2ZQUA

Crystal structure of a mutant pin1 peptidyl-prolyl cis-trans isomerase
Total Genus 42
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
42
sequence length
158
structure length
153
Chain Sequence
KLPPGWEKRMSRSSGRVYYFNHITNASQAERPSGGKNGQGEPARVRCSHLLVKHSQSRRPSSWRQEKITRTKEEALELINGYIQKIKSGEEDFESLASQFSDCSSAKARGDLGAFSRGQMQKPFEDASFALRTGEMSGPVFTDSGIHIILRTE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Peptidyl-prolyl cis-trans isomerase NIMA-interacting 1
publication title Structural studies on PIN1 mutants
rcsb
source organism Homo sapiens
molecule tags Isomerase
total genus 42
structure length 153
sequence length 158
ec nomenclature ec 5.2.1.8: Peptidylprolyl isomerase.
pdb deposition date 2008-08-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00397 WW WW domain
A PF00639 Rotamase PPIC-type PPIASE domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.20.70.10 Mainly Beta Single Sheet Ubiquitin Ligase Nedd4; Chain: W; Ubiquitin Ligase Nedd4; Chain: W; 2zquA01
3.10.50.40 Alpha Beta Roll Chitinase A; domain 3 Chitinase A; domain 3 2zquA02
2K8IA 5HWBA 2JX8A 4DZ3A 4JFJA 1L1PA 1P5QA 1EG4A 4IPXA 2EZ5W 3O5OA 2MF9A 4DRPA 1Q6IA 1Q6HA 3CGMA 3KAIA 3KABA 3IKGA 4O2TA 2ITKA 3LUOA 2RE3A 2RUDA 1D7IA 3PRBA 1FKKA 1FKGA 2XP5A 1FKFA 2PPPA 2RUQA 4ODRA 3UQIA 5HKGA 1J4RA 1WMVA 3KCEA 2F4EA 2JV4A 5BXJA 4DROA 5HT1A 2KGJA 3UF8A 2LPVA 2DMVA 1ROTA 4NNRA 1K9QA 4DRMA 3TC5A 1I5HW 2UZ5A 4JFLA 3GPKA 4U85A 2XPBA 4DT4A 2M8IA 3O5KA 1JNTA 3JYMA 2LJ4A 1A7XA 2L4JA 4N19A 2XP8A 2M2AA 3O5IA 3CNGA 4QT3A 4LAVA 2DK7A 4U84A 1FKTA 3JXVA 4MGVA 4E5RA 2FKEA 3O5JA 5HTGA 1EQ3A 1K9RA 3LE4A 4ODPA 3PRDA 1NMVA 4TNSA 2LAJA 3CGNA 2RQSA 1EG3A 3TDBA 3RGCA 2N87A 1EYMA 4JFKA 4W9QA 1YW5A 3WH0A 2KR7A 1D7JA 2XP7A 1O6WA 4ODQA 3KZ7A 2PV2A 3KAHA 5AHTA 3O5RA 4ODLA 1HXVA 2E45A 2KFWA 2RSEA 2ZQTA 2RURA 2JZVA 1JNSA 1W26A 3B7XA 2XPAA 4GIVA 2KE0A 4TW6A 1Q1CA 5HW8A 4G2PA 2JMFA 4TW7A 4DRQA 2LGOA 1FKRA 3NTPA 4J4NA 3KAFA 1B6CA 1ROUA 1KT1A 3O5PA 1F8AB 5HUAA 2YSIA 4LAXA 1N1AA 1Q6UA 1R9HA 3H9RB 4DRIA 1FKBA 1J6YA 4ODKA 4TYOA 2F21A 3O5FA 1FD9A 3NRKA 1M5YA 3L4HA 3TCZA 3MDYB 4TX0A 1Y0OA 3VAWA 1FAPA 2DG3A 2PV1A 2ZQVA 4DIPA 5HWCA 2KI3A 2XP4A 2M1IA 1J4HA 4JFMA 2MLZA 1U79A 3O5QA 4ODNA 2ZAJA 3KAGA 3UI5A 1WR7A 5DITA 4ITZA 1JMQA 1JVWA 1FKIA 3IHZA 5GPGA 4GGQA 1D6OA 4REXA 5HW7A 1ZCNA 2M3OW 2BA1A 2IF4A 4LAYA 5DIVA 2M08A 3FAPA 1BKFA 1FKHA 2DG4A 4BF8A 2XP3A 4DRNA 4U86A 3KADA 4IQCA 2ZQSA 2FAPA 4JFIA 5DIUA 2YSFA 4MSPA 3PA7A 4JYSA 4ODOA 3O5DA 4C02B 4DRKA 4W9PA 3O5MA 4QT2A 3EY6A 2ZR5A 2VN1A 4DRHA 2ZR4A 2ZR6A 4G50A 4QIBA 1NSGA 5D75A 2XP6A 1FKDA 4IQ2A 2MLXA 2Y78A 1FJDA 3IKDA 4J4OA 1T11A 3ODKA 2DK1A 3UQAA 2PBCA 4R0XA 5CQ2A 1ZK6A 2MLYA 1F40A 2PV3A 2PPNA 1J4IA 4TW8A 3OOBA 2DJYA 1PBKA 2L2SA 4ODMA 1FKSA 4LAWA 3O5EA 2D9FA 1QPLA 1PINA 3NI6A 2DG9A 4W9OA 5I98A 2DWVA 1C9HA 3O5LA 3UI6A 2YSHA 1YATA 3KACA 1FKJA 2VCDA 4DRJA 1FKLA 2Q5AA 2XP9A 5HW6A 3I6CA 3UI4A 1QPFA 2F2DA 4DH0A 1TCOC 2LKNA 4FN2A 2YSBA 1D7HA 2MDIA 1QZ2A 3IK8A 2ZQUA 2RUCA 4DZ2A 2MPHA 2PPOA 2KXQA 2KO7A 3O5GA 2AWGA 2M8JA 3JYJA 3RFWA 2MNTA 3M85A 2YSGA 1BL4A 3M7NA 1KT0A 4FAPA 1NMWA 3UQBA 5J6EA 5B8IC 1TK7A 2JXWA 2OFNA
chains in the Genus database with same CATH superfamily
5E62A 2K8IA 5HWBA 3CH9A 2JX8A 4DZ3A 2A3CA 3ARZA 4MNLA 2DSUA 3B9EA 4JFJA 1IX5A 1L1PA 1P5QA 3B8SA 1TR8A 4Z2GA 3PRAA 1OGGA 1EG4A 4IPXA 2EZ5W 3LKXA 1E6ZA 4UDMA 3AROA 3O5OA 2A3BA 3CHFA 2DT1A 1TFVA 2MF9A 4DRPA 1W9PA 1Q6IA 1KFWA 1Q6HA 3GU0A 3CGMA 3ARXA 3KAIA 4Z2HA 1ZBCA 3KABA 3IKGA 4O2TA 1E44A 1E6NA 2ITKA 3CZ8A 3ARQA 3LUOA 2RE3A 2RUDA 1D7IA 1K9TA 3PRBA 1FKKA 2DSZA 1FKGA 2XP5A 1FKFA 3MQHA 1X6NA 1HKKA 3WL0A 2PPPA 3BXWA 2WM0A 3RMEA 2RUQA 4ODRA 3UQIA 1E9LA 2A3AA 2Y8NB 3B9DA 5HKGA 1J4RA 1WMVA 1GUVA 3KCEA 1ZL1A 2F4EA 4IT4A 1EIBA 3B9AA 5HBFA 1WAWA 2JV4A 5BXJA 2AOSA 5HT1A 2KGJA 4DROA 3UF8A 1NWSA 1X6LA 2LPVA 4KQZA 3G6MA 1E6PA 2DMVA 1WNOA 4MNMA 1SYTA 1NWUA 2B5UB 1ROTA 4NNRA 1K9QA 4DRMA 3TC5A 1I5HW 2OWOA 2UZ5A 4JFLA 2PN0A 1W1YA 2EULA 3CHEA 4U85A 3GPKA 3ARUA 2XPBA 3RM9A 4DT4A 2M8IA 4ZPWR 1HKJA 5DEZA 3O5KA 1JNTA 1XHGA 2G8ZA 1HKIA 2OLHA 3JYMA 2LJ4A 1A7XA 2L4JA 4N19A 3WKZA 3AQUA 2XP8A 4ZPTR 4AY1A 3OA5A 2M2AA 3O5IA 1ZBKA 3CNGA 4QT3A 3ARPA 2YBTA 4WKHA 4S3JA 4LAVA 2DK7A 4U84A 1LQ0A 1UR9A 1RP5A 1FKTA 4DWSB 3WD0A 1EHNA 4WKAA 1HJVA 3JXVA 4E5RA 2FKEA 3O5JA 4MGVA 5HTGA 3MQGA 1EQ3A 3ALFA 4WK9A 2YAJB 1K9RA 3LE4A 1HJXA 2B31A 4ODPA 3FY1A 1W1VA 3PRDA 1NMVA 3ALGA 5E65A 4TNSA 5GPRA 2LAJA 2DPEA 1ZBVA 3CGNA 2RQSA 1EG3A 3TDBA 3RGCA 2ESCA 2N87A 1W9UA 1EYMA 4JFKA 4P8VA 4W9QA 1E15A 1YW5A 3WH0A 1NWTA 2KR7A 1D7JA 2XP7A 1O6WA 4ODQA 3KZ7A 2PV2A 1ZU8A 3KAHA 5AHTA 3O5RA 4S3KA 4ODLA 1HXVA 2E45A 2KFWA 3ARWA 2RSEA 3G6LA 2ZQTA 1OWQA 2RURA 2JZVA 1JNSA 1W26A 3B7XA 2XPAA 5E64A 1FFRA 3WL1A 1GPFA 4GIVA 2KE0A 3RM8A 3PR9A 4TW6A 1Q1CA 4URIA 4QZVB 4NZCA 5HW8A 4G2PA 2JMFA 4TW7A 4XAKA 4DRQA 2LGOA 1FKRA 3GTYX 3NTPA 4J4NA 4GLXA 1ZB5A 3FSBA 3KAFA 1B6CA 1ROUA 1KT1A 3O5PA 4MNJA 1F8AB 3ARSA 5HUAA 4L3NA 3WD4A 2YSIA 4ZPVR 4DWSA 4LAXA 1N1AA 1H0IA 1Q6UA 1HJWA 4ML4A 1R9HA 3H9RB 2O9OA 4DRIA 1FKBA 3W4RA 4NSBA 1J6YA 4ODKA 4TYOA 2F21A 4PTMA 3O5FA 1LJYA 3EIPA 4HARA 1FD9A 4WKFA 2DSWA 3NRKA 1M5YA 2O92A 3L4HA 3TCZA 3MDYB 2QF8A 3PQHA 4TX0A 1Y0OA 3VAWA 2DT2A 1FAPA 2DG3A 2PV1A 3CHCA 2F23A 4Q22A 1JCHB 1VF8A 2ZQVA 4DIPA 4HBOA 5HWCA 2KI3A 2WAEA 2XP4A 3ARRA 2M1IA 1D2KA 1J4HA 4JFMA 2MLZA 1ITXA 1U79A 2WLZA 2WK2A 1GRJA 3O5QA 4ODNA 2ZAJA 4MPKA 3KAGA 1FLCA 1O6IA 3FSCA 3UI5A 5DO2A 1WR7A 5DITA 4ITZA 1JMQA 1JVWA 3WQVA 2DT0A 3FS8A 1XRVA 1FKIA 3IHZA 1LL7A 2DSVA 5GPGA 1W9VA 2WADA 4GGQA 1D6OA 4HBEA 4REXA 2WLYA 5HW7A 1ZCNA 4Z2KA 1ZBWA 2M3OW 3AS0A 5U47A 2BA1A 2IF4A 4LAYA 3WIJA 3BMBA 5DIVA 2M08A 1WB0A 3FAPA 1BKFA 1FKHA 2DG4A 4P8XA 4MTVA 1W1PA 3WD1A 4BF8A 1LG2A 2XP3A 4DRNA 4U86A 3KADA 4IQCA 2ZQSA 1NH6A 2FAPA 4JFIA 5DIUA 2YSFA 4MSPA 3WQWA 3PA7A 4JYSA 4ODOA 3O5DA 3QOKA 4C02B 5DF0A 4DRKA 3ARYA 3WD3A 4W9PA 3O5MA 4QT2A 3EY6A 2ZR5A 1UR8A 2VN1A 3RM4A 4DWSD 4DRHA 2P4VA 2ZR4A 1CTNA 2ZR6A 4G50A 4A0TA 4QIBA 1JNEA 3FXYA 1LG1A 4Q7NA 1NSGA 5D75A 2XP6A 1FKDA 2DT3A 4IQ2A 2MLXA 4WJXA 2Y78A 4MAVA 1FJDA 3IKDA 4J4OA 1T11A 3ODKA 1LL6A 3AS3A 3MCBB 2DK1A 4P8UA 3AS1A 3UQAA 2PBCA 4R0XA 5CQ2A 3CHDA 1ZK6A 2MLYA 1F40A 1LL4A 2PV3A 4W5UA 2PPNA 1J4IA 4TW8A 3OOBA 2DJYA 4Z2JA 1PBKA 2L2SA 1FKSA 2A3EA 4LAWA 4ODMA 3O5EA 2D9FA 1QPLA 1NWRA 1PINA 3NI6A 2DG9A 5E66A 4MNKA 4W9OA 3LKXB 5I98A 1H0GA 4Z2IA 2DWVA 1C9HA 2QRVA 3O5LA 3UI6A 1HKMA 2YSHA 1YATA 3ARTA 1FKJA 2ETNA 2VCDA 3KACA 4DRJA 4Z2LA 1FKLA 1FFQA 2Q5AA 2XP9A 5HW6A 4KR0B 3I6CA 3UI4A 1QPFA 2F2DA 4DH0A 1TCOC 2YBUA 2LKNA 4FN2A 2YSBA 1D7HA 2MDIA 1QZ2A 3IK8A 2ZQUA 2RUCA 4DZ2A 2MPHA 4IT6A 1GOIA 2PPOA 2KXQA 2PI6A 2KO7A 4WIWA 3WD2A 3O5GA 2AWGA 3ARVA 1RD6A 2M8JA 5E5WA 2IUZA 1SR0A 3JYJA 3RFWA 2MNTA 3M85A 4LGXA 2YSGA 1BL4A 3M7NA 1JNDA 1KT0A 1W1TA 4FAPA 1E6RA 1NMWA 1EDQA 3UQBA 4ZS6A 4P8WA 4R5EA 5J6EA 3AS2A 5B8IC 4A0UA 5JH8A 1TK7A 1OGBA 2FDMA 4L72B 2JXWA 4DWSC 2OFNA 5GQBA 2G41A 3MCBA
chains in the Genus database with same CATH topology
5E62A 2K8IA 5HWBA 3CH9A 2JX8A 4DZ3A 2A3CA 3ARZA 4MNLA 2DSUA 3B9EA 4JFJA 1IX5A 1L1PA 1P5QA 3B8SA 1TR8A 4Z2GA 3PRAA 1OGGA 1EG4A 4IPXA 2EZ5W 3LKXA 1E6ZA 3AROA 3O5OA 2A3BA 3CHFA 2DT1A 1TFVA 2MF9A 4DRPA 1W9PA 1Q6IA 1KFWA 1Q6HA 3CGMA 3ARXA 3KAIA 4Z2HA 1ZBCA 3KABA 3IKGA 4O2TA 1E6NA 2ITKA 3CZ8A 3ARQA 3LUOA 2RE3A 2RUDA 1D7IA 1K9TA 3PRBA 1FKKA 2DSZA 1FKGA 2XP5A 1FKFA 3MQHA 1X6NA 1HKKA 3WL0A 2PPPA 3BXWA 2WM0A 3RMEA 2RUQA 4ODRA 3UQIA 1E9LA 2A3AA 2Y8NB 3B9DA 5HKGA 1J4RA 1WMVA 1GUVA 3KCEA 1ZL1A 2F4EA 4IT4A 1EIBA 3B9AA 5HBFA 1WAWA 2JV4A 5BXJA 2AOSA 5HT1A 2KGJA 4DROA 3UF8A 1NWSA 1X6LA 2LPVA 4KQZA 3G6MA 1E6PA 2DMVA 1WNOA 4MNMA 1SYTA 1NWUA 1ROTA 4NNRA 1K9QA 4DRMA 3TC5A 1I5HW 2OWOA 2UZ5A 4JFLA 1W1YA 3CHEA 3GPKA 4U85A 3ARUA 2XPBA 3RM9A 4DT4A 2M8IA 4ZPWR 1HKJA 5DEZA 3O5KA 1JNTA 1XHGA 2G8ZA 1HKIA 2OLHA 3JYMA 2LJ4A 1A7XA 2L4JA 4N19A 3WKZA 3AQUA 2XP8A 4ZPTR 4AY1A 3OA5A 2M2AA 3O5IA 1ZBKA 3CNGA 4QT3A 3ARPA 2YBTA 4WKHA 4S3JA 4LAVA 2DK7A 4U84A 1LQ0A 1UR9A 1RP5A 1FKTA 4DWSB 3WD0A 1EHNA 4WKAA 1HJVA 3JXVA 4E5RA 2FKEA 3O5JA 4MGVA 5HTGA 3MQGA 1EQ3A 3ALFA 4WK9A 2YAJB 1K9RA 3LE4A 1HJXA 2B31A 4ODPA 3FY1A 1W1VA 3PRDA 1NMVA 3ALGA 5E65A 4TNSA 5GPRA 2LAJA 2DPEA 1ZBVA 3CGNA 2RQSA 1EG3A 3TDBA 3RGCA 2ESCA 2N87A 1W9UA 1EYMA 4JFKA 4P8VA 4W9QA 1E15A 1YW5A 3WH0A 1NWTA 2KR7A 1D7JA 2XP7A 1O6WA 4ODQA 3KZ7A 2PV2A 1ZU8A 3KAHA 5AHTA 3O5RA 4S3KA 4ODLA 1HXVA 2E45A 2KFWA 3ARWA 2RSEA 3G6LA 2ZQTA 1OWQA 2RURA 2JZVA 1JNSA 1W26A 3B7XA 2XPAA 5E64A 1FFRA 3WL1A 1GPFA 4GIVA 2KE0A 3RM8A 3PR9A 4TW6A 1Q1CA 4URIA 4QZVB 4NZCA 5HW8A 4G2PA 2JMFA 4TW7A 4XAKA 4DRQA 2LGOA 1FKRA 3NTPA 4J4NA 4GLXA 1ZB5A 3FSBA 3KAFA 1B6CA 1ROUA 1KT1A 3O5PA 4MNJA 1F8AB 3ARSA 5HUAA 4L3NA 3WD4A 2YSIA 4ZPVR 4DWSA 4LAXA 1N1AA 1H0IA 1Q6UA 1HJWA 4ML4A 1R9HA 3H9RB 2O9OA 4DRIA 1FKBA 3W4RA 4NSBA 1J6YA 4ODKA 4TYOA 2F21A 4PTMA 3O5FA 1LJYA 4HARA 1FD9A 4WKFA 2DSWA 3NRKA 1M5YA 2O92A 3L4HA 3TCZA 3MDYB 2QF8A 3PQHA 4TX0A 1Y0OA 3VAWA 2DT2A 1FAPA 2DG3A 2PV1A 3CHCA 4Q22A 1VF8A 2ZQVA 4DIPA 4HBOA 5HWCA 2KI3A 2WAEA 2XP4A 3ARRA 2M1IA 1D2KA 1J4HA 4JFMA 2MLZA 1ITXA 1U79A 2WLZA 2WK2A 3O5QA 4ODNA 2ZAJA 4MPKA 3KAGA 1FLCA 1O6IA 3FSCA 3UI5A 5DO2A 1WR7A 5DITA 4ITZA 1JMQA 1JVWA 3WQVA 2DT0A 3FS8A 1XRVA 1FKIA 3IHZA 1LL7A 2DSVA 5GPGA 1W9VA 2WADA 4GGQA 1D6OA 4HBEA 4REXA 2WLYA 5HW7A 1ZCNA 4Z2KA 1ZBWA 2M3OW 3AS0A 5U47A 2BA1A 2IF4A 4LAYA 3WIJA 5DIVA 2M08A 1WB0A 3FAPA 1BKFA 1FKHA 2DG4A 4P8XA 4MTVA 1W1PA 3WD1A 4BF8A 1LG2A 2XP3A 4DRNA 4U86A 3KADA 4IQCA 2ZQSA 1NH6A 2FAPA 4JFIA 5DIUA 2YSFA 4MSPA 3WQWA 3PA7A 4JYSA 4ODOA 3O5DA 3QOKA 4C02B 5DF0A 4DRKA 3ARYA 3WD3A 4W9PA 3O5MA 4QT2A 3EY6A 2ZR5A 1UR8A 2VN1A 3RM4A 4DWSD 4DRHA 2ZR4A 1CTNA 2ZR6A 4G50A 4A0TA 4QIBA 1JNEA 3FXYA 1LG1A 4Q7NA 1NSGA 5D75A 2XP6A 1FKDA 2DT3A 4IQ2A 2MLXA 4WJXA 2Y78A 4MAVA 1FJDA 3IKDA 4J4OA 1T11A 3ODKA 1LL6A 3AS3A 3MCBB 2DK1A 4P8UA 3AS1A 3UQAA 2PBCA 4R0XA 5CQ2A 3CHDA 1ZK6A 2MLYA 1F40A 1LL4A 2PV3A 4W5UA 2PPNA 1J4IA 4TW8A 3OOBA 2DJYA 4Z2JA 1PBKA 2L2SA 1FKSA 2A3EA 4LAWA 4ODMA 3O5EA 2D9FA 1QPLA 1NWRA 1PINA 3NI6A 2DG9A 5E66A 4MNKA 4W9OA 3LKXB 5I98A 1H0GA 4Z2IA 2DWVA 1C9HA 2QRVA 3O5LA 3UI6A 1HKMA 2YSHA 1YATA 3ARTA 1FKJA 3KACA 2VCDA 4DRJA 4Z2LA 1FKLA 1FFQA 2Q5AA 2XP9A 5HW6A 4KR0B 3I6CA 3UI4A 1QPFA 2F2DA 4DH0A 1TCOC 2YBUA 2LKNA 4FN2A 2YSBA 1D7HA 2MDIA 1QZ2A 3IK8A 2ZQUA 2RUCA 4DZ2A 2MPHA 4IT6A 1GOIA 2PPOA 2KXQA 2PI6A 2KO7A 4WIWA 3WD2A 3O5GA 2AWGA 3ARVA 1RD6A 2M8JA 5E5WA 2IUZA 1SR0A 3JYJA 3RFWA 2MNTA 3M85A 4LGXA 2YSGA 1BL4A 3M7NA 1JNDA 1KT0A 1W1TA 4FAPA 1E6RA 1NMWA 1EDQA 3UQBA 4ZS6A 4P8WA 4R5EA 5J6EA 3AS2A 5B8IC 4A0UA 5JH8A 1TK7A 1OGBA 2FDMA 4L72B 2JXWA 4DWSC 2OFNA 5GQBA 2G41A 3MCBA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2K8I A;  5HWB A;  2JX8 A;  4DZ3 A;  4JFJ A;  1L1P A;  1P5Q A;  1EG4 A;  4IPX A;  2EZ5 W;  3O5O A;  2MF9 A;  4DRP A;  1Q6I A;  1Q6H A;  3CGM A;  3KAI A;  3KAB A;  3IKG A;  4O2T A;  2ITK A;  3LUO A;  2RE3 A;  2RUD A;  1D7I A;  3PRB A;  1FKK A;  1FKG A;  2XP5 A;  1FKF A;  2PPP A;  2RUQ A;  4ODR A;  3UQI A;  5HKG A;  1J4R A;  1WMV A;  3KCE A;  2F4E A;  2JV4 A;  5BXJ A;  4DRO A;  5HT1 A;  2KGJ A;  3UF8 A;  2LPV A;  2DMV A;  1ROT A;  4NNR A;  1K9Q A;  4DRM A;  3TC5 A;  1I5H W;  2UZ5 A;  4JFL A;  3GPK A;  4U85 A;  2XPB A;  4DT4 A;  2M8I A;  3O5K A;  1JNT A;  3JYM A;  2LJ4 A;  1A7X A;  2L4J A;  4N19 A;  2XP8 A;  2M2A A;  3O5I A;  3CNG A;  4QT3 A;  4LAV A;  2DK7 A;  4U84 A;  1FKT A;  3JXV A;  4MGV A;  4E5R A;  2FKE A;  3O5J A;  5HTG A;  1EQ3 A;  1K9R A;  3LE4 A;  4ODP A;  3PRD A;  1NMV A;  4TNS A;  2LAJ A;  3CGN A;  2RQS A;  1EG3 A;  3TDB A;  3RGC A;  2N87 A;  1EYM A;  4JFK A;  4W9Q A;  1YW5 A;  3WH0 A;  2KR7 A;  1D7J A;  2XP7 A;  1O6W A;  4ODQ A;  3KZ7 A;  2PV2 A;  3KAH A;  5AHT A;  3O5R A;  4ODL A;  1HXV A;  2E45 A;  2KFW A;  2RSE A;  2ZQT A;  2RUR A;  2JZV A;  1JNS A;  1W26 A;  3B7X A;  2XPA A;  4GIV A;  2KE0 A;  4TW6 A;  1Q1C A;  5HW8 A;  4G2P A;  2JMF A;  4TW7 A;  4DRQ A;  2LGO A;  1FKR A;  3NTP A;  4J4N A;  3KAF A;  1B6C A;  1ROU A;  1KT1 A;  3O5P A;  1F8A B;  5HUA A;  2YSI A;  4LAX A;  1N1A A;  1Q6U A;  1R9H A;  3H9R B;  4DRI A;  1FKB A;  1J6Y A;  4ODK A;  4TYO A;  2F21 A;  3O5F A;  1FD9 A;  3NRK A;  1M5Y A;  3L4H A;  3TCZ A;  3MDY B;  4TX0 A;  1Y0O A;  3VAW A;  1FAP A;  2DG3 A;  2PV1 A;  2ZQV A;  4DIP A;  5HWC A;  2KI3 A;  2XP4 A;  2M1I A;  1J4H A;  4JFM A;  2MLZ A;  1U79 A;  3O5Q A;  4ODN A;  2ZAJ A;  3KAG A;  3UI5 A;  1WR7 A;  5DIT A;  4ITZ A;  1JMQ A;  1JVW A;  1FKI A;  3IHZ A;  5GPG A;  4GGQ A;  1D6O A;  4REX A;  5HW7 A;  1ZCN A;  2M3O W;  2BA1 A;  2IF4 A;  4LAY A;  5DIV A;  2M08 A;  3FAP A;  1BKF A;  1FKH A;  2DG4 A;  4BF8 A;  2XP3 A;  4DRN A;  4U86 A;  3KAD A;  4IQC A;  2ZQS A;  2FAP A;  4JFI A;  5DIU A;  2YSF A;  4MSP A;  3PA7 A;  4JYS A;  4ODO A;  3O5D A;  4C02 B;  4DRK A;  4W9P A;  3O5M A;  4QT2 A;  3EY6 A;  2ZR5 A;  2VN1 A;  4DRH A;  2ZR4 A;  2ZR6 A;  4G50 A;  4QIB A;  1NSG A;  5D75 A;  2XP6 A;  1FKD A;  4IQ2 A;  2MLX A;  2Y78 A;  1FJD A;  3IKD A;  4J4O A;  1T11 A;  3ODK A;  2DK1 A;  3UQA A;  2PBC A;  4R0X A;  5CQ2 A;  1ZK6 A;  2MLY A;  1F40 A;  2PV3 A;  2PPN A;  1J4I A;  4TW8 A;  3OOB A;  2DJY A;  1PBK A;  2L2S A;  4ODM A;  1FKS A;  4LAW A;  3O5E A;  2D9F A;  1QPL A;  1PIN A;  3NI6 A;  2DG9 A;  4W9O A;  5I98 A;  2DWV A;  1C9H A;  3O5L A;  3UI6 A;  2YSH A;  1YAT A;  3KAC A;  1FKJ A;  2VCD A;  4DRJ A;  1FKL A;  2Q5A A;  2XP9 A;  5HW6 A;  3I6C A;  3UI4 A;  1QPF A;  2F2D A;  4DH0 A;  1TCO C;  2LKN A;  4FN2 A;  2YSB A;  1D7H A;  2MDI A;  1QZ2 A;  3IK8 A;  2ZQU A;  2RUC A;  4DZ2 A;  2MPH A;  2PPO A;  2KXQ A;  2KO7 A;  3O5G A;  2AWG A;  2M8J A;  3JYJ A;  3RFW A;  2MNT A;  3M85 A;  2YSG A;  1BL4 A;  3M7N A;  1KT0 A;  4FAP A;  1NMW A;  3UQB A;  5J6E A;  5B8I C;  1TK7 A;  2JXW A;  2OFN A; 
#chains in the Genus database with same CATH topology
 5E62 A;  2K8I A;  5HWB A;  3CH9 A;  2JX8 A;  4DZ3 A;  2A3C A;  3ARZ A;  4MNL A;  2DSU A;  3B9E A;  4JFJ A;  1IX5 A;  1L1P A;  1P5Q A;  3B8S A;  1TR8 A;  4Z2G A;  3PRA A;  1OGG A;  1EG4 A;  4IPX A;  2EZ5 W;  3LKX A;  1E6Z A;  4UDM A;  3ARO A;  3O5O A;  2A3B A;  3CHF A;  2DT1 A;  1TFV A;  2MF9 A;  4DRP A;  1W9P A;  1Q6I A;  1KFW A;  1Q6H A;  3GU0 A;  3CGM A;  3ARX A;  3KAI A;  4Z2H A;  1ZBC A;  3KAB A;  3IKG A;  4O2T A;  1E44 A;  1E6N A;  2ITK A;  3CZ8 A;  3ARQ A;  3LUO A;  2RE3 A;  2RUD A;  1D7I A;  1K9T A;  3PRB A;  1FKK A;  2DSZ A;  1FKG A;  2XP5 A;  1FKF A;  3MQH A;  1X6N A;  1HKK A;  3WL0 A;  2PPP A;  3BXW A;  2WM0 A;  3RME A;  2RUQ A;  4ODR A;  3UQI A;  1E9L A;  2A3A A;  2Y8N B;  3B9D A;  5HKG A;  1J4R A;  1WMV A;  1GUV A;  3KCE A;  1ZL1 A;  2F4E A;  4IT4 A;  1EIB A;  3B9A A;  5HBF A;  1WAW A;  2JV4 A;  5BXJ A;  2AOS A;  5HT1 A;  2KGJ A;  4DRO A;  3UF8 A;  1NWS A;  1X6L A;  2LPV A;  4KQZ A;  3G6M A;  1E6P A;  2DMV A;  1WNO A;  4MNM A;  1SYT A;  1NWU A;  2B5U B;  1ROT A;  4NNR A;  1K9Q A;  4DRM A;  3TC5 A;  1I5H W;  2OWO A;  2UZ5 A;  4JFL A;  2PN0 A;  1W1Y A;  2EUL A;  3CHE A;  4U85 A;  3GPK A;  3ARU A;  2XPB A;  3RM9 A;  4DT4 A;  2M8I A;  4ZPW R;  1HKJ A;  5DEZ A;  3O5K A;  1JNT A;  1XHG A;  2G8Z A;  1HKI A;  2OLH A;  3JYM A;  2LJ4 A;  1A7X A;  2L4J A;  4N19 A;  3WKZ A;  3AQU A;  2XP8 A;  4ZPT R;  4AY1 A;  3OA5 A;  2M2A A;  3O5I A;  1ZBK A;  3CNG A;  4QT3 A;  3ARP A;  2YBT A;  4WKH A;  4S3J A;  4LAV A;  2DK7 A;  4U84 A;  1LQ0 A;  1UR9 A;  1RP5 A;  1FKT A;  4DWS B;  3WD0 A;  1EHN A;  4WKA A;  1HJV A;  3JXV A;  4E5R A;  2FKE A;  3O5J A;  4MGV A;  5HTG A;  3MQG A;  1EQ3 A;  3ALF A;  4WK9 A;  2YAJ B;  1K9R A;  3LE4 A;  1HJX A;  2B31 A;  4ODP A;  3FY1 A;  1W1V A;  3PRD A;  1NMV A;  3ALG A;  5E65 A;  4TNS A;  5GPR A;  2LAJ A;  2DPE A;  1ZBV A;  3CGN A;  2RQS A;  1EG3 A;  3TDB A;  3RGC A;  2ESC A;  2N87 A;  1W9U A;  1EYM A;  4JFK A;  4P8V A;  4W9Q A;  1E15 A;  1YW5 A;  3WH0 A;  1NWT A;  2KR7 A;  1D7J A;  2XP7 A;  1O6W A;  4ODQ A;  3KZ7 A;  2PV2 A;  1ZU8 A;  3KAH A;  5AHT A;  3O5R A;  4S3K A;  4ODL A;  1HXV A;  2E45 A;  2KFW A;  3ARW A;  2RSE A;  3G6L A;  2ZQT A;  1OWQ A;  2RUR A;  2JZV A;  1JNS A;  1W26 A;  3B7X A;  2XPA A;  5E64 A;  1FFR A;  3WL1 A;  1GPF A;  4GIV A;  2KE0 A;  3RM8 A;  3PR9 A;  4TW6 A;  1Q1C A;  4URI A;  4QZV B;  4NZC A;  5HW8 A;  4G2P A;  2JMF A;  4TW7 A;  4XAK A;  4DRQ A;  2LGO A;  1FKR A;  3GTY X;  3NTP A;  4J4N A;  4GLX A;  1ZB5 A;  3FSB A;  3KAF A;  1B6C A;  1ROU A;  1KT1 A;  3O5P A;  4MNJ A;  1F8A B;  3ARS A;  5HUA A;  4L3N A;  3WD4 A;  2YSI A;  4ZPV R;  4DWS A;  4LAX A;  1N1A A;  1H0I A;  1Q6U A;  1HJW A;  4ML4 A;  1R9H A;  3H9R B;  2O9O A;  4DRI A;  1FKB A;  3W4R A;  4NSB A;  1J6Y A;  4ODK A;  4TYO A;  2F21 A;  4PTM A;  3O5F A;  1LJY A;  3EIP A;  4HAR A;  1FD9 A;  4WKF A;  2DSW A;  3NRK A;  1M5Y A;  2O92 A;  3L4H A;  3TCZ A;  3MDY B;  2QF8 A;  3PQH A;  4TX0 A;  1Y0O A;  3VAW A;  2DT2 A;  1FAP A;  2DG3 A;  2PV1 A;  3CHC A;  2F23 A;  4Q22 A;  1JCH B;  1VF8 A;  2ZQV A;  4DIP A;  4HBO A;  5HWC A;  2KI3 A;  2WAE A;  2XP4 A;  3ARR A;  2M1I A;  1D2K A;  1J4H A;  4JFM A;  2MLZ A;  1ITX A;  1U79 A;  2WLZ A;  2WK2 A;  1GRJ A;  3O5Q A;  4ODN A;  2ZAJ A;  4MPK A;  3KAG A;  1FLC A;  1O6I A;  3FSC A;  3UI5 A;  5DO2 A;  1WR7 A;  5DIT A;  4ITZ A;  1JMQ A;  1JVW A;  3WQV A;  2DT0 A;  3FS8 A;  1XRV A;  1FKI A;  3IHZ A;  1LL7 A;  2DSV A;  5GPG A;  1W9V A;  2WAD A;  4GGQ A;  1D6O A;  4HBE A;  4REX A;  2WLY A;  5HW7 A;  1ZCN A;  4Z2K A;  1ZBW A;  2M3O W;  3AS0 A;  5U47 A;  2BA1 A;  2IF4 A;  4LAY A;  3WIJ A;  3BMB A;  5DIV A;  2M08 A;  1WB0 A;  3FAP A;  1BKF A;  1FKH A;  2DG4 A;  4P8X A;  4MTV A;  1W1P A;  3WD1 A;  4BF8 A;  1LG2 A;  2XP3 A;  4DRN A;  4U86 A;  3KAD A;  4IQC A;  2ZQS A;  1NH6 A;  2FAP A;  4JFI A;  5DIU A;  2YSF A;  4MSP A;  3WQW A;  3PA7 A;  4JYS A;  4ODO A;  3O5D A;  3QOK A;  4C02 B;  5DF0 A;  4DRK A;  3ARY A;  3WD3 A;  4W9P A;  3O5M A;  4QT2 A;  3EY6 A;  2ZR5 A;  1UR8 A;  2VN1 A;  3RM4 A;  4DWS D;  4DRH A;  2P4V A;  2ZR4 A;  1CTN A;  2ZR6 A;  4G50 A;  4A0T A;  4QIB A;  1JNE A;  3FXY A;  1LG1 A;  4Q7N A;  1NSG A;  5D75 A;  2XP6 A;  1FKD A;  2DT3 A;  4IQ2 A;  2MLX A;  4WJX A;  2Y78 A;  4MAV A;  1FJD A;  3IKD A;  4J4O A;  1T11 A;  3ODK A;  1LL6 A;  3AS3 A;  3MCB B;  2DK1 A;  4P8U A;  3AS1 A;  3UQA A;  2PBC A;  4R0X A;  5CQ2 A;  3CHD A;  1ZK6 A;  2MLY A;  1F40 A;  1LL4 A;  2PV3 A;  4W5U A;  2PPN A;  1J4I A;  4TW8 A;  3OOB A;  2DJY A;  4Z2J A;  1PBK A;  2L2S A;  1FKS A;  2A3E A;  4LAW A;  4ODM A;  3O5E A;  2D9F A;  1QPL A;  1NWR A;  1PIN A;  3NI6 A;  2DG9 A;  5E66 A;  4MNK A;  4W9O A;  3LKX B;  5I98 A;  1H0G A;  4Z2I A;  2DWV A;  1C9H A;  2QRV A;  3O5L A;  3UI6 A;  1HKM A;  2YSH A;  1YAT A;  3ART A;  1FKJ A;  2ETN A;  2VCD A;  3KAC A;  4DRJ A;  4Z2L A;  1FKL A;  1FFQ A;  2Q5A A;  2XP9 A;  5HW6 A;  4KR0 B;  3I6C A;  3UI4 A;  1QPF A;  2F2D A;  4DH0 A;  1TCO C;  2YBU A;  2LKN A;  4FN2 A;  2YSB A;  1D7H A;  2MDI A;  1QZ2 A;  3IK8 A;  2ZQU A;  2RUC A;  4DZ2 A;  2MPH A;  4IT6 A;  1GOI A;  2PPO A;  2KXQ A;  2PI6 A;  2KO7 A;  4WIW A;  3WD2 A;  3O5G A;  2AWG A;  3ARV A;  1RD6 A;  2M8J A;  5E5W A;  2IUZ A;  1SR0 A;  3JYJ A;  3RFW A;  2MNT A;  3M85 A;  4LGX A;  2YSG A;  1BL4 A;  3M7N A;  1JND A;  1KT0 A;  1W1T A;  4FAP A;  1E6R A;  1NMW A;  1EDQ A;  3UQB A;  4ZS6 A;  4P8W A;  4R5E A;  5J6E A;  3AS2 A;  5B8I C;  4A0U A;  5JH8 A;  1TK7 A;  1OGB A;  2FDM A;  4L72 B;  2JXW A;  4DWS C;  2OFN A;  5GQB A;  2G41 A;  3MCB A; 
#chains in the Genus database with same CATH homology
 5E62 A;  2K8I A;  5HWB A;  3CH9 A;  2JX8 A;  4DZ3 A;  2A3C A;  3ARZ A;  4MNL A;  2DSU A;  3B9E A;  4JFJ A;  1IX5 A;  1L1P A;  1P5Q A;  3B8S A;  1TR8 A;  4Z2G A;  3PRA A;  1OGG A;  1EG4 A;  4IPX A;  2EZ5 W;  3LKX A;  1E6Z A;  3ARO A;  3O5O A;  2A3B A;  3CHF A;  2DT1 A;  1TFV A;  2MF9 A;  4DRP A;  1W9P A;  1Q6I A;  1KFW A;  1Q6H A;  3CGM A;  3ARX A;  3KAI A;  4Z2H A;  1ZBC A;  3KAB A;  3IKG A;  4O2T A;  1E6N A;  2ITK A;  3CZ8 A;  3ARQ A;  3LUO A;  2RE3 A;  2RUD A;  1D7I A;  1K9T A;  3PRB A;  1FKK A;  2DSZ A;  1FKG A;  2XP5 A;  1FKF A;  3MQH A;  1X6N A;  1HKK A;  3WL0 A;  2PPP A;  3BXW A;  2WM0 A;  3RME A;  2RUQ A;  4ODR A;  3UQI A;  1E9L A;  2A3A A;  2Y8N B;  3B9D A;  5HKG A;  1J4R A;  1WMV A;  1GUV A;  3KCE A;  1ZL1 A;  2F4E A;  4IT4 A;  1EIB A;  3B9A A;  5HBF A;  1WAW A;  2JV4 A;  5BXJ A;  2AOS A;  5HT1 A;  2KGJ A;  4DRO A;  3UF8 A;  1NWS A;  1X6L A;  2LPV A;  4KQZ A;  3G6M A;  1E6P A;  2DMV A;  1WNO A;  4MNM A;  1SYT A;  1NWU A;  1ROT A;  4NNR A;  1K9Q A;  4DRM A;  3TC5 A;  1I5H W;  2OWO A;  2UZ5 A;  4JFL A;  1W1Y A;  3CHE A;  3GPK A;  4U85 A;  3ARU A;  2XPB A;  3RM9 A;  4DT4 A;  2M8I A;  4ZPW R;  1HKJ A;  5DEZ A;  3O5K A;  1JNT A;  1XHG A;  2G8Z A;  1HKI A;  2OLH A;  3JYM A;  2LJ4 A;  1A7X A;  2L4J A;  4N19 A;  3WKZ A;  3AQU A;  2XP8 A;  4ZPT R;  4AY1 A;  3OA5 A;  2M2A A;  3O5I A;  1ZBK A;  3CNG A;  4QT3 A;  3ARP A;  2YBT A;  4WKH A;  4S3J A;  4LAV A;  2DK7 A;  4U84 A;  1LQ0 A;  1UR9 A;  1RP5 A;  1FKT A;  4DWS B;  3WD0 A;  1EHN A;  4WKA A;  1HJV A;  3JXV A;  4E5R A;  2FKE A;  3O5J A;  4MGV A;  5HTG A;  3MQG A;  1EQ3 A;  3ALF A;  4WK9 A;  2YAJ B;  1K9R A;  3LE4 A;  1HJX A;  2B31 A;  4ODP A;  3FY1 A;  1W1V A;  3PRD A;  1NMV A;  3ALG A;  5E65 A;  4TNS A;  5GPR A;  2LAJ A;  2DPE A;  1ZBV A;  3CGN A;  2RQS A;  1EG3 A;  3TDB A;  3RGC A;  2ESC A;  2N87 A;  1W9U A;  1EYM A;  4JFK A;  4P8V A;  4W9Q A;  1E15 A;  1YW5 A;  3WH0 A;  1NWT A;  2KR7 A;  1D7J A;  2XP7 A;  1O6W A;  4ODQ A;  3KZ7 A;  2PV2 A;  1ZU8 A;  3KAH A;  5AHT A;  3O5R A;  4S3K A;  4ODL A;  1HXV A;  2E45 A;  2KFW A;  3ARW A;  2RSE A;  3G6L A;  2ZQT A;  1OWQ A;  2RUR A;  2JZV A;  1JNS A;  1W26 A;  3B7X A;  2XPA A;  5E64 A;  1FFR A;  3WL1 A;  1GPF A;  4GIV A;  2KE0 A;  3RM8 A;  3PR9 A;  4TW6 A;  1Q1C A;  4URI A;  4QZV B;  4NZC A;  5HW8 A;  4G2P A;  2JMF A;  4TW7 A;  4XAK A;  4DRQ A;  2LGO A;  1FKR A;  3NTP A;  4J4N A;  4GLX A;  1ZB5 A;  3FSB A;  3KAF A;  1B6C A;  1ROU A;  1KT1 A;  3O5P A;  4MNJ A;  1F8A B;  3ARS A;  5HUA A;  4L3N A;  3WD4 A;  2YSI A;  4ZPV R;  4DWS A;  4LAX A;  1N1A A;  1H0I A;  1Q6U A;  1HJW A;  4ML4 A;  1R9H A;  3H9R B;  2O9O A;  4DRI A;  1FKB A;  3W4R A;  4NSB A;  1J6Y A;  4ODK A;  4TYO A;  2F21 A;  4PTM A;  3O5F A;  1LJY A;  4HAR A;  1FD9 A;  4WKF A;  2DSW A;  3NRK A;  1M5Y A;  2O92 A;  3L4H A;  3TCZ A;  3MDY B;  2QF8 A;  3PQH A;  4TX0 A;  1Y0O A;  3VAW A;  2DT2 A;  1FAP A;  2DG3 A;  2PV1 A;  3CHC A;  4Q22 A;  1VF8 A;  2ZQV A;  4DIP A;  4HBO A;  5HWC A;  2KI3 A;  2WAE A;  2XP4 A;  3ARR A;  2M1I A;  1D2K A;  1J4H A;  4JFM A;  2MLZ A;  1ITX A;  1U79 A;  2WLZ A;  2WK2 A;  3O5Q A;  4ODN A;  2ZAJ A;  4MPK A;  3KAG A;  1FLC A;  1O6I A;  3FSC A;  3UI5 A;  5DO2 A;  1WR7 A;  5DIT A;  4ITZ A;  1JMQ A;  1JVW A;  3WQV A;  2DT0 A;  3FS8 A;  1XRV A;  1FKI A;  3IHZ A;  1LL7 A;  2DSV A;  5GPG A;  1W9V A;  2WAD A;  4GGQ A;  1D6O A;  4HBE A;  4REX A;  2WLY A;  5HW7 A;  1ZCN A;  4Z2K A;  1ZBW A;  2M3O W;  3AS0 A;  5U47 A;  2BA1 A;  2IF4 A;  4LAY A;  3WIJ A;  5DIV A;  2M08 A;  1WB0 A;  3FAP A;  1BKF A;  1FKH A;  2DG4 A;  4P8X A;  4MTV A;  1W1P A;  3WD1 A;  4BF8 A;  1LG2 A;  2XP3 A;  4DRN A;  4U86 A;  3KAD A;  4IQC A;  2ZQS A;  1NH6 A;  2FAP A;  4JFI A;  5DIU A;  2YSF A;  4MSP A;  3WQW A;  3PA7 A;  4JYS A;  4ODO A;  3O5D A;  3QOK A;  4C02 B;  5DF0 A;  4DRK A;  3ARY A;  3WD3 A;  4W9P A;  3O5M A;  4QT2 A;  3EY6 A;  2ZR5 A;  1UR8 A;  2VN1 A;  3RM4 A;  4DWS D;  4DRH A;  2ZR4 A;  1CTN A;  2ZR6 A;  4G50 A;  4A0T A;  4QIB A;  1JNE A;  3FXY A;  1LG1 A;  4Q7N A;  1NSG A;  5D75 A;  2XP6 A;  1FKD A;  2DT3 A;  4IQ2 A;  2MLX A;  4WJX A;  2Y78 A;  4MAV A;  1FJD A;  3IKD A;  4J4O A;  1T11 A;  3ODK A;  1LL6 A;  3AS3 A;  3MCB B;  2DK1 A;  4P8U A;  3AS1 A;  3UQA A;  2PBC A;  4R0X A;  5CQ2 A;  3CHD A;  1ZK6 A;  2MLY A;  1F40 A;  1LL4 A;  2PV3 A;  4W5U A;  2PPN A;  1J4I A;  4TW8 A;  3OOB A;  2DJY A;  4Z2J A;  1PBK A;  2L2S A;  1FKS A;  2A3E A;  4LAW A;  4ODM A;  3O5E A;  2D9F A;  1QPL A;  1NWR A;  1PIN A;  3NI6 A;  2DG9 A;  5E66 A;  4MNK A;  4W9O A;  3LKX B;  5I98 A;  1H0G A;  4Z2I A;  2DWV A;  1C9H A;  2QRV A;  3O5L A;  3UI6 A;  1HKM A;  2YSH A;  1YAT A;  3ART A;  1FKJ A;  3KAC A;  2VCD A;  4DRJ A;  4Z2L A;  1FKL A;  1FFQ A;  2Q5A A;  2XP9 A;  5HW6 A;  4KR0 B;  3I6C A;  3UI4 A;  1QPF A;  2F2D A;  4DH0 A;  1TCO C;  2YBU A;  2LKN A;  4FN2 A;  2YSB A;  1D7H A;  2MDI A;  1QZ2 A;  3IK8 A;  2ZQU A;  2RUC A;  4DZ2 A;  2MPH A;  4IT6 A;  1GOI A;  2PPO A;  2KXQ A;  2PI6 A;  2KO7 A;  4WIW A;  3WD2 A;  3O5G A;  2AWG A;  3ARV A;  1RD6 A;  2M8J A;  5E5W A;  2IUZ A;  1SR0 A;  3JYJ A;  3RFW A;  2MNT A;  3M85 A;  4LGX A;  2YSG A;  1BL4 A;  3M7N A;  1JND A;  1KT0 A;  1W1T A;  4FAP A;  1E6R A;  1NMW A;  1EDQ A;  3UQB A;  4ZS6 A;  4P8W A;  4R5E A;  5J6E A;  3AS2 A;  5B8I C;  4A0U A;  5JH8 A;  1TK7 A;  1OGB A;  2FDM A;  4L72 B;  2JXW A;  4DWS C;  2OFN A;  5GQB A;  2G41 A;  3MCB A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...