2ZQUA

Crystal structure of a mutant pin1 peptidyl-prolyl cis-trans isomerase
Total Genus 42
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
42
sequence length
158
structure length
153
Chain Sequence
KLPPGWEKRMSRSSGRVYYFNHITNASQAERPSGGKNGQGEPARVRCSHLLVKHSQSRRPSSWRQEKITRTKEEALELINGYIQKIKSGEEDFESLASQFSDCSSAKARGDLGAFSRGQMQKPFEDASFALRTGEMSGPVFTDSGIHIILRTE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Peptidyl-prolyl cis-trans isomerase NIMA-interacting 1
publication title Structural studies on PIN1 mutants
rcsb
source organism Homo sapiens
molecule tags Isomerase
total genus 42
structure length 153
sequence length 158
ec nomenclature ec 5.2.1.8: Peptidylprolyl isomerase.
pdb deposition date 2008-08-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00397 WW WW domain
A PF00639 Rotamase PPIC-type PPIASE domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.20.70.10 Mainly Beta Single Sheet Ubiquitin Ligase Nedd4; Chain: W; Ubiquitin Ligase Nedd4; Chain: W; 2zquA01
3.10.50.40 Alpha Beta Roll Chitinase A; domain 3 Chitinase A; domain 3 2zquA02
5D75A 3KCEA 3I6CA 4TNSA 1FKRA 4DRNA 1KT0A 5B8IC 5HKGA 2F21A 2JX8A 1T11A 3FAPA 3KACA 4IQ2A 2YSIA 3MDYB 2F4EA 2XP6A 1PINA 1FAPA 1FKIA 4GGQA 1M5YA 4MSPA 2VN1A 2L4JA 4ODMA 5AHTA 1FKHA 1F40A 4U85A 2FAPA 2ZR6A 3O5RA 2PPOA 3UQBA 4DRIA 5I98A 1P5QA 2XPBA 2KGJA 2LJ4A 2MLYA 3KZ7A 4LAVA 3RGCA 1FKSA 2DG9A 2LKNA 1D7JA 2LAJA 5HUAA 2YSFA 2KXQA 4FAPA 3KADA 5GPGA 1TCOC 2DWVA 3OOBA 3M85A 3KAIA 2DG3A 2M8JA 3TC5A 2M1IA 1L1PA 2EZ5W 4TW6A 3PRBA 2RURA 5J6EA 4REXA 3IKDA 5CQ2A 4BF8A 1FKTA 4O2TA 2UZ5A 1D7IA 3UI5A 3O5GA 3LE4A 1HXVA 5HW7A 1EG3A 4GIVA 1TK7A 1J4IA 3KAFA 3TDBA 4U86A 2MDIA 3WH0A 1K9QA 4ODPA 4TYOA 3GPKA 3JYMA 2PV1A 4TW8A 2DJYA 2JZVA 3O5JA 3KAGA 3B7XA 1QZ2A 2ZQSA 1O6WA 3TCZA 4DRPA 2XP9A 1JVWA 3O5IA 4W9QA 4ODLA 1NMVA 4DRKA 1FKLA 1NMWA 2AWGA 5HT1A 1EG4A 4LAYA 4R0XA 2VCDA 2PPNA 1WMVA 2KO7A 2XP4A 1ZCNA 3KABA 4JFJA 5HWCA 1J6YA 4DZ3A 3KAHA 1BL4A 1QPLA 5HW8A 3CNGA 4MGVA 2KR7A 2BA1A 1FKJA 2Y78A 4IQCA 2DK7A 2MF9A 1F8AB 1Q6HA 2M08A 2PBCA 1J4HA 3O5OA 2DMVA 3EY6A 1JNSA 5DIVA 2F2DA 1FD9A 3O5KA 2DK1A 2XP5A 4ODNA 2ITKA 2YSBA 2ZQUA 2MNTA 4QT2A 5HWBA 3NTPA 4QIBA 2K8IA 2JMFA 3UF8A 4DH0A 2MPHA 1FKKA 4U84A 3PA7A 3UI6A 2MLZA 2XP3A 1U79A 4IPXA 1BKFA 2LPVA 1W26A 3VAWA 2D9FA 1Q6UA 4DZ2A 3RFWA 1EYMA 3H9RB 1N1AA 3O5MA 2ZQTA 4FN2A 3O5FA 2ZR5A 1B6CA 2RUQA 4TW7A 4LAXA 2YSHA 3IKGA 4DRHA 4J4NA 4DRMA 4JFMA 4W9PA 2FKEA 4ITZA 2ZAJA 4ODQA 3JXVA 1Y0OA 2PV3A 1YW5A 4G50A 4DT4A 1EQ3A 5HW6A 1FKBA 4JFKA 4W9OA 2PV2A 3CGNA 4JFIA 2E45A 1J4RA 4QT3A 3IHZA 2LGOA 3UI4A 1FKGA 1K9RA 2JV4A 5HTGA 1I5HW 2RE3A 1FJDA 2ZR4A 4DRJA 3UQAA 2IF4A 3NRKA 2XPAA 2KFWA 1JNTA 4JYSA 3O5EA 3NI6A 4N19A 2XP8A 4G2PA 4DROA 3L4HA 2ZQVA 4E5RA 3O5LA 3M7NA 4ODKA 2KE0A 2DG4A 3JYJA 1PBKA 1WR7A 1C9HA 3O5PA 4DIPA 1D6OA 1ZK6A 1YATA 1A7XA 1NSGA 1ROUA 2RUCA 4LAWA 1FKFA 4DRQA 2RSEA 4TX0A 1D7HA 3ODKA 1QPFA 3IK8A 1FKDA 2RUDA 1Q1CA 2KI3A 4J4OA 1JMQA 3LUOA 4C02B 4ODOA 3UQIA 2YSGA 4JFLA 1R9HA 1Q6IA 1KT1A 2RQSA 2XP7A 1ROTA 2M8IA 5BXJA 3CGMA 2OFNA 2L2SA 5DITA 5DIUA 2M2AA 2MLXA 4ODRA 3O5DA 2Q5AA 3PRDA 2PPPA 2N87A 2JXWA 2M3OW 4NNRA 3O5QA
chains in the Genus database with same CATH superfamily
2WK2A 3WIJA 5D75A 3KCEA 2YAJB 1SYTA 3I6CA 4TNSA 1FKRA 2DT3A 3ARTA 4DRNA 3CHFA 1KT0A 2G8ZA 5B8IC 3AS0A 5HKGA 2F21A 2JX8A 4MNLA 1T11A 3FAPA 3KACA 4IQ2A 2YSIA 3MDYB 2F4EA 2XP6A 1PINA 3GTYX 1FAPA 4DWSB 1FKIA 4Z2IA 5E62A 3ALFA 4GGQA 1M5YA 4MSPA 2VN1A 3WD0A 2L4JA 4ODMA 5AHTA 4DWSD 1FKHA 4MNMA 1F40A 4U85A 2FAPA 2ZR6A 1ZL1A 3O5RA 3B9EA 4Z2HA 3QOKA 2PPOA 1ZBKA 3UQBA 4DRIA 5I98A 1P5QA 2XPBA 2KGJA 2LJ4A 2MLYA 1LL4A 4MNJA 3KZ7A 1LQ0A 4LAVA 3RGCA 1FKSA 2DG9A 2LKNA 1D7JA 2LAJA 5HUAA 2YSFA 2KXQA 1LG2A 4LGXA 4FAPA 2ESCA 3KADA 1O6IA 5GPGA 1E44A 2DWVA 1TCOC 4ZPWR 2QRVA 3ARVA 3OOBA 3M85A 3KAIA 2DG3A 2M8JA 3TC5A 2IUZA 2M1IA 4MTVA 4DWSA 1L1PA 2EZ5W 4TW6A 3CHEA 1W1PA 3AROA 3PRBA 2RURA 5J6EA 1E6PA 5DF0A 3WQWA 2A3CA 4IT6A 1GOIA 4REXA 3FXYA 3IKDA 2QF8A 5CQ2A 3WD4A 1FKTA 4BF8A 4ML4A 4O2TA 4P8WA 2UZ5A 3RM9A 1D7IA 3UI5A 3O5GA 3LE4A 5U47A 1HXVA 5HW7A 2OLHA 1EG3A 3PRAA 1TK7A 1J4IA 4GIVA 3CZ8A 3KAFA 3TDBA 3G6LA 4HBEA 1XRVA 4U86A 2ETNA 3WD3A 1LJYA 2MDIA 3WQVA 3WH0A 1K9QA 1E6ZA 4ODPA 4TYOA 3GPKA 3JYMA 2PV1A 4TW8A 2DJYA 2JZVA 3O5JA 3KAGA 3B7XA 1QZ2A 5GPRA 4PTMA 4Z2LA 2ZQSA 1O6WA 1D2KA 4MAVA 3TCZA 4DRPA 3GU0A 2XP9A 1JVWA 1VF8A 3O5IA 4W9QA 1NWTA 3CHDA 2O9OA 4ODLA 1NMVA 4DRKA 1ITXA 1FKLA 1NMWA 2AWGA 2WLZA 1OGBA 4KR0B 5HT1A 5DO2A 5E65A 2WAEA 1HJVA 1EG4A 4ZPVR 4LAYA 2DSZA 2WADA 4P8UA 4R0XA 5E64A 2VCDA 2PPNA 3WKZA 1WMVA 2KO7A 4S3KA 1GUVA 2XP4A 3ARQA 1ZCNA 3KABA 4IT4A 1E9LA 3FY1A 4JFJA 5HWCA 1FFQA 3LKXB 4DZ3A 1J6YA 4WKAA 3KAHA 3CHCA 1BL4A 1QPLA 5HW8A 3CNGA 1W1TA 4GLXA 4P8XA 4MGVA 2KR7A 1JNEA 2BA1A 2DT0A 1LG1A 3PQHA 3EIPA 2WLYA 1FKJA 2Y78A 4IQCA 3W4RA 2DK7A 2MF9A 1F8AB 3AS2A 1Q6HA 2M08A 2PBCA 4Q22A 1J4HA 3O5OA 2DMVA 3EY6A 4P8VA 3WL1A 1HKMA 4HBOA 3B8SA 1JNSA 3ARUA 5DIVA 2F2DA 1FD9A 3O5KA 2DK1A 2XP5A 1JCHB 4ODNA 4NSBA 2ITKA 3B9DA 2YSBA 2ZQUA 3ARPA 1TR8A 4UDMA 2MNTA 4QT2A 4MNKA 5HWBA 1NH6A 2B31A 3NTPA 4QIBA 2K8IA 2JMFA 3UF8A 4Z2GA 3WL0A 3LKXA 3BMBA 1FLCA 2MPHA 4DH0A 1W9VA 1FKKA 4U84A 3PA7A 4WK9A 3UI6A 2MLZA 2PN0A 2XP3A 1U79A 3ARWA 4IPXA 1BKFA 2LPVA 1XHGA 1W26A 3CH9A 1E6RA 3ARSA 1ZBVA 3BXWA 3OA5A 4L3NA 3VAWA 2O92A 4XAKA 1E15A 2D9FA 1Q6UA 1JNDA 4Z2JA 4DZ2A 3RFWA 1EYMA 3H9RB 1CTNA 1HKJA 1N1AA 1H0GA 3O5MA 2ZQTA 4FN2A 5JH8A 3O5FA 5E5WA 4QZVB 2ZR5A 1B6CA 2RUQA 3MQHA 1TFVA 4TW7A 4LAXA 2YSHA 5DEZA 2B5UB 2YBUA 2DSWA 3IKGA 4DRHA 1LL7A 4J4NA 3ARXA 4DRMA 5HBFA 4JFMA 4Z2KA 4W9PA 4DWSC 3WD1A 1K9TA 2FKEA 4ITZA 2ZAJA 2DT1A 4ODQA 1UR9A 3JXVA 1EDQA 1Y0OA 2PV3A 3ALGA 1EHNA 3ARYA 1YW5A 4G50A 1FFRA 1ZU8A 4DT4A 1EQ3A 5HW6A 1FKBA 1ZBWA 4JFKA 4W9OA 1HKIA 3MQGA 2PV2A 3FS8A 3CGNA 4JFIA 4MPKA 2E45A 1J4RA 1WNOA 4QT3A 4URIA 3IHZA 2LGOA 3UI4A 4ZPTR 1FKGA 1W9UA 1K9RA 2JV4A 5HTGA 1I5HW 2YBTA 2RE3A 1NWRA 1X6LA 1FJDA 2ZR4A 4Q7NA 2DT2A 4DRJA 4L72B 3UQAA 2IF4A 2F23A 3NRKA 2XPAA 2G41A 1E6NA 3PR9A 1NWUA 2DSUA 2KFWA 1JNTA 4JYSA 3O5EA 2A3AA 1ZB5A 3NI6A 4N19A 2XP8A 1KFWA 4G2PA 4DROA 4HARA 2DSVA 3L4HA 1W1VA 3MCBB 2ZQVA 1UR8A 1WB0A 3ARZA 4E5RA 1WAWA 3O5LA 3M7NA 2EULA 4ODKA 2KE0A 3ARRA 2DG4A 3JYJA 4WIWA 1PBKA 1WR7A 5E66A 1C9HA 1HJWA 3B9AA 3RMEA 3O5PA 2P4VA 4DIPA 1D6OA 1NWSA 1ZK6A 1YATA 1A7XA 1NSGA 4R5EA 1ROUA 1ZBCA 1OGGA 1IX5A 2RUCA 4LAWA 3WD2A 1SR0A 1FKFA 1W9PA 3AS3A 4DRQA 2RSEA 3G6MA 2FDMA 1D7HA 1EIBA 1H0IA 4TX0A 3ODKA 1QPFA 3IK8A 1X6NA 1FKDA 3RM8A 2RUDA 3AS1A 1Q1CA 1HKKA 2KI3A 2Y8NB 4J4OA 1JMQA 3LUOA 4C02B 3FSBA 4ODOA 3UQIA 2YSGA 3RM4A 4JFLA 4A0UA 4A0TA 1R9HA 5GQBA 3MCBA 1W1YA 1Q6IA 1KT1A 2RQSA 2XP7A 1OWQA 1RP5A 2M8IA 1ROTA 4WKFA 5BXJA 3CGMA 2OFNA 2L2SA 5DITA 4S3JA 2A3BA 5DIUA 1HJXA 2PI6A 2M2AA 2AOSA 4ZS6A 4W5UA 3FSCA 4WKHA 2MLXA 4NZCA 2DPEA 4ODRA 4AY1A 3O5DA 2Q5AA 1GPFA 1LL6A 1GRJA 2OWOA 3PRDA 2PPPA 2N87A 1RD6A 2JXWA 2WM0A 4WJXA 2M3OW 3AQUA 4NNRA 4KQZA 2A3EA 3O5QA
chains in the Genus database with same CATH topology
2WK2A 3WIJA 5D75A 3KCEA 2YAJB 1SYTA 3I6CA 4TNSA 1FKRA 2DT3A 3ARTA 4DRNA 3CHFA 1KT0A 2G8ZA 5B8IC 3AS0A 5HKGA 2F21A 2JX8A 4MNLA 1T11A 3FAPA 3KACA 4IQ2A 2YSIA 3MDYB 2F4EA 2XP6A 1PINA 1FAPA 4DWSB 1FKIA 4Z2IA 5E62A 3ALFA 4GGQA 1M5YA 4MSPA 2VN1A 3WD0A 2L4JA 4ODMA 5AHTA 4DWSD 1FKHA 4MNMA 1F40A 4U85A 2FAPA 2ZR6A 1ZL1A 3O5RA 3B9EA 4Z2HA 3QOKA 2PPOA 1ZBKA 3UQBA 4DRIA 5I98A 1P5QA 2XPBA 2KGJA 2LJ4A 2MLYA 1LL4A 4MNJA 3KZ7A 1LQ0A 4LAVA 3RGCA 1FKSA 2DG9A 2LKNA 1D7JA 2LAJA 5HUAA 2YSFA 2KXQA 1LG2A 4LGXA 4FAPA 2ESCA 3KADA 1O6IA 5GPGA 1TCOC 2DWVA 4ZPWR 2QRVA 3ARVA 3OOBA 3M85A 3KAIA 2DG3A 2M8JA 3TC5A 2IUZA 2M1IA 4MTVA 4DWSA 1L1PA 2EZ5W 4TW6A 3CHEA 1W1PA 3AROA 3PRBA 2RURA 5J6EA 1E6PA 5DF0A 3WQWA 2A3CA 4IT6A 1GOIA 4REXA 3FXYA 3IKDA 2QF8A 5CQ2A 3WD4A 1FKTA 4BF8A 4ML4A 4O2TA 4P8WA 2UZ5A 3RM9A 1D7IA 3UI5A 3O5GA 3LE4A 5U47A 1HXVA 5HW7A 2OLHA 1EG3A 3PRAA 1TK7A 1J4IA 4GIVA 3CZ8A 3KAFA 3TDBA 3G6LA 4HBEA 1XRVA 4U86A 3WD3A 1LJYA 2MDIA 3WQVA 3WH0A 1K9QA 1E6ZA 4ODPA 4TYOA 3GPKA 3JYMA 2PV1A 4TW8A 2DJYA 2JZVA 3O5JA 3KAGA 3B7XA 1QZ2A 5GPRA 4PTMA 4Z2LA 2ZQSA 1O6WA 1D2KA 4MAVA 3TCZA 4DRPA 2XP9A 1JVWA 1VF8A 3O5IA 4W9QA 1NWTA 3CHDA 2O9OA 4ODLA 1NMVA 4DRKA 1ITXA 1FKLA 1NMWA 2AWGA 2WLZA 1OGBA 4KR0B 5HT1A 5DO2A 5E65A 2WAEA 1HJVA 1EG4A 4ZPVR 4LAYA 2DSZA 2WADA 4P8UA 4R0XA 5E64A 2VCDA 2PPNA 3WKZA 1WMVA 2KO7A 4S3KA 1GUVA 2XP4A 3ARQA 1ZCNA 3KABA 4IT4A 1E9LA 3FY1A 4JFJA 5HWCA 1FFQA 3LKXB 4DZ3A 1J6YA 4WKAA 3KAHA 3CHCA 1BL4A 1QPLA 5HW8A 3CNGA 1W1TA 4GLXA 4P8XA 4MGVA 2KR7A 1JNEA 2BA1A 2DT0A 1LG1A 3PQHA 2WLYA 1FKJA 2Y78A 4IQCA 3W4RA 2DK7A 2MF9A 1F8AB 3AS2A 1Q6HA 2M08A 2PBCA 4Q22A 1J4HA 3O5OA 2DMVA 3EY6A 4P8VA 3WL1A 1HKMA 4HBOA 3B8SA 1JNSA 3ARUA 5DIVA 2F2DA 1FD9A 3O5KA 2DK1A 2XP5A 4ODNA 4NSBA 2ITKA 3B9DA 2YSBA 2ZQUA 3ARPA 1TR8A 2MNTA 4QT2A 4MNKA 5HWBA 1NH6A 2B31A 3NTPA 4QIBA 2K8IA 2JMFA 3UF8A 4Z2GA 3WL0A 3LKXA 1FLCA 2MPHA 4DH0A 1W9VA 1FKKA 4U84A 3PA7A 4WK9A 3UI6A 2MLZA 2XP3A 1U79A 3ARWA 4IPXA 1BKFA 2LPVA 1XHGA 1W26A 3CH9A 1E6RA 3ARSA 1ZBVA 3BXWA 3OA5A 4L3NA 3VAWA 2O92A 4XAKA 1E15A 2D9FA 1Q6UA 1JNDA 4Z2JA 4DZ2A 3RFWA 1EYMA 3H9RB 1CTNA 1HKJA 1N1AA 1H0GA 3O5MA 2ZQTA 4FN2A 5JH8A 3O5FA 5E5WA 4QZVB 2ZR5A 1B6CA 2RUQA 3MQHA 1TFVA 4TW7A 4LAXA 2YSHA 5DEZA 2YBUA 2DSWA 3IKGA 4DRHA 1LL7A 4J4NA 3ARXA 4DRMA 5HBFA 4JFMA 4Z2KA 4W9PA 4DWSC 3WD1A 1K9TA 2FKEA 4ITZA 2ZAJA 2DT1A 4ODQA 1UR9A 3JXVA 1EDQA 1Y0OA 2PV3A 3ALGA 1EHNA 3ARYA 1YW5A 4G50A 1FFRA 1ZU8A 4DT4A 1EQ3A 5HW6A 1FKBA 1ZBWA 4JFKA 4W9OA 1HKIA 3MQGA 2PV2A 3FS8A 3CGNA 4JFIA 4MPKA 2E45A 1J4RA 1WNOA 4QT3A 4URIA 3IHZA 2LGOA 3UI4A 4ZPTR 1FKGA 1W9UA 1K9RA 2JV4A 5HTGA 1I5HW 2YBTA 2RE3A 1NWRA 1X6LA 1FJDA 2ZR4A 4Q7NA 2DT2A 4DRJA 4L72B 3UQAA 2IF4A 3NRKA 2XPAA 2G41A 1E6NA 3PR9A 1NWUA 2DSUA 2KFWA 1JNTA 4JYSA 3O5EA 2A3AA 1ZB5A 3NI6A 4N19A 2XP8A 1KFWA 4G2PA 4DROA 4HARA 2DSVA 3L4HA 1W1VA 3MCBB 2ZQVA 1UR8A 1WB0A 3ARZA 4E5RA 1WAWA 3O5LA 3M7NA 4ODKA 2KE0A 3ARRA 2DG4A 3JYJA 4WIWA 1PBKA 1WR7A 5E66A 1C9HA 1HJWA 3B9AA 3RMEA 3O5PA 4DIPA 1D6OA 1NWSA 1ZK6A 1YATA 1A7XA 1NSGA 4R5EA 1ROUA 1ZBCA 1OGGA 1IX5A 2RUCA 4LAWA 3WD2A 1SR0A 1FKFA 1W9PA 3AS3A 4DRQA 2RSEA 3G6MA 2FDMA 1D7HA 1EIBA 1H0IA 4TX0A 3ODKA 1QPFA 3IK8A 1X6NA 1FKDA 3RM8A 2RUDA 3AS1A 1Q1CA 1HKKA 2KI3A 2Y8NB 4J4OA 1JMQA 3LUOA 4C02B 3FSBA 4ODOA 3UQIA 2YSGA 3RM4A 4JFLA 4A0UA 4A0TA 1R9HA 5GQBA 3MCBA 1W1YA 1Q6IA 1KT1A 2RQSA 2XP7A 1OWQA 1RP5A 2M8IA 1ROTA 4WKFA 5BXJA 3CGMA 2OFNA 2L2SA 5DITA 4S3JA 2A3BA 5DIUA 1HJXA 2PI6A 2M2AA 2AOSA 4ZS6A 4W5UA 3FSCA 4WKHA 2MLXA 4NZCA 2DPEA 4ODRA 4AY1A 3O5DA 2Q5AA 1GPFA 1LL6A 2OWOA 3PRDA 2PPPA 2N87A 1RD6A 2JXWA 2WM0A 4WJXA 2M3OW 3AQUA 4NNRA 4KQZA 2A3EA 3O5QA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5D75 A;  3KCE A;  3I6C A;  4TNS A;  1FKR A;  4DRN A;  1KT0 A;  5B8I C;  5HKG A;  2F21 A;  2JX8 A;  1T11 A;  3FAP A;  3KAC A;  4IQ2 A;  2YSI A;  3MDY B;  2F4E A;  2XP6 A;  1PIN A;  1FAP A;  1FKI A;  4GGQ A;  1M5Y A;  4MSP A;  2VN1 A;  2L4J A;  4ODM A;  5AHT A;  1FKH A;  1F40 A;  4U85 A;  2FAP A;  2ZR6 A;  3O5R A;  2PPO A;  3UQB A;  4DRI A;  5I98 A;  1P5Q A;  2XPB A;  2KGJ A;  2LJ4 A;  2MLY A;  3KZ7 A;  4LAV A;  3RGC A;  1FKS A;  2DG9 A;  2LKN A;  1D7J A;  2LAJ A;  5HUA A;  2YSF A;  2KXQ A;  4FAP A;  3KAD A;  5GPG A;  1TCO C;  2DWV A;  3OOB A;  3M85 A;  3KAI A;  2DG3 A;  2M8J A;  3TC5 A;  2M1I A;  1L1P A;  2EZ5 W;  4TW6 A;  3PRB A;  2RUR A;  5J6E A;  4REX A;  3IKD A;  5CQ2 A;  4BF8 A;  1FKT A;  4O2T A;  2UZ5 A;  1D7I A;  3UI5 A;  3O5G A;  3LE4 A;  1HXV A;  5HW7 A;  1EG3 A;  4GIV A;  1TK7 A;  1J4I A;  3KAF A;  3TDB A;  4U86 A;  2MDI A;  3WH0 A;  1K9Q A;  4ODP A;  4TYO A;  3GPK A;  3JYM A;  2PV1 A;  4TW8 A;  2DJY A;  2JZV A;  3O5J A;  3KAG A;  3B7X A;  1QZ2 A;  2ZQS A;  1O6W A;  3TCZ A;  4DRP A;  2XP9 A;  1JVW A;  3O5I A;  4W9Q A;  4ODL A;  1NMV A;  4DRK A;  1FKL A;  1NMW A;  2AWG A;  5HT1 A;  1EG4 A;  4LAY A;  4R0X A;  2VCD A;  2PPN A;  1WMV A;  2KO7 A;  2XP4 A;  1ZCN A;  3KAB A;  4JFJ A;  5HWC A;  1J6Y A;  4DZ3 A;  3KAH A;  1BL4 A;  1QPL A;  5HW8 A;  3CNG A;  4MGV A;  2KR7 A;  2BA1 A;  1FKJ A;  2Y78 A;  4IQC A;  2DK7 A;  2MF9 A;  1F8A B;  1Q6H A;  2M08 A;  2PBC A;  1J4H A;  3O5O A;  2DMV A;  3EY6 A;  1JNS A;  5DIV A;  2F2D A;  1FD9 A;  3O5K A;  2DK1 A;  2XP5 A;  4ODN A;  2ITK A;  2YSB A;  2ZQU A;  2MNT A;  4QT2 A;  5HWB A;  3NTP A;  4QIB A;  2K8I A;  2JMF A;  3UF8 A;  4DH0 A;  2MPH A;  1FKK A;  4U84 A;  3PA7 A;  3UI6 A;  2MLZ A;  2XP3 A;  1U79 A;  4IPX A;  1BKF A;  2LPV A;  1W26 A;  3VAW A;  2D9F A;  1Q6U A;  4DZ2 A;  3RFW A;  1EYM A;  3H9R B;  1N1A A;  3O5M A;  2ZQT A;  4FN2 A;  3O5F A;  2ZR5 A;  1B6C A;  2RUQ A;  4TW7 A;  4LAX A;  2YSH A;  3IKG A;  4DRH A;  4J4N A;  4DRM A;  4JFM A;  4W9P A;  2FKE A;  4ITZ A;  2ZAJ A;  4ODQ A;  3JXV A;  1Y0O A;  2PV3 A;  1YW5 A;  4G50 A;  4DT4 A;  1EQ3 A;  5HW6 A;  1FKB A;  4JFK A;  4W9O A;  2PV2 A;  3CGN A;  4JFI A;  2E45 A;  1J4R A;  4QT3 A;  3IHZ A;  2LGO A;  3UI4 A;  1FKG A;  1K9R A;  2JV4 A;  5HTG A;  1I5H W;  2RE3 A;  1FJD A;  2ZR4 A;  4DRJ A;  3UQA A;  2IF4 A;  3NRK A;  2XPA A;  2KFW A;  1JNT A;  4JYS A;  3O5E A;  3NI6 A;  4N19 A;  2XP8 A;  4G2P A;  4DRO A;  3L4H A;  2ZQV A;  4E5R A;  3O5L A;  3M7N A;  4ODK A;  2KE0 A;  2DG4 A;  3JYJ A;  1PBK A;  1WR7 A;  1C9H A;  3O5P A;  4DIP A;  1D6O A;  1ZK6 A;  1YAT A;  1A7X A;  1NSG A;  1ROU A;  2RUC A;  4LAW A;  1FKF A;  4DRQ A;  2RSE A;  4TX0 A;  1D7H A;  3ODK A;  1QPF A;  3IK8 A;  1FKD A;  2RUD A;  1Q1C A;  2KI3 A;  4J4O A;  1JMQ A;  3LUO A;  4C02 B;  4ODO A;  3UQI A;  2YSG A;  4JFL A;  1R9H A;  1Q6I A;  1KT1 A;  2RQS A;  2XP7 A;  1ROT A;  2M8I A;  5BXJ A;  3CGM A;  2OFN A;  2L2S A;  5DIT A;  5DIU A;  2M2A A;  2MLX A;  4ODR A;  3O5D A;  2Q5A A;  3PRD A;  2PPP A;  2N87 A;  2JXW A;  2M3O W;  4NNR A;  3O5Q A; 
#chains in the Genus database with same CATH topology
 2WK2 A;  3WIJ A;  5D75 A;  3KCE A;  2YAJ B;  1SYT A;  3I6C A;  4TNS A;  1FKR A;  2DT3 A;  3ART A;  4DRN A;  3CHF A;  1KT0 A;  2G8Z A;  5B8I C;  3AS0 A;  5HKG A;  2F21 A;  2JX8 A;  4MNL A;  1T11 A;  3FAP A;  3KAC A;  4IQ2 A;  2YSI A;  3MDY B;  2F4E A;  2XP6 A;  1PIN A;  3GTY X;  1FAP A;  4DWS B;  1FKI A;  4Z2I A;  5E62 A;  3ALF A;  4GGQ A;  1M5Y A;  4MSP A;  2VN1 A;  3WD0 A;  2L4J A;  4ODM A;  5AHT A;  4DWS D;  1FKH A;  4MNM A;  1F40 A;  4U85 A;  2FAP A;  2ZR6 A;  1ZL1 A;  3O5R A;  3B9E A;  4Z2H A;  3QOK A;  2PPO A;  1ZBK A;  3UQB A;  4DRI A;  5I98 A;  1P5Q A;  2XPB A;  2KGJ A;  2LJ4 A;  2MLY A;  1LL4 A;  4MNJ A;  3KZ7 A;  1LQ0 A;  4LAV A;  3RGC A;  1FKS A;  2DG9 A;  2LKN A;  1D7J A;  2LAJ A;  5HUA A;  2YSF A;  2KXQ A;  1LG2 A;  4LGX A;  4FAP A;  2ESC A;  3KAD A;  1O6I A;  5GPG A;  1E44 A;  2DWV A;  1TCO C;  4ZPW R;  2QRV A;  3ARV A;  3OOB A;  3M85 A;  3KAI A;  2DG3 A;  2M8J A;  3TC5 A;  2IUZ A;  2M1I A;  4MTV A;  4DWS A;  1L1P A;  2EZ5 W;  4TW6 A;  3CHE A;  1W1P A;  3ARO A;  3PRB A;  2RUR A;  5J6E A;  1E6P A;  5DF0 A;  3WQW A;  2A3C A;  4IT6 A;  1GOI A;  4REX A;  3FXY A;  3IKD A;  2QF8 A;  5CQ2 A;  3WD4 A;  1FKT A;  4BF8 A;  4ML4 A;  4O2T A;  4P8W A;  2UZ5 A;  3RM9 A;  1D7I A;  3UI5 A;  3O5G A;  3LE4 A;  5U47 A;  1HXV A;  5HW7 A;  2OLH A;  1EG3 A;  3PRA A;  1TK7 A;  1J4I A;  4GIV A;  3CZ8 A;  3KAF A;  3TDB A;  3G6L A;  4HBE A;  1XRV A;  4U86 A;  2ETN A;  3WD3 A;  1LJY A;  2MDI A;  3WQV A;  3WH0 A;  1K9Q A;  1E6Z A;  4ODP A;  4TYO A;  3GPK A;  3JYM A;  2PV1 A;  4TW8 A;  2DJY A;  2JZV A;  3O5J A;  3KAG A;  3B7X A;  1QZ2 A;  5GPR A;  4PTM A;  4Z2L A;  2ZQS A;  1O6W A;  1D2K A;  4MAV A;  3TCZ A;  4DRP A;  3GU0 A;  2XP9 A;  1JVW A;  1VF8 A;  3O5I A;  4W9Q A;  1NWT A;  3CHD A;  2O9O A;  4ODL A;  1NMV A;  4DRK A;  1ITX A;  1FKL A;  1NMW A;  2AWG A;  2WLZ A;  1OGB A;  4KR0 B;  5HT1 A;  5DO2 A;  5E65 A;  2WAE A;  1HJV A;  1EG4 A;  4ZPV R;  4LAY A;  2DSZ A;  2WAD A;  4P8U A;  4R0X A;  5E64 A;  2VCD A;  2PPN A;  3WKZ A;  1WMV A;  2KO7 A;  4S3K A;  1GUV A;  2XP4 A;  3ARQ A;  1ZCN A;  3KAB A;  4IT4 A;  1E9L A;  3FY1 A;  4JFJ A;  5HWC A;  1FFQ A;  3LKX B;  4DZ3 A;  1J6Y A;  4WKA A;  3KAH A;  3CHC A;  1BL4 A;  1QPL A;  5HW8 A;  3CNG A;  1W1T A;  4GLX A;  4P8X A;  4MGV A;  2KR7 A;  1JNE A;  2BA1 A;  2DT0 A;  1LG1 A;  3PQH A;  3EIP A;  2WLY A;  1FKJ A;  2Y78 A;  4IQC A;  3W4R A;  2DK7 A;  2MF9 A;  1F8A B;  3AS2 A;  1Q6H A;  2M08 A;  2PBC A;  4Q22 A;  1J4H A;  3O5O A;  2DMV A;  3EY6 A;  4P8V A;  3WL1 A;  1HKM A;  4HBO A;  3B8S A;  1JNS A;  3ARU A;  5DIV A;  2F2D A;  1FD9 A;  3O5K A;  2DK1 A;  2XP5 A;  1JCH B;  4ODN A;  4NSB A;  2ITK A;  3B9D A;  2YSB A;  2ZQU A;  3ARP A;  1TR8 A;  4UDM A;  2MNT A;  4QT2 A;  4MNK A;  5HWB A;  1NH6 A;  2B31 A;  3NTP A;  4QIB A;  2K8I A;  2JMF A;  3UF8 A;  4Z2G A;  3WL0 A;  3LKX A;  3BMB A;  1FLC A;  2MPH A;  4DH0 A;  1W9V A;  1FKK A;  4U84 A;  3PA7 A;  4WK9 A;  3UI6 A;  2MLZ A;  2PN0 A;  2XP3 A;  1U79 A;  3ARW A;  4IPX A;  1BKF A;  2LPV A;  1XHG A;  1W26 A;  3CH9 A;  1E6R A;  3ARS A;  1ZBV A;  3BXW A;  3OA5 A;  4L3N A;  3VAW A;  2O92 A;  4XAK A;  1E15 A;  2D9F A;  1Q6U A;  1JND A;  4Z2J A;  4DZ2 A;  3RFW A;  1EYM A;  3H9R B;  1CTN A;  1HKJ A;  1N1A A;  1H0G A;  3O5M A;  2ZQT A;  4FN2 A;  5JH8 A;  3O5F A;  5E5W A;  4QZV B;  2ZR5 A;  1B6C A;  2RUQ A;  3MQH A;  1TFV A;  4TW7 A;  4LAX A;  2YSH A;  5DEZ A;  2B5U B;  2YBU A;  2DSW A;  3IKG A;  4DRH A;  1LL7 A;  4J4N A;  3ARX A;  4DRM A;  5HBF A;  4JFM A;  4Z2K A;  4W9P A;  4DWS C;  3WD1 A;  1K9T A;  2FKE A;  4ITZ A;  2ZAJ A;  2DT1 A;  4ODQ A;  1UR9 A;  3JXV A;  1EDQ A;  1Y0O A;  2PV3 A;  3ALG A;  1EHN A;  3ARY A;  1YW5 A;  4G50 A;  1FFR A;  1ZU8 A;  4DT4 A;  1EQ3 A;  5HW6 A;  1FKB A;  1ZBW A;  4JFK A;  4W9O A;  1HKI A;  3MQG A;  2PV2 A;  3FS8 A;  3CGN A;  4JFI A;  4MPK A;  2E45 A;  1J4R A;  1WNO A;  4QT3 A;  4URI A;  3IHZ A;  2LGO A;  3UI4 A;  4ZPT R;  1FKG A;  1W9U A;  1K9R A;  2JV4 A;  5HTG A;  1I5H W;  2YBT A;  2RE3 A;  1NWR A;  1X6L A;  1FJD A;  2ZR4 A;  4Q7N A;  2DT2 A;  4DRJ A;  4L72 B;  3UQA A;  2IF4 A;  2F23 A;  3NRK A;  2XPA A;  2G41 A;  1E6N A;  3PR9 A;  1NWU A;  2DSU A;  2KFW A;  1JNT A;  4JYS A;  3O5E A;  2A3A A;  1ZB5 A;  3NI6 A;  4N19 A;  2XP8 A;  1KFW A;  4G2P A;  4DRO A;  4HAR A;  2DSV A;  3L4H A;  1W1V A;  3MCB B;  2ZQV A;  1UR8 A;  1WB0 A;  3ARZ A;  4E5R A;  1WAW A;  3O5L A;  3M7N A;  2EUL A;  4ODK A;  2KE0 A;  3ARR A;  2DG4 A;  3JYJ A;  4WIW A;  1PBK A;  1WR7 A;  5E66 A;  1C9H A;  1HJW A;  3B9A A;  3RME A;  3O5P A;  2P4V A;  4DIP A;  1D6O A;  1NWS A;  1ZK6 A;  1YAT A;  1A7X A;  1NSG A;  4R5E A;  1ROU A;  1ZBC A;  1OGG A;  1IX5 A;  2RUC A;  4LAW A;  3WD2 A;  1SR0 A;  1FKF A;  1W9P A;  3AS3 A;  4DRQ A;  2RSE A;  3G6M A;  2FDM A;  1D7H A;  1EIB A;  1H0I A;  4TX0 A;  3ODK A;  1QPF A;  3IK8 A;  1X6N A;  1FKD A;  3RM8 A;  2RUD A;  3AS1 A;  1Q1C A;  1HKK A;  2KI3 A;  2Y8N B;  4J4O A;  1JMQ A;  3LUO A;  4C02 B;  3FSB A;  4ODO A;  3UQI A;  2YSG A;  3RM4 A;  4JFL A;  4A0U A;  4A0T A;  1R9H A;  5GQB A;  3MCB A;  1W1Y A;  1Q6I A;  1KT1 A;  2RQS A;  2XP7 A;  1OWQ A;  1RP5 A;  2M8I A;  1ROT A;  4WKF A;  5BXJ A;  3CGM A;  2OFN A;  2L2S A;  5DIT A;  4S3J A;  2A3B A;  5DIU A;  1HJX A;  2PI6 A;  2M2A A;  2AOS A;  4ZS6 A;  4W5U A;  3FSC A;  4WKH A;  2MLX A;  4NZC A;  2DPE A;  4ODR A;  4AY1 A;  3O5D A;  2Q5A A;  1GPF A;  1LL6 A;  1GRJ A;  2OWO A;  3PRD A;  2PPP A;  2N87 A;  1RD6 A;  2JXW A;  2WM0 A;  4WJX A;  2M3O W;  3AQU A;  4NNR A;  4KQZ A;  2A3E A;  3O5Q A; 
#chains in the Genus database with same CATH homology
 2WK2 A;  3WIJ A;  5D75 A;  3KCE A;  2YAJ B;  1SYT A;  3I6C A;  4TNS A;  1FKR A;  2DT3 A;  3ART A;  4DRN A;  3CHF A;  1KT0 A;  2G8Z A;  5B8I C;  3AS0 A;  5HKG A;  2F21 A;  2JX8 A;  4MNL A;  1T11 A;  3FAP A;  3KAC A;  4IQ2 A;  2YSI A;  3MDY B;  2F4E A;  2XP6 A;  1PIN A;  1FAP A;  4DWS B;  1FKI A;  4Z2I A;  5E62 A;  3ALF A;  4GGQ A;  1M5Y A;  4MSP A;  2VN1 A;  3WD0 A;  2L4J A;  4ODM A;  5AHT A;  4DWS D;  1FKH A;  4MNM A;  1F40 A;  4U85 A;  2FAP A;  2ZR6 A;  1ZL1 A;  3O5R A;  3B9E A;  4Z2H A;  3QOK A;  2PPO A;  1ZBK A;  3UQB A;  4DRI A;  5I98 A;  1P5Q A;  2XPB A;  2KGJ A;  2LJ4 A;  2MLY A;  1LL4 A;  4MNJ A;  3KZ7 A;  1LQ0 A;  4LAV A;  3RGC A;  1FKS A;  2DG9 A;  2LKN A;  1D7J A;  2LAJ A;  5HUA A;  2YSF A;  2KXQ A;  1LG2 A;  4LGX A;  4FAP A;  2ESC A;  3KAD A;  1O6I A;  5GPG A;  1TCO C;  2DWV A;  4ZPW R;  2QRV A;  3ARV A;  3OOB A;  3M85 A;  3KAI A;  2DG3 A;  2M8J A;  3TC5 A;  2IUZ A;  2M1I A;  4MTV A;  4DWS A;  1L1P A;  2EZ5 W;  4TW6 A;  3CHE A;  1W1P A;  3ARO A;  3PRB A;  2RUR A;  5J6E A;  1E6P A;  5DF0 A;  3WQW A;  2A3C A;  4IT6 A;  1GOI A;  4REX A;  3FXY A;  3IKD A;  2QF8 A;  5CQ2 A;  3WD4 A;  1FKT A;  4BF8 A;  4ML4 A;  4O2T A;  4P8W A;  2UZ5 A;  3RM9 A;  1D7I A;  3UI5 A;  3O5G A;  3LE4 A;  5U47 A;  1HXV A;  5HW7 A;  2OLH A;  1EG3 A;  3PRA A;  1TK7 A;  1J4I A;  4GIV A;  3CZ8 A;  3KAF A;  3TDB A;  3G6L A;  4HBE A;  1XRV A;  4U86 A;  3WD3 A;  1LJY A;  2MDI A;  3WQV A;  3WH0 A;  1K9Q A;  1E6Z A;  4ODP A;  4TYO A;  3GPK A;  3JYM A;  2PV1 A;  4TW8 A;  2DJY A;  2JZV A;  3O5J A;  3KAG A;  3B7X A;  1QZ2 A;  5GPR A;  4PTM A;  4Z2L A;  2ZQS A;  1O6W A;  1D2K A;  4MAV A;  3TCZ A;  4DRP A;  2XP9 A;  1JVW A;  1VF8 A;  3O5I A;  4W9Q A;  1NWT A;  3CHD A;  2O9O A;  4ODL A;  1NMV A;  4DRK A;  1ITX A;  1FKL A;  1NMW A;  2AWG A;  2WLZ A;  1OGB A;  4KR0 B;  5HT1 A;  5DO2 A;  5E65 A;  2WAE A;  1HJV A;  1EG4 A;  4ZPV R;  4LAY A;  2DSZ A;  2WAD A;  4P8U A;  4R0X A;  5E64 A;  2VCD A;  2PPN A;  3WKZ A;  1WMV A;  2KO7 A;  4S3K A;  1GUV A;  2XP4 A;  3ARQ A;  1ZCN A;  3KAB A;  4IT4 A;  1E9L A;  3FY1 A;  4JFJ A;  5HWC A;  1FFQ A;  3LKX B;  4DZ3 A;  1J6Y A;  4WKA A;  3KAH A;  3CHC A;  1BL4 A;  1QPL A;  5HW8 A;  3CNG A;  1W1T A;  4GLX A;  4P8X A;  4MGV A;  2KR7 A;  1JNE A;  2BA1 A;  2DT0 A;  1LG1 A;  3PQH A;  2WLY A;  1FKJ A;  2Y78 A;  4IQC A;  3W4R A;  2DK7 A;  2MF9 A;  1F8A B;  3AS2 A;  1Q6H A;  2M08 A;  2PBC A;  4Q22 A;  1J4H A;  3O5O A;  2DMV A;  3EY6 A;  4P8V A;  3WL1 A;  1HKM A;  4HBO A;  3B8S A;  1JNS A;  3ARU A;  5DIV A;  2F2D A;  1FD9 A;  3O5K A;  2DK1 A;  2XP5 A;  4ODN A;  4NSB A;  2ITK A;  3B9D A;  2YSB A;  2ZQU A;  3ARP A;  1TR8 A;  2MNT A;  4QT2 A;  4MNK A;  5HWB A;  1NH6 A;  2B31 A;  3NTP A;  4QIB A;  2K8I A;  2JMF A;  3UF8 A;  4Z2G A;  3WL0 A;  3LKX A;  1FLC A;  2MPH A;  4DH0 A;  1W9V A;  1FKK A;  4U84 A;  3PA7 A;  4WK9 A;  3UI6 A;  2MLZ A;  2XP3 A;  1U79 A;  3ARW A;  4IPX A;  1BKF A;  2LPV A;  1XHG A;  1W26 A;  3CH9 A;  1E6R A;  3ARS A;  1ZBV A;  3BXW A;  3OA5 A;  4L3N A;  3VAW A;  2O92 A;  4XAK A;  1E15 A;  2D9F A;  1Q6U A;  1JND A;  4Z2J A;  4DZ2 A;  3RFW A;  1EYM A;  3H9R B;  1CTN A;  1HKJ A;  1N1A A;  1H0G A;  3O5M A;  2ZQT A;  4FN2 A;  5JH8 A;  3O5F A;  5E5W A;  4QZV B;  2ZR5 A;  1B6C A;  2RUQ A;  3MQH A;  1TFV A;  4TW7 A;  4LAX A;  2YSH A;  5DEZ A;  2YBU A;  2DSW A;  3IKG A;  4DRH A;  1LL7 A;  4J4N A;  3ARX A;  4DRM A;  5HBF A;  4JFM A;  4Z2K A;  4W9P A;  4DWS C;  3WD1 A;  1K9T A;  2FKE A;  4ITZ A;  2ZAJ A;  2DT1 A;  4ODQ A;  1UR9 A;  3JXV A;  1EDQ A;  1Y0O A;  2PV3 A;  3ALG A;  1EHN A;  3ARY A;  1YW5 A;  4G50 A;  1FFR A;  1ZU8 A;  4DT4 A;  1EQ3 A;  5HW6 A;  1FKB A;  1ZBW A;  4JFK A;  4W9O A;  1HKI A;  3MQG A;  2PV2 A;  3FS8 A;  3CGN A;  4JFI A;  4MPK A;  2E45 A;  1J4R A;  1WNO A;  4QT3 A;  4URI A;  3IHZ A;  2LGO A;  3UI4 A;  4ZPT R;  1FKG A;  1W9U A;  1K9R A;  2JV4 A;  5HTG A;  1I5H W;  2YBT A;  2RE3 A;  1NWR A;  1X6L A;  1FJD A;  2ZR4 A;  4Q7N A;  2DT2 A;  4DRJ A;  4L72 B;  3UQA A;  2IF4 A;  3NRK A;  2XPA A;  2G41 A;  1E6N A;  3PR9 A;  1NWU A;  2DSU A;  2KFW A;  1JNT A;  4JYS A;  3O5E A;  2A3A A;  1ZB5 A;  3NI6 A;  4N19 A;  2XP8 A;  1KFW A;  4G2P A;  4DRO A;  4HAR A;  2DSV A;  3L4H A;  1W1V A;  3MCB B;  2ZQV A;  1UR8 A;  1WB0 A;  3ARZ A;  4E5R A;  1WAW A;  3O5L A;  3M7N A;  4ODK A;  2KE0 A;  3ARR A;  2DG4 A;  3JYJ A;  4WIW A;  1PBK A;  1WR7 A;  5E66 A;  1C9H A;  1HJW A;  3B9A A;  3RME A;  3O5P A;  4DIP A;  1D6O A;  1NWS A;  1ZK6 A;  1YAT A;  1A7X A;  1NSG A;  4R5E A;  1ROU A;  1ZBC A;  1OGG A;  1IX5 A;  2RUC A;  4LAW A;  3WD2 A;  1SR0 A;  1FKF A;  1W9P A;  3AS3 A;  4DRQ A;  2RSE A;  3G6M A;  2FDM A;  1D7H A;  1EIB A;  1H0I A;  4TX0 A;  3ODK A;  1QPF A;  3IK8 A;  1X6N A;  1FKD A;  3RM8 A;  2RUD A;  3AS1 A;  1Q1C A;  1HKK A;  2KI3 A;  2Y8N B;  4J4O A;  1JMQ A;  3LUO A;  4C02 B;  3FSB A;  4ODO A;  3UQI A;  2YSG A;  3RM4 A;  4JFL A;  4A0U A;  4A0T A;  1R9H A;  5GQB A;  3MCB A;  1W1Y A;  1Q6I A;  1KT1 A;  2RQS A;  2XP7 A;  1OWQ A;  1RP5 A;  2M8I A;  1ROT A;  4WKF A;  5BXJ A;  3CGM A;  2OFN A;  2L2S A;  5DIT A;  4S3J A;  2A3B A;  5DIU A;  1HJX A;  2PI6 A;  2M2A A;  2AOS A;  4ZS6 A;  4W5U A;  3FSC A;  4WKH A;  2MLX A;  4NZC A;  2DPE A;  4ODR A;  4AY1 A;  3O5D A;  2Q5A A;  1GPF A;  1LL6 A;  2OWO A;  3PRD A;  2PPP A;  2N87 A;  1RD6 A;  2JXW A;  2WM0 A;  4WJX A;  2M3O W;  3AQU A;  4NNR A;  4KQZ A;  2A3E A;  3O5Q A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...