A 2PPPA 1KFWA 4DZ2A 5DIUA 5DF0A 5HWCA 2DWVA 2AWGA 3CGMA 3PRAA 4Z2LA 3RM4A 4ODPA 3WH0A 1E6NA 1NH6A 1KT1A 1YW5A 1FKDA 3O5RA 2Y8NB 4MAVA 1ITXA 5HWBA 2YBTA 2M08A 3I6CA 4P8WA 2OLHA 4DRJA 2WADA 4JFIA 3CHFA 3WD0A 4MTVA 1OWQA 4W9QA 3KAFA 4HBEA 5E5WA 3UQIA 1SYTA 3G6MA 1HKMA 3NRKA 2RUDA 2XP3A 1BKFA 3NI6A 3BXWA 3AS0A 1ZB5A 2G8ZA 4DRKA 4U86A 3PA7A 1F40A 2WLZA 1A7XA 4IQ2A 2L4JA 5E65A 1FKFA 3LE4A 1P5QA 1SR0A 2OWOA 2M1IA 1Q6HA 4ZPWR 3WD4A 1X6NA 4KQZA 2KFWA 2JXWA 3IKDA 2PV1A 2IUZA 3O5MA 3ARUA 1IX5A 4N19A 3AS2A 4REXA 4TW7A 1LJYA 1NWUA 1CTNA 1NMVA 2A3EA 3IK8A 3WIJA 1C9HA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1FJD A;  1JVW A;  3O5D A;  2ZQT A;  4DIP A;  4DZ3 A;  5I98 A;  1EG4 A;  2F21 A;  3JYM A;  2VCD A;  1B6C A;  2ZQS A;  3M85 A;  1N1A A;  4ODO A;  2EZ5 W;  2JV4 A;  1FKR A;  4U85 A;  2RQS A;  4DRQ A;  4W9O A;  3UQA A;  2JX8 A;  1Q1C A;  2ZAJ A;  2XP9 A;  1WR7 A;  3O5J A;  1PBK A;  1W26 A;  2XP4 A;  4JFJ A;  2M2A A;  2RUR A;  2D9F A;  3O5P A;  2MLY A;  1ROU A;  5B8I C;  4GIV A;  3RFW A;  2RSE A;  3UI4 A;  4G50 A;  2BA1 A;  2KGJ A;  3TCZ A;  1K9R A;  1NMW A;  3KAC A;  4LAX A;  1QZ2 A;  3PRD A;  2M8J A;  3O5K A;  4U84 A;  3KAH A;  4G2P A;  1YAT A;  3IKG A;  2RUC A;  1FKS A;  1Y0O A;  1NSG A;  2FAP A;  3JYJ A;  2MPH A;  1F8A B;  2ZR4 A;  3FAP A;  2MLZ A;  2KO7 A;  2MNT A;  4NNR A;  5D75 A;  2XP7 A;  3CNG A;  1ZCN A;  4O2T A;  2ZR5 A;  1JNS A;  1K9Q A;  1ROT A;  1EG3 A;  4TYO A;  1EQ3 A;  1ZK6 A;  4GGQ A;  4DRN A;  1D7J A;  2DJY A;  2LKN A;  2DG9 A;  2PV3 A;  3GPK A;  4DT4 A;  1Q6I A;  3JXV A;  3KZ7 A;  5DIT A;  1I5H W;  1FD9 A;  4DRI A;  5HT1 A;  4MSP A;  1L1P A;  2MLX A;  4LAY A;  3UI5 A;  1J4H A;  1PIN A;  2LPV A;  2JMF A;  2JZV A;  4LAW A;  1TCO C;  4ITZ A;  1JNT A;  3TC5 A;  5HW8 A;  5HTG A;  2PV2 A;  4DRP A;  2F4E A;  3O5I A;  3NTP A;  1TK7 A;  3O5L A;  4DRM A;  4ODQ A;  1Q6U A;  4QIB A;  1BL4 A;  2RUQ A;  3IHZ A;  3TDB A;  1J4I A;  2K8I A;  4QT2 A;  1M5Y A;  2YSG A;  1D7H A;  4DRO A;  1WMV A;  4ODK A;  2DG3 A;  3EY6 A;  1QPL A;  2OFN A;  3L4H A;  4JFM A;  5CQ2 A;  4TX0 A;  3B7X A;  1J6Y A;  2M8I A;  1FAP A;  5HUA A;  4J4O A;  2F2D A;  2MF9 A;  1C9H A;  2M3O W;  3ODK A;  2Q5A A;  5BXJ A;  4MGV A;  2XPA A;  3KAB A;  2IF4 A;  2XP8 A;  3VAW A;  1D6O A;  3KAG A;  3KCE A;  4R0X A;  2KI3 A;  2PPO A;  3M7N A;  4JYS A;  1EYM A;  4LAV A;  2KR7 A;  2PPN A;  2UZ5 A;  2XP5 A;  1QPF A;  5GPG A;  4ODR A;  2E45 A;  3OOB A;  1FKK A;  3RGC A;  1FKG A;  4W9P A;  2FKE A;  4ODM A;  2YSB A;  1U79 A;  3UI6 A;  3O5Q A;  2YSH A;  2DG4 A;  1J4R A;  5HKG A;  4JFK A;  4DH0 A;  1T11 A;  2LGO A;  1HXV A;  4BF8 A;  4ODL A;  2XPB A;  4FN2 A;  5HW7 A;  4IPX A;  4JFL A;  5DIV A;  2LJ4 A;  1FKB A;  2KE0 A;  4IQC A;  2L2S A;  3LUO A;  3O5G A;  5J6E A;  2N87 A;  2ZR6 A;  2ITK A;  1FKL A;  2VN1 A;  2XP6 A;  5HW6 A;  1D7I A;  2DK7 A;  4J4N A;  4ODN A;  3UF8 A;  3O5E A;  3H9R B;  2DMV A;  2LAJ A;  4E5R A;  1FKT A;  3KAI A;  3PRB A;  2ZQU A;  3KAD A;  4TW8 A;  2RE3 A;  1O6W A;  4C02 B;  3CGN A;  1FKI A;  1R9H A;  1JMQ A;  4TNS A;  2YSF A;  3O5F A;  4DRH A;  1FKJ A;  2KXQ A;  3UQB A;  2DK1 A;  5AHT A;  2YSI A;  2ZQV A;  3MDY B;  4QT3 A;  1KT0 A;  1FKH A;  2Y78 A;  2MDI A;  4FAP A;  2PBC A;  4TW6 A;  2PPP A;  4DZ2 A;  5DIU A;  5HWC A;  2DWV A;  2AWG A;  3CGM A;  4ODP A;  3WH0 A;  1KT1 A;  1YW5 A;  1FKD A;  3O5R A;  5HWB A;  2M08 A;  3I6C A;  4DRJ A;  4JFI A;  4W9Q A;  3KAF A;  3UQI A;  3NRK A;  2RUD A;  2XP3 A;  1BKF A;  3NI6 A;  4DRK A;  4U86 A;  3PA7 A;  1F40 A;  1A7X A;  4IQ2 A;  2L4J A;  1FKF A;  3LE4 A;  1P5Q A;  2M1I A;  1Q6H A;  2KFW A;  2JXW A;  3IKD A;  2PV1 A;  3O5M A;  4N19 A;  4REX A;  4TW7 A;  1NMV A;  3IK8 A;  3O5O A; 
#chains in the Genus database with same CATH topology
 1FJD A;  4R5E A;  3LKX B;  1GRJ A;  1JVW A;  3O5D A;  2B31 A;  2ZQT A;  4DIP A;  4DZ3 A;  4NSB A;  5I98 A;  1EG4 A;  3WKZ A;  2F21 A;  4XAK A;  3JYM A;  2VCD A;  4ZPV R;  1B6C A;  2ZQS A;  1XHG A;  3M85 A;  1ZBK A;  1N1A A;  4ODO A;  2EZ5 W;  2JV4 A;  1FKR A;  2DT3 A;  4Z2G A;  4U85 A;  2RQS A;  4DRQ A;  4W9O A;  1E6Z A;  3UQA A;  2JX8 A;  1Q1C A;  2ZAJ A;  1HJV A;  2XP9 A;  1WR7 A;  3ALG A;  3ARS A;  2DT2 A;  3O5J A;  1PBK A;  1W26 A;  1E6R A;  2XP4 A;  1EIB A;  4JFJ A;  2M2A A;  3ARP A;  2RUR A;  2D9F A;  3BMB A;  3O5P A;  2MLY A;  1ROU A;  5B8I C;  4GIV A;  1LG2 A;  3RFW A;  3MQG A;  1ZBW A;  4WKA A;  1E6P A;  2RSE A;  3UI4 A;  4G50 A;  2BA1 A;  4HBO A;  3O5O A;  2KGJ A;  3TCZ A;  1K9R A;  1NMW A;  1LG1 A;  3CH9 A;  3KAC A;  4LAX A;  2WK2 A;  1QZ2 A;  3PRD A;  5DEZ A;  2M8J A;  2F23 A;  5DO2 A;  3O5K A;  4U84 A;  1D2K A;  2DPE A;  3KAH A;  4G2P A;  1YAT A;  3IKG A;  4L3N A;  2RUC A;  1EHN A;  2DT1 A;  1FKS A;  1Y0O A;  4DWS D;  1NSG A;  1E9L A;  2FAP A;  3JYJ A;  4AY1 A;  1WAW A;  4NZC A;  1HKK A;  1NWS A;  1LL6 A;  1JND A;  3GU0 A;  5GQB A;  4WIW A;  2MPH A;  1FFR A;  3B9D A;  1F8A B;  2ZR4 A;  1W1P A;  3CHE A;  3FAP A;  1LQ0 A;  3ARY A;  2MLZ A;  4L72 B;  4A0T A;  2KO7 A;  2DSV A;  3ARQ A;  2MNT A;  4NNR A;  5D75 A;  2XP7 A;  3CNG A;  1HJX A;  1ZCN A;  4O2T A;  3WL0 A;  3ARR A;  2EUL A;  2ZR5 A;  1TFV A;  3QOK A;  1O6I A;  4ZPT R;  1JNS A;  1K9Q A;  1ROT A;  1EG3 A;  3ARV A;  4IT6 A;  4PTM A;  1RP5 A;  4TYO A;  1EQ3 A;  1EDQ A;  1ZK6 A;  4GGQ A;  5JH8 A;  4DRN A;  1D7J A;  2DJY A;  1W1Y A;  1ZU8 A;  3FY1 A;  2YBU A;  1FFQ A;  4P8X A;  2LKN A;  2DG9 A;  2PV3 A;  3GPK A;  4Q22 A;  4DT4 A;  1Q6I A;  2PI6 A;  3FXY A;  3JXV A;  3KZ7 A;  3PQH A;  5DIT A;  3CZ8 A;  1I5H W;  1FD9 A;  4DRI A;  5HT1 A;  4MSP A;  1L1P A;  2MLX A;  4LAY A;  3UI5 A;  4Z2K A;  1J4H A;  1H0G A;  1PIN A;  2P4V A;  4Q7N A;  2LPV A;  2JMF A;  3MCB B;  2JZV A;  3ALF A;  2FDM A;  4LAW A;  3FS8 A;  1TCO C;  4ITZ A;  1OGB A;  1JNT A;  2ESC A;  3TC5 A;  4Z2I A;  5HW8 A;  5HTG A;  1H0I A;  2PV2 A;  4DRP A;  2G41 A;  3W4R A;  1ZBC A;  3OA5 A;  1JCH B;  3B9A A;  1HKJ A;  2F4E A;  1FLC A;  3O5I A;  4LGX A;  3NTP A;  1TK7 A;  3O5L A;  4DRM A;  4ODQ A;  1Q6U A;  4QIB A;  1BL4 A;  2B5U B;  2RUQ A;  3WQW A;  3IHZ A;  3TDB A;  1J4I A;  4MNJ A;  2K8I A;  1GPF A;  4QT2 A;  1M5Y A;  2YSG A;  1W9V A;  1D7H A;  4DRO A;  1WMV A;  4P8V A;  2A3B A;  4ODK A;  2DG3 A;  3EY6 A;  3MQH A;  1E15 A;  1QPL A;  2OFN A;  3L4H A;  2A3A A;  5CQ2 A;  4JFM A;  4TX0 A;  4WKF A;  3B7X A;  1J6Y A;  2M8I A;  3AQU A;  1NWR A;  1FAP A;  5HUA A;  4J4O A;  1UR9 A;  2ETN A;  2F2D A;  1WNO A;  2MF9 A;  4A0U A;  2M3O W;  3ODK A;  1NWT A;  2Q5A A;  5BXJ A;  4MGV A;  2XPA A;  3B8S A;  5E62 A;  3KAB A;  1HKI A;  3RM8 A;  2A3C A;  2IF4 A;  2XP8 A;  3VAW A;  3ARZ A;  1D6O A;  5E66 A;  3KAG A;  1VF8 A;  4WJX A;  3KCE A;  4R0X A;  2KI3 A;  2PPO A;  5E64 A;  4S3J A;  3M7N A;  4JYS A;  1EYM A;  3GTY X;  3AS3 A;  4S3K A;  4LAV A;  2KR7 A;  4WKH A;  1W9U A;  2PPN A;  2UZ5 A;  3WQV A;  3WD1 A;  2XP5 A;  3B9E A;  3FSC A;  3WD2 A;  1K9T A;  1QPF A;  5GPG A;  4ODR A;  1W1T A;  4UDM A;  3ARX A;  2E45 A;  3OOB A;  4DWS A;  2YAJ B;  2WM0 A;  4MNK A;  1FKK A;  1RD6 A;  3RGC A;  1X6L A;  2DT0 A;  1FKG A;  2WLY A;  3RME A;  4KR0 B;  1TR8 A;  2QF8 A;  3ARW A;  2QRV A;  4W9P A;  2FKE A;  2DSZ A;  1XRV A;  2DSU A;  4IT4 A;  4ODM A;  2YSB A;  1U79 A;  1W9P A;  3UI6 A;  4GLX A;  3O5Q A;  2YSH A;  3G6L A;  2DG4 A;  1J4R A;  5HKG A;  4JFK A;  2O92 A;  4DH0 A;  1T11 A;  1ZL1 A;  2LGO A;  1HXV A;  4BF8 A;  5HBF A;  4ODL A;  2XPB A;  4FN2 A;  5HW7 A;  4IPX A;  4JFL A;  3PR9 A;  5DIV A;  2LJ4 A;  1FKB A;  2KE0 A;  3ART A;  4IQC A;  4MNM A;  4MPK A;  2O9O A;  2L2S A;  3LUO A;  3O5G A;  3RM9 A;  1HJW A;  4DWS C;  3CHC A;  5J6E A;  2N87 A;  4WK9 A;  2ZR6 A;  2ITK A;  1JNE A;  1FKL A;  2VN1 A;  2XP6 A;  5HW6 A;  1D7I A;  2DK7 A;  5GPR A;  4W5U A;  4J4N A;  4ODN A;  2DSW A;  5U47 A;  2PN0 A;  3UF8 A;  3O5E A;  3CHD A;  4HAR A;  3ARO A;  4MNL A;  1GUV A;  3H9R B;  2DMV A;  2LAJ A;  2WAE A;  4E5R A;  1FKT A;  3KAI A;  3PRB A;  2ZQU A;  3KAD A;  4TW8 A;  2RE3 A;  1GOI A;  4Z2J A;  1WB0 A;  1O6W A;  3LKX A;  1LL7 A;  3AS1 A;  4C02 B;  1E44 A;  4URI A;  4QZV B;  3WL1 A;  3CGN A;  1FKI A;  1R9H A;  3FSB A;  1JMQ A;  4P8U A;  4ZS6 A;  2AOS A;  1OGG A;  2YSF A;  3O5F A;  4TNS A;  1ZBV A;  4DRH A;  1FKJ A;  2KXQ A;  1LL4 A;  3MCB A;  3UQB A;  2DK1 A;  5AHT A;  4ML4 A;  2YSI A;  2ZQV A;  3MDY B;  4QT3 A;  1KT0 A;  1FKH A;  1W1V A;  2Y78 A;  4Z2H A;  2MDI A;  4FAP A;  2PBC A;  1UR8 A;  4DWS B;  4TW6 A;  3WD3 A;  2PPP A;  1KFW A;  4DZ2 A;  5DIU A;  5DF0 A;  5HWC A;  2DWV A;  2AWG A;  3CGM A;  3PRA A;  4Z2L A;  3RM4 A;  4ODP A;  3WH0 A;  1E6N A;  1NH6 A;  1KT1 A;  1YW5 A;  1FKD A;  3O5R A;  2Y8N B;  4MAV A;  1ITX A;  5HWB A;  2YBT A;  2M08 A;  3I6C A;  4P8W A;  2OLH A;  4DRJ A;  2WAD A;  4JFI A;  3CHF A;  3WD0 A;  4MTV A;  1OWQ A;  4W9Q A;  3KAF A;  4HBE A;  5E5W A;  3UQI A;  1SYT A;  3G6M A;  1HKM A;  3NRK A;  2RUD A;  2XP3 A;  1BKF A;  3NI6 A;  3BXW A;  3AS0 A;  1ZB5 A;  2G8Z A;  4DRK A;  4U86 A;  3PA7 A;  1F40 A;  2WLZ A;  1A7X A;  4IQ2 A;  2L4J A;  5E65 A;  1FKF A;  3LE4 A;  1P5Q A;  1SR0 A;  2OWO A;  2M1I A;  1Q6H A;  4ZPW R;  3WD4 A;  1X6N A;  4KQZ A;  2KFW A;  2JXW A;  3IKD A;  2PV1 A;  2IUZ A;  3O5M A;  3ARU A;  1IX5 A;  4N19 A;  3AS2 A;  4REX A;  4TW7 A;  1LJY A;  3EIP A;  1NWU A;  1CTN A;  1NMV A;  2A3E A;  3IK8 A;  3WIJ A;  1C9H A; 
#chains in the Genus database with same CATH homology
 1FJD A;  4R5E A;  3LKX B;  1JVW A;  3O5D A;  2B31 A;  2ZQT A;  4DIP A;  4DZ3 A;  4NSB A;  5I98 A;  1EG4 A;  3WKZ A;  2F21 A;  4XAK A;  3JYM A;  2VCD A;  4ZPV R;  1B6C A;  2ZQS A;  1XHG A;  3M85 A;  1ZBK A;  1N1A A;  4ODO A;  2EZ5 W;  2JV4 A;  1FKR A;  2DT3 A;  4Z2G A;  4U85 A;  2RQS A;  4DRQ A;  4W9O A;  1E6Z A;  3UQA A;  2JX8 A;  1Q1C A;  2ZAJ A;  1HJV A;  2XP9 A;  1WR7 A;  3ALG A;  3ARS A;  2DT2 A;  3O5J A;  1PBK A;  1W26 A;  1E6R A;  2XP4 A;  1EIB A;  4JFJ A;  2M2A A;  3ARP A;  2RUR A;  2D9F A;  3O5P A;  2MLY A;  1ROU A;  5B8I C;  4GIV A;  1LG2 A;  3RFW A;  3MQG A;  1ZBW A;  4WKA A;  1E6P A;  2RSE A;  3UI4 A;  4G50 A;  2BA1 A;  4HBO A;  3O5O A;  2KGJ A;  3TCZ A;  1K9R A;  1NMW A;  1LG1 A;  3CH9 A;  3KAC A;  4LAX A;  2WK2 A;  1QZ2 A;  3PRD A;  5DEZ A;  2M8J A;  5DO2 A;  3O5K A;  4U84 A;  1D2K A;  2DPE A;  3KAH A;  4G2P A;  1YAT A;  3IKG A;  4L3N A;  2RUC A;  1EHN A;  2DT1 A;  1FKS A;  1Y0O A;  4DWS D;  1NSG A;  1E9L A;  2FAP A;  3JYJ A;  4AY1 A;  1WAW A;  4NZC A;  1HKK A;  1NWS A;  1LL6 A;  1JND A;  5GQB A;  4WIW A;  2MPH A;  1FFR A;  3B9D A;  1F8A B;  2ZR4 A;  1W1P A;  3CHE A;  3FAP A;  1LQ0 A;  3ARY A;  2MLZ A;  4L72 B;  4A0T A;  2KO7 A;  2DSV A;  3ARQ A;  2MNT A;  4NNR A;  5D75 A;  2XP7 A;  3CNG A;  1HJX A;  1ZCN A;  4O2T A;  3WL0 A;  3ARR A;  2ZR5 A;  1TFV A;  3QOK A;  1O6I A;  4ZPT R;  1JNS A;  1K9Q A;  1ROT A;  1EG3 A;  3ARV A;  4IT6 A;  4PTM A;  1RP5 A;  4TYO A;  1EQ3 A;  1EDQ A;  1ZK6 A;  4GGQ A;  5JH8 A;  4DRN A;  1D7J A;  2DJY A;  1W1Y A;  1ZU8 A;  3FY1 A;  2YBU A;  1FFQ A;  4P8X A;  2LKN A;  2DG9 A;  2PV3 A;  3GPK A;  4Q22 A;  4DT4 A;  1Q6I A;  2PI6 A;  3FXY A;  3JXV A;  3KZ7 A;  3PQH A;  5DIT A;  3CZ8 A;  1I5H W;  1FD9 A;  4DRI A;  5HT1 A;  4MSP A;  1L1P A;  2MLX A;  4LAY A;  3UI5 A;  4Z2K A;  1J4H A;  1H0G A;  1PIN A;  4Q7N A;  2LPV A;  2JMF A;  3MCB B;  2JZV A;  3ALF A;  2FDM A;  4LAW A;  3FS8 A;  1TCO C;  4ITZ A;  1OGB A;  1JNT A;  2ESC A;  3TC5 A;  4Z2I A;  5HW8 A;  5HTG A;  1H0I A;  2PV2 A;  4DRP A;  2G41 A;  3W4R A;  1ZBC A;  3OA5 A;  3B9A A;  1HKJ A;  2F4E A;  1FLC A;  3O5I A;  4LGX A;  3NTP A;  1TK7 A;  3O5L A;  4DRM A;  4ODQ A;  1Q6U A;  4QIB A;  1BL4 A;  2RUQ A;  3WQW A;  3IHZ A;  3TDB A;  1J4I A;  4MNJ A;  2K8I A;  1GPF A;  4QT2 A;  1M5Y A;  2YSG A;  1W9V A;  1D7H A;  4DRO A;  1WMV A;  4P8V A;  2A3B A;  4ODK A;  2DG3 A;  3EY6 A;  3MQH A;  1E15 A;  1QPL A;  2OFN A;  3L4H A;  2A3A A;  5CQ2 A;  4JFM A;  4TX0 A;  4WKF A;  3B7X A;  1J6Y A;  2M8I A;  3AQU A;  1NWR A;  1FAP A;  5HUA A;  4J4O A;  1UR9 A;  2F2D A;  1WNO A;  2MF9 A;  4A0U A;  2M3O W;  3ODK A;  1NWT A;  2Q5A A;  5BXJ A;  4MGV A;  2XPA A;  3B8S A;  5E62 A;  3KAB A;  1HKI A;  3RM8 A;  2A3C A;  2IF4 A;  2XP8 A;  3VAW A;  3ARZ A;  1D6O A;  5E66 A;  3KAG A;  1VF8 A;  4WJX A;  3KCE A;  4R0X A;  2KI3 A;  2PPO A;  5E64 A;  4S3J A;  3M7N A;  4JYS A;  1EYM A;  3AS3 A;  4S3K A;  4LAV A;  2KR7 A;  4WKH A;  1W9U A;  2PPN A;  2UZ5 A;  3WQV A;  3WD1 A;  2XP5 A;  3B9E A;  3FSC A;  3WD2 A;  1K9T A;  1QPF A;  5GPG A;  4ODR A;  1W1T A;  3ARX A;  2E45 A;  3OOB A;  4DWS A;  2YAJ B;  2WM0 A;  4MNK A;  1FKK A;  1RD6 A;  3RGC A;  1X6L A;  2DT0 A;  1FKG A;  2WLY A;  3RME A;  4KR0 B;  1TR8 A;  2QF8 A;  3ARW A;  2QRV A;  4W9P A;  2FKE A;  2DSZ A;  1XRV A;  2DSU A;  4IT4 A;  4ODM A;  2YSB A;  1U79 A;  1W9P A;  3UI6 A;  4GLX A;  3O5Q A;  2YSH A;  3G6L A;  2DG4 A;  1J4R A;  5HKG A;  4JFK A;  2O92 A;  4DH0 A;  1T11 A;  1ZL1 A;  2LGO A;  1HXV A;  4BF8 A;  5HBF A;  4ODL A;  2XPB A;  4FN2 A;  5HW7 A;  4IPX A;  4JFL A;  3PR9 A;  5DIV A;  2LJ4 A;  1FKB A;  2KE0 A;  3ART A;  4IQC A;  4MNM A;  4MPK A;  2O9O A;  2L2S A;  3LUO A;  3O5G A;  3RM9 A;  1HJW A;  4DWS C;  3CHC A;  5J6E A;  2N87 A;  4WK9 A;  2ZR6 A;  2ITK A;  1JNE A;  1FKL A;  2VN1 A;  2XP6 A;  5HW6 A;  1D7I A;  2DK7 A;  5GPR A;  4W5U A;  4J4N A;  4ODN A;  2DSW A;  5U47 A;  3UF8 A;  3O5E A;  3CHD A;  4HAR A;  3ARO A;  4MNL A;  1GUV A;  3H9R B;  2DMV A;  2LAJ A;  2WAE A;  4E5R A;  1FKT A;  3KAI A;  3PRB A;  2ZQU A;  3KAD A;  4TW8 A;  2RE3 A;  1GOI A;  4Z2J A;  1WB0 A;  1O6W A;  3LKX A;  1LL7 A;  3AS1 A;  4C02 B;  4URI A;  4QZV B;  3WL1 A;  3CGN A;  1FKI A;  1R9H A;  3FSB A;  1JMQ A;  4P8U A;  4ZS6 A;  2AOS A;  1OGG A;  2YSF A;  3O5F A;  4TNS A;  1ZBV A;  4DRH A;  1FKJ A;  2KXQ A;  1LL4 A;  3MCB A;  3UQB A;  2DK1 A;  5AHT A;  4ML4 A;  2YSI A;  2ZQV A;  3MDY B;  4QT3 A;  1KT0 A;  1FKH A;  1W1V A;  2Y78 A;  4Z2H A;  2MDI A;  4FAP A;  2PBC A;  1UR8 A;  4DWS B;  4TW6 A;  3WD3 A;  2PPP A;  1KFW A;  4DZ2 A;  5DIU A;  5DF0 A;  5HWC A;  2DWV A;  2AWG A;  3CGM A;  3PRA A;  4Z2L A;  3RM4 A;  4ODP A;  3WH0 A;  1E6N A;  1NH6 A;  1KT1 A;  1YW5 A;  1FKD A;  3O5R A;  2Y8N B;  4MAV A;  1ITX A;  5HWB A;  2YBT A;  2M08 A;  3I6C A;  4P8W A;  2OLH A;  4DRJ A;  2WAD A;  4JFI A;  3CHF A;  3WD0 A;  4MTV A;  1OWQ A;  4W9Q A;  3KAF A;  4HBE A;  5E5W A;  3UQI A;  1SYT A;  3G6M A;  1HKM A;  3NRK A;  2RUD A;  2XP3 A;  1BKF A;  3NI6 A;  3BXW A;  3AS0 A;  1ZB5 A;  2G8Z A;  4DRK A;  4U86 A;  3PA7 A;  1F40 A;  2WLZ A;  1A7X A;  4IQ2 A;  2L4J A;  5E65 A;  1FKF A;  3LE4 A;  1P5Q A;  1SR0 A;  2OWO A;  2M1I A;  1Q6H A;  4ZPW R;  3WD4 A;  1X6N A;  4KQZ A;  2KFW A;  2JXW A;  3IKD A;  2PV1 A;  2IUZ A;  3O5M A;  3ARU A;  1IX5 A;  4N19 A;  3AS2 A;  4REX A;  4TW7 A;  1LJY A;  1NWU A;  1CTN A;  1NMV A;  2A3E A;  3IK8 A;  3WIJ A;  1C9H A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...