2ZQUA

Crystal structure of a mutant pin1 peptidyl-prolyl cis-trans isomerase
Total Genus 42
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
42
sequence length
158
structure length
153
Chain Sequence
b'KLPPGWEKRMSRSSGRVYYFNHITNASQAERPSGGKNGQGEPARVRCSHLLVKHSQSRRPSSWRQEKITRTKEEALELINGYIQKIKSGEEDFESLASQFSDCSSAKARGDLGAFSRGQMQKPFEDASFALRTGEMSGPVFTDSGIHIILRTE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Peptidyl-prolyl cis-trans isomerase NIMA-interacting 1
publication title Structural studies on PIN1 mutants
rcsb
source organism Homo sapiens
molecule tags Isomerase
total genus 42
structure length 153
sequence length 158
ec nomenclature ec 5.2.1.8: Peptidylprolyl isomerase.
pdb deposition date 2008-08-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00397 WW WW domain
A PF00639 Rotamase PPIC-type PPIASE domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.20.70.10 Mainly Beta Single Sheet Ubiquitin Ligase Nedd4; Chain: W; Ubiquitin Ligase Nedd4; Chain: W; 2zquA01
3.10.50.40 Alpha Beta Roll Chitinase A; domain 3 Chitinase A; domain 3 2zquA02
1EG3A 1I5HW 2JX8A 5B8IC 3M85A 3IK8A 3TCZA 5HW6A 4ODLA 1NSGA 3CNGA 1P5QA 3IKDA 4W9QA 4U85A 1FKIA 4N19A 1QZ2A 4DRKA 3O5LA 2XP3A 2MNTA 4REXA 2YSIA 4U84A 2YSHA 4MSPA 3O5PA 2LGOA 4FN2A 2VN1A 2F2DA 1QPFA 2ZR4A 2K8IA 2KXQA 2LAJA 4JFMA 2ZR5A 3PRBA 2N87A 1Q6IA 1BKFA 4BF8A 1BL4A 3L4HA 2MDIA 5HW8A 2YSFA 1D6OA 3JYMA 4DZ3A 2UZ5A 4DRIA 1FD9A 2L4JA 1TK7A 5HWCA 1Q6UA 2E45A 2YSGA 3CGNA 3VAWA 3JXVA 1PINA 1FKKA 2KE0A 3O5MA 3TDBA 4IQ2A 1Q6HA 1EQ3A 2MLZA 2Y78A 2RE3A 2M2AA 5BXJA 1J6YA 2M8JA 5CQ2A 1J4HA 1FKFA 1JNSA 1HXVA 3O5RA 3O5QA 1ZK6A 4DZ2A 4GIVA 4DROA 2PPNA 2F4EA 2XPBA 3JYJA 3LE4A 1D7HA 2PV1A 2ZR6A 2DMVA 3UQIA 5HW7A 4G50A 4W9OA 1K9RA 2AWGA 4ODQA 2IF4A 2MF9A 4LAYA 2DK1A 4TX0A 1FKDA 3M7NA 1R9HA 3KZ7A 4DRMA 1L1PA 3UQBA 4LAXA 2MPHA 5DIUA 1ROUA 3H9RB 1ROTA 1D7IA 4QT2A 4DH0A 2EZ5W 2ITKA 5HKGA 5HT1A 2ZAJA 4QT3A 4ODNA 3IHZA 3KAGA 1ZCNA 1K9QA 4IPXA 5HUAA 2PBCA 3TC5A 5HWBA 4TW6A 3MDYB 2DK7A 3CGMA 3NRKA 2KFWA 3O5KA 4TYOA 4JFKA 2MLYA 4G2PA 2ZQSA 3OOBA 1O6WA 2PPOA 2XP6A 4DIPA 1N1AA 4DRJA 4JFLA 2Q5AA 3KAFA 1YATA 2XP8A 3UI6A 4ODKA 2XP5A 4FAPA 1FJDA 3KCEA 1JMQA 1JNTA 4JFJA 1QPLA 3IKGA 2JV4A 1J4IA 1Q1CA 2M8IA 3O5OA 2JXWA 3O5FA 1KT1A 2DJYA 2LJ4A 4ITZA 3NTPA 1FKJA 1TCOC 2ZQTA 1FKLA 5HTGA 2RQSA 3KADA 3O5EA 4TW7A 3O5IA 2XPAA 3FAPA 2OFNA 3I6CA 3KACA 2YSBA 4E5RA 2D9FA 2KI3A 1A7XA 4DRPA 5DIVA 2KGJA 2VCDA 5J6EA 1F40A 2DG3A 2M08A 4ODPA 4U86A 3NI6A 3GPKA 2BA1A 2PV2A 1EG4A 2PV3A 2M1IA 1EYMA 4IQCA 2ZQVA 4MGVA 3RFWA 2DWVA 4R0XA 1KT0A 2ZQUA 1FKBA 4NNRA 1U79A 2PPPA 2RUCA 1JVWA 2DG9A 4J4OA 1FAPA 2F21A 1NMVA 1FKGA 3O5DA 2M3OW 4TW8A 4ODOA 2DG4A 3O5GA 3KABA 3UI4A 5GPGA 4J4NA 5D75A 4LAWA 1D7JA 3RGCA 2FAPA 4JFIA 3UI5A 3EY6A 3B7XA 2KO7A 1W26A 4TNSA 1F8AB 2RUQA 3ODKA 2JZVA 4GGQA 4W9PA 3PA7A 2RUDA 2XP9A 1FKTA 1Y0OA 4QIBA 3LUOA 4JYSA 4C02B 5AHTA 2XP4A 4DRNA 1FKRA 4DRQA 2XP7A 1FKHA 1FKSA 3UF8A 1T11A 2FKEA 1WR7A 3KAHA 3PRDA 1WMVA 1J4RA 1C9HA 1B6CA 5I98A 1NMWA 4ODRA 3O5JA 3WH0A 2MLXA 2KR7A 4LAVA 2L2SA 1M5YA 2RURA 4O2TA 4ODMA 3KAIA 3UQAA 5DITA 2RSEA 2LPVA 4DRHA 4DT4A 2LKNA 1PBKA 2JMFA 1YW5A
chains in the Genus database with same CATH superfamily
1EG3A 1IX5A 1I5HW 2JX8A 5B8IC 3M85A 3IK8A 3TCZA 1W9UA 1K9TA 1W1YA 5JH8A 5HW6A 4ODLA 1NSGA 4KR0B 3CNGA 1P5QA 3IKDA 3LKXA 4W9QA 4U85A 1FKIA 4N19A 2WADA 1QZ2A 3AROA 1ZL1A 4DRKA 3O5LA 2XP3A 2MNTA 4REXA 2YSIA 3WL0A 4U84A 1EDQA 2YSHA 1HKKA 4Z2KA 4MSPA 3O5PA 3WD2A 2LGOA 1H0IA 4MNKA 1ITXA 4FN2A 2WK2A 2VN1A 2F2DA 1RD6A 1X6NA 1QPFA 3ARXA 4Q7NA 2ZR4A 2WM0A 2K8IA 2KXQA 3BMBA 1TR8A 2LAJA 4S3JA 4JFMA 1W9VA 1UR8A 2ZR5A 4P8WA 1GPFA 3PRBA 2DT3A 5DO2A 2N87A 1Q6IA 1E6PA 1LG1A 1E6NA 1BKFA 4BF8A 1BL4A 5E5WA 3ARQA 3L4HA 3MCBA 1W1TA 2MDIA 4AY1A 5HW8A 2YSFA 2Y8NB 4P8UA 3FS8A 3EIPA 5DF0A 1D6OA 2YBTA 1ZBCA 3JYMA 2ESCA 4DZ3A 4ZS6A 2UZ5A 4DRIA 4MAVA 1FD9A 4Z2JA 4L72B 4WJXA 1CTNA 2L4JA 1TK7A 1LJYA 1O6IA 5HWCA 2AOSA 1Q6UA 1JNDA 4P8XA 4Z2LA 2E45A 3RMEA 2YSGA 3CGNA 3VAWA 1LL7A 2WAEA 1LL4A 1PINA 1FKKA 3JXVA 2KE0A 3O5MA 3RM9A 3TDBA 3B9AA 1JCHB 4IQ2A 3G6LA 1FFRA 1Q6HA 4QZVB 2EULA 1EQ3A 2MLZA 2Y78A 2RE3A 2M2AA 3ARUA 1EIBA 4ML4A 3BXWA 1NH6A 1ZBWA 3WL1A 2DT1A 5BXJA 1J6YA 2M8JA 5CQ2A 1J4HA 4MTVA 1FKFA 1JNSA 1HXVA 1WB0A 2DSWA 3O5RA 3O5QA 1ZK6A 4MNMA 4DZ2A 4GIVA 1UR9A 4GLXA 1LL6A 3ARPA 2IUZA 4NSBA 4DROA 5E62A 3CHDA 2PPNA 2F4EA 2XPBA 1RP5A 3JYJA 3LE4A 1D7HA 5E65A 2PV1A 3FY1A 2ZR6A 2DMVA 3UQIA 3AS0A 5HW7A 4G50A 3MQGA 4W9OA 1NWSA 2A3EA 1K9RA 2AWGA 4ODQA 2IF4A 2MF9A 4LAYA 3GTYX 2DK1A 3FXYA 3B9EA 4TX0A 1FKDA 3M7NA 1R9HA 3PR9A 3KZ7A 3WD0A 3QOKA 1HJWA 4WKFA 2F23A 2DSVA 4DRMA 1L1PA 1FLCA 4LAXA 3UQBA 3AS2A 4R5EA 2MPHA 5DIUA 1ROUA 3H9RB 4Q22A 3FSCA 1ROTA 1D7IA 4QT2A 4DH0A 3ARYA 2EZ5W 2ITKA 5HKGA 5HT1A 2ZAJA 4QT3A 1HKIA 1JNEA 2DT2A 4ODNA 4DWSA 3IHZA 3KAGA 3RM4A 4A0UA 1ZCNA 1K9QA 4IPXA 5HUAA 2PBCA 4DWSC 3TC5A 5GPRA 5HWBA 3PQHA 4TW6A 4XAKA 3MDYB 4HARA 2DK7A 3CGMA 3NRKA 3CHCA 2KFWA 5E66A 2WLZA 3O5KA 3WIJA 1WNOA 2DSUA 4TYOA 4JFKA 1D2KA 2MLYA 2ZQSA 3OOBA 2PPOA 1O6WA 4G2PA 1SR0A 2XP6A 4DIPA 1N1AA 4DRJA 4JFLA 2Q5AA 5HBFA 2QF8A 3KAFA 1YATA 1W9PA 4UDMA 2XP8A 3UI6A 4ODKA 2XP5A 4FAPA 3ARTA 3KCEA 3ALGA 4Z2HA 1JMQA 3AQUA 1FJDA 1JNTA 4JFJA 1QPLA 4WKAA 3IKGA 2JV4A 1J4IA 1Q1CA 2M8IA 3O5OA 2JXWA 3O5FA 1KT1A 4HBEA 3WD3A 2DJYA 2LJ4A 4ITZA 3NTPA 2B31A 3B8SA 2A3AA 2OLHA 3AS1A 1FKJA 2FDMA 1TCOC 2OWOA 2ZQTA 1FKLA 3ARVA 1ZBVA 5HTGA 1FFQA 2RQSA 1E15A 3KADA 5U47A 2P4VA 3O5EA 4TW7A 3WKZA 1GUVA 3O5IA 2XPAA 3MQHA 1E44A 3FAPA 3LKXB 3CHFA 2OFNA 3I6CA 3KACA 4MNJA 2YSBA 4E5RA 2D9FA 2KI3A 1A7XA 4W5UA 4DRPA 2YBUA 4WKHA 5DIVA 3FSBA 1VF8A 1W1PA 2KGJA 2VCDA 5J6EA 3WD4A 1F40A 2DG3A 2M08A 4ODPA 1GRJA 1GOIA 4U86A 3NI6A 1SYTA 3GPKA 2BA1A 2PV2A 4Z2GA 1EG4A 4Z2IA 2DT0A 2PV3A 2M1IA 2O9OA 4IT4A 1EYMA 1WAWA 4IQCA 3ALFA 4L3NA 4PTMA 2WLYA 3CZ8A 2ZQVA 4URIA 1LG2A 4MGVA 1EHNA 3RFWA 4DWSD 3RM8A 2DWVA 3MCBB 4R0XA 1KT0A 3B9DA 2ZQUA 1FKBA 1OWQA 4NNRA 4ZPWR 4WIWA 1U79A 2PPPA 2RUCA 4NZCA 1JVWA 2A3BA 2DG9A 4J4OA 4KQZA 1FAPA 1E9LA 2PN0A 2F21A 1NWUA 1NMVA 3WD1A 1FKGA 3O5DA 4ZPTR 4S3KA 2M3OW 4TW8A 4ODOA 2DG4A 4WK9A 3WQVA 2O92A 3KABA 3O5GA 3UI4A 1XHGA 1OGBA 5GPGA 4J4NA 3CHEA 5D75A 4LAWA 1D7JA 4A0TA 1HKMA 2A3CA 3G6MA 3GU0A 3RGCA 3PRAA 1OGGA 3AS3A 3WQWA 2FAPA 4JFIA 3UI5A 4HBOA 3EY6A 3B7XA 2KO7A 1W26A 2G41A 4TNSA 2DPEA 1F8AB 4LGXA 2RUQA 3ODKA 1NWTA 2JZVA 4GGQA 4W9PA 4P8VA 3PA7A 2RUDA 2XP9A 1FKTA 1Y0OA 4QIBA 3LUOA 4JYSA 4C02B 5AHTA 2XP4A 1ZBKA 5E64A 4DRNA 1ZU8A 1FKRA 4DRQA 4ZPVR 2XP7A 1H0GA 1FKHA 1FKSA 3UF8A 2PI6A 1T11A 2FKEA 1WR7A 2YAJB 1KFWA 1X6LA 3KAHA 3ARSA 3PRDA 1WMVA 1J4RA 1C9HA 1B6CA 1E6ZA 5I98A 1TFVA 3OA5A 1NMWA 2B5UB 1LQ0A 5DEZA 1HJXA 4ODRA 3ARRA 2ETNA 3O5JA 1HJVA 3WH0A 2QRVA 2MLXA 2KR7A 4LAVA 3W4RA 4MPKA 2L2SA 2DSZA 1M5YA 2RURA 4O2TA 4ODMA 5GQBA 3CH9A 4MNLA 3KAIA 3ARZA 3UQAA 5DITA 2RSEA 2LPVA 4IT6A 4DRHA 4DT4A 1NWRA 2LKNA 1PBKA 1ZB5A 2JMFA 4DWSB 1HKJA 1W1VA 2G8ZA 3ARWA 1XRVA 1YW5A 1E6RA
chains in the Genus database with same CATH topology
1EG3A 1IX5A 1I5HW 2JX8A 5B8IC 3M85A 3IK8A 3TCZA 1W9UA 1K9TA 1W1YA 5JH8A 5HW6A 4ODLA 1NSGA 4KR0B 3CNGA 1P5QA 3IKDA 3LKXA 4W9QA 4U85A 1FKIA 4N19A 2WADA 1QZ2A 3AROA 1ZL1A 4DRKA 3O5LA 2XP3A 2MNTA 4REXA 2YSIA 3WL0A 4U84A 1EDQA 2YSHA 1HKKA 4Z2KA 4MSPA 3O5PA 3WD2A 2LGOA 1H0IA 4MNKA 1ITXA 4FN2A 2WK2A 2VN1A 2F2DA 1RD6A 1X6NA 1QPFA 3ARXA 4Q7NA 2ZR4A 2WM0A 2K8IA 2KXQA 1TR8A 2LAJA 4S3JA 4JFMA 1W9VA 1UR8A 2ZR5A 4P8WA 1GPFA 3PRBA 2DT3A 5DO2A 2N87A 1Q6IA 1E6PA 1LG1A 1E6NA 1BKFA 4BF8A 1BL4A 5E5WA 3ARQA 3L4HA 3MCBA 1W1TA 2MDIA 4AY1A 5HW8A 2YSFA 2Y8NB 4P8UA 3FS8A 5DF0A 1D6OA 2YBTA 1ZBCA 3JYMA 2ESCA 4DZ3A 4ZS6A 2UZ5A 4DRIA 4MAVA 1FD9A 4Z2JA 4L72B 4WJXA 1CTNA 2L4JA 1TK7A 1LJYA 1O6IA 5HWCA 2AOSA 1Q6UA 1JNDA 4P8XA 4Z2LA 2E45A 3RMEA 2YSGA 3CGNA 3VAWA 1LL7A 2WAEA 1LL4A 1PINA 1FKKA 3JXVA 2KE0A 3O5MA 3RM9A 3TDBA 3B9AA 4IQ2A 3G6LA 1FFRA 1Q6HA 4QZVB 1EQ3A 2MLZA 2Y78A 2RE3A 2M2AA 3ARUA 1EIBA 4ML4A 3BXWA 1NH6A 1ZBWA 3WL1A 2DT1A 5BXJA 1J6YA 2M8JA 5CQ2A 1J4HA 4MTVA 1FKFA 1JNSA 1HXVA 1WB0A 2DSWA 3O5RA 3O5QA 1ZK6A 4MNMA 4DZ2A 4GIVA 1UR9A 4GLXA 1LL6A 3ARPA 2IUZA 4NSBA 4DROA 5E62A 3CHDA 2PPNA 2F4EA 2XPBA 1RP5A 3JYJA 3LE4A 1D7HA 5E65A 2PV1A 3FY1A 2ZR6A 2DMVA 3UQIA 3AS0A 5HW7A 4G50A 3MQGA 4W9OA 1NWSA 2A3EA 1K9RA 2AWGA 4ODQA 2IF4A 2MF9A 4LAYA 2DK1A 3FXYA 3B9EA 4TX0A 1FKDA 3M7NA 1R9HA 3PR9A 3KZ7A 3WD0A 3QOKA 1HJWA 4WKFA 2DSVA 4DRMA 1L1PA 1FLCA 4LAXA 3UQBA 3AS2A 4R5EA 2MPHA 5DIUA 1ROUA 3H9RB 4Q22A 3FSCA 1ROTA 1D7IA 4QT2A 4DH0A 3ARYA 2EZ5W 2ITKA 5HKGA 5HT1A 2ZAJA 4QT3A 1HKIA 1JNEA 2DT2A 4ODNA 4DWSA 3IHZA 3KAGA 3RM4A 4A0UA 1ZCNA 1K9QA 4IPXA 5HUAA 2PBCA 4DWSC 3TC5A 5GPRA 5HWBA 3PQHA 4TW6A 4XAKA 3MDYB 4HARA 2DK7A 3CGMA 3NRKA 3CHCA 2KFWA 5E66A 2WLZA 3O5KA 3WIJA 1WNOA 2DSUA 4TYOA 4JFKA 1D2KA 2MLYA 2PPOA 2ZQSA 3OOBA 1O6WA 4G2PA 1SR0A 2XP6A 4DIPA 1N1AA 4DRJA 4JFLA 2Q5AA 5HBFA 2QF8A 3KAFA 1YATA 1W9PA 2XP8A 3UI6A 4ODKA 2XP5A 4FAPA 3ARTA 3KCEA 3ALGA 4Z2HA 1JMQA 3AQUA 1FJDA 1JNTA 4JFJA 1QPLA 4WKAA 3IKGA 2JV4A 1J4IA 1Q1CA 2M8IA 3O5OA 2JXWA 3O5FA 1KT1A 4HBEA 3WD3A 2DJYA 2LJ4A 4ITZA 3NTPA 2B31A 3B8SA 2A3AA 2OLHA 3AS1A 1FKJA 2FDMA 1TCOC 2OWOA 2ZQTA 1FKLA 3ARVA 1ZBVA 5HTGA 1FFQA 2RQSA 1E15A 3KADA 5U47A 3O5EA 4TW7A 3WKZA 1GUVA 3O5IA 2XPAA 3MQHA 3FAPA 3LKXB 3CHFA 2OFNA 3I6CA 3KACA 4MNJA 2YSBA 4E5RA 2D9FA 2KI3A 1A7XA 4W5UA 4DRPA 2YBUA 4WKHA 5DIVA 3FSBA 1VF8A 1W1PA 2KGJA 2VCDA 5J6EA 3WD4A 1F40A 2DG3A 2M08A 4ODPA 1GOIA 4U86A 3NI6A 1SYTA 3GPKA 2BA1A 2PV2A 4Z2GA 1EG4A 4Z2IA 2DT0A 2PV3A 2M1IA 2O9OA 4IT4A 1EYMA 1WAWA 4IQCA 3ALFA 4L3NA 4PTMA 2WLYA 3CZ8A 2ZQVA 4URIA 1LG2A 4MGVA 1EHNA 3RFWA 4DWSD 3RM8A 2DWVA 3MCBB 4R0XA 1KT0A 3B9DA 2ZQUA 1FKBA 1OWQA 4NNRA 4ZPWR 4WIWA 1U79A 2PPPA 2RUCA 4NZCA 1JVWA 2A3BA 2DG9A 4J4OA 4KQZA 1FAPA 1E9LA 2F21A 1NWUA 1NMVA 3WD1A 1FKGA 3O5DA 4ZPTR 4S3KA 2M3OW 4TW8A 4ODOA 2DG4A 4WK9A 3WQVA 2O92A 3KABA 3O5GA 3UI4A 1XHGA 1OGBA 5GPGA 4J4NA 3CHEA 5D75A 4LAWA 1D7JA 4A0TA 1HKMA 2A3CA 3G6MA 3RGCA 3PRAA 1OGGA 3AS3A 3WQWA 2FAPA 4JFIA 3UI5A 4HBOA 3EY6A 3B7XA 2KO7A 1W26A 2G41A 4TNSA 2DPEA 1F8AB 4LGXA 2RUQA 3ODKA 1NWTA 2JZVA 4GGQA 4W9PA 4P8VA 3PA7A 2RUDA 2XP9A 1FKTA 1Y0OA 4QIBA 3LUOA 4JYSA 4C02B 5AHTA 2XP4A 1ZBKA 5E64A 4DRNA 1ZU8A 1FKRA 4DRQA 4ZPVR 2XP7A 1H0GA 1FKHA 1FKSA 3UF8A 2PI6A 1T11A 2FKEA 1WR7A 2YAJB 1KFWA 1X6LA 3KAHA 3ARSA 3PRDA 1WMVA 1J4RA 1C9HA 1B6CA 1E6ZA 5I98A 1TFVA 3OA5A 1NMWA 1LQ0A 5DEZA 1HJXA 4ODRA 3ARRA 3O5JA 1HJVA 3WH0A 2QRVA 2MLXA 2KR7A 4LAVA 3W4RA 4MPKA 2L2SA 2DSZA 1M5YA 2RURA 4O2TA 4ODMA 5GQBA 3CH9A 4MNLA 3KAIA 3ARZA 3UQAA 5DITA 2RSEA 2LPVA 4IT6A 4DRHA 4DT4A 1NWRA 2LKNA 1PBKA 1ZB5A 2JMFA 4DWSB 1HKJA 1W1VA 2G8ZA 3ARWA 1XRVA 1YW5A 1E6RA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1EG3 A;  1I5H W;  2JX8 A;  5B8I C;  3M85 A;  3IK8 A;  3TCZ A;  5HW6 A;  4ODL A;  1NSG A;  3CNG A;  1P5Q A;  3IKD A;  4W9Q A;  4U85 A;  1FKI A;  4N19 A;  1QZ2 A;  4DRK A;  3O5L A;  2XP3 A;  2MNT A;  4REX A;  2YSI A;  4U84 A;  2YSH A;  4MSP A;  3O5P A;  2LGO A;  4FN2 A;  2VN1 A;  2F2D A;  1QPF A;  2ZR4 A;  2K8I A;  2KXQ A;  2LAJ A;  4JFM A;  2ZR5 A;  3PRB A;  2N87 A;  1Q6I A;  1BKF A;  4BF8 A;  1BL4 A;  3L4H A;  2MDI A;  5HW8 A;  2YSF A;  1D6O A;  3JYM A;  4DZ3 A;  2UZ5 A;  4DRI A;  1FD9 A;  2L4J A;  1TK7 A;  5HWC A;  1Q6U A;  2E45 A;  2YSG A;  3CGN A;  3VAW A;  3JXV A;  1PIN A;  1FKK A;  2KE0 A;  3O5M A;  3TDB A;  4IQ2 A;  1Q6H A;  1EQ3 A;  2MLZ A;  2Y78 A;  2RE3 A;  2M2A A;  5BXJ A;  1J6Y A;  2M8J A;  5CQ2 A;  1J4H A;  1FKF A;  1JNS A;  1HXV A;  3O5R A;  3O5Q A;  1ZK6 A;  4DZ2 A;  4GIV A;  4DRO A;  2PPN A;  2F4E A;  2XPB A;  3JYJ A;  3LE4 A;  1D7H A;  2PV1 A;  2ZR6 A;  2DMV A;  3UQI A;  5HW7 A;  4G50 A;  4W9O A;  1K9R A;  2AWG A;  4ODQ A;  2IF4 A;  2MF9 A;  4LAY A;  2DK1 A;  4TX0 A;  1FKD A;  3M7N A;  1R9H A;  3KZ7 A;  4DRM A;  1L1P A;  3UQB A;  4LAX A;  2MPH A;  5DIU A;  1ROU A;  3H9R B;  1ROT A;  1D7I A;  4QT2 A;  4DH0 A;  2EZ5 W;  2ITK A;  5HKG A;  5HT1 A;  2ZAJ A;  4QT3 A;  4ODN A;  3IHZ A;  3KAG A;  1ZCN A;  1K9Q A;  4IPX A;  5HUA A;  2PBC A;  3TC5 A;  5HWB A;  4TW6 A;  3MDY B;  2DK7 A;  3CGM A;  3NRK A;  2KFW A;  3O5K A;  4TYO A;  4JFK A;  2MLY A;  4G2P A;  2ZQS A;  3OOB A;  1O6W A;  2PPO A;  2XP6 A;  4DIP A;  1N1A A;  4DRJ A;  4JFL A;  2Q5A A;  3KAF A;  1YAT A;  2XP8 A;  3UI6 A;  4ODK A;  2XP5 A;  4FAP A;  1FJD A;  3KCE A;  1JMQ A;  1JNT A;  4JFJ A;  1QPL A;  3IKG A;  2JV4 A;  1J4I A;  1Q1C A;  2M8I A;  3O5O A;  2JXW A;  3O5F A;  1KT1 A;  2DJY A;  2LJ4 A;  4ITZ A;  3NTP A;  1FKJ A;  1TCO C;  2ZQT A;  1FKL A;  5HTG A;  2RQS A;  3KAD A;  3O5E A;  4TW7 A;  3O5I A;  2XPA A;  3FAP A;  2OFN A;  3I6C A;  3KAC A;  2YSB A;  4E5R A;  2D9F A;  2KI3 A;  1A7X A;  4DRP A;  5DIV A;  2KGJ A;  2VCD A;  5J6E A;  1F40 A;  2DG3 A;  2M08 A;  4ODP A;  4U86 A;  3NI6 A;  3GPK A;  2BA1 A;  2PV2 A;  1EG4 A;  2PV3 A;  2M1I A;  1EYM A;  4IQC A;  2ZQV A;  4MGV A;  3RFW A;  2DWV A;  4R0X A;  1KT0 A;  2ZQU A;  1FKB A;  4NNR A;  1U79 A;  2PPP A;  2RUC A;  1JVW A;  2DG9 A;  4J4O A;  1FAP A;  2F21 A;  1NMV A;  1FKG A;  3O5D A;  2M3O W;  4TW8 A;  4ODO A;  2DG4 A;  3O5G A;  3KAB A;  3UI4 A;  5GPG A;  4J4N A;  5D75 A;  4LAW A;  1D7J A;  3RGC A;  2FAP A;  4JFI A;  3UI5 A;  3EY6 A;  3B7X A;  2KO7 A;  1W26 A;  4TNS A;  1F8A B;  2RUQ A;  3ODK A;  2JZV A;  4GGQ A;  4W9P A;  3PA7 A;  2RUD A;  2XP9 A;  1FKT A;  1Y0O A;  4QIB A;  3LUO A;  4JYS A;  4C02 B;  5AHT A;  2XP4 A;  4DRN A;  1FKR A;  4DRQ A;  2XP7 A;  1FKH A;  1FKS A;  3UF8 A;  1T11 A;  2FKE A;  1WR7 A;  3KAH A;  3PRD A;  1WMV A;  1J4R A;  1C9H A;  1B6C A;  5I98 A;  1NMW A;  4ODR A;  3O5J A;  3WH0 A;  2MLX A;  2KR7 A;  4LAV A;  2L2S A;  1M5Y A;  2RUR A;  4O2T A;  4ODM A;  3KAI A;  3UQA A;  5DIT A;  2RSE A;  2LPV A;  4DRH A;  4DT4 A;  2LKN A;  1PBK A;  2JMF A;  1YW5 A; 
#chains in the Genus database with same CATH topology
 1EG3 A;  1IX5 A;  1I5H W;  2JX8 A;  5B8I C;  3M85 A;  3IK8 A;  3TCZ A;  1W9U A;  1K9T A;  1W1Y A;  5JH8 A;  5HW6 A;  4ODL A;  1NSG A;  4KR0 B;  3CNG A;  1P5Q A;  3IKD A;  3LKX A;  4W9Q A;  4U85 A;  1FKI A;  4N19 A;  2WAD A;  1QZ2 A;  3ARO A;  1ZL1 A;  4DRK A;  3O5L A;  2XP3 A;  2MNT A;  4REX A;  2YSI A;  3WL0 A;  4U84 A;  1EDQ A;  2YSH A;  1HKK A;  4Z2K A;  4MSP A;  3O5P A;  3WD2 A;  2LGO A;  1H0I A;  4MNK A;  1ITX A;  4FN2 A;  2WK2 A;  2VN1 A;  2F2D A;  1RD6 A;  1X6N A;  1QPF A;  3ARX A;  4Q7N A;  2ZR4 A;  2WM0 A;  2K8I A;  2KXQ A;  3BMB A;  1TR8 A;  2LAJ A;  4S3J A;  4JFM A;  1W9V A;  1UR8 A;  2ZR5 A;  4P8W A;  1GPF A;  3PRB A;  2DT3 A;  5DO2 A;  2N87 A;  1Q6I A;  1E6P A;  1LG1 A;  1E6N A;  1BKF A;  4BF8 A;  1BL4 A;  5E5W A;  3ARQ A;  3L4H A;  3MCB A;  1W1T A;  2MDI A;  4AY1 A;  5HW8 A;  2YSF A;  2Y8N B;  4P8U A;  3FS8 A;  3EIP A;  5DF0 A;  1D6O A;  2YBT A;  1ZBC A;  3JYM A;  2ESC A;  4DZ3 A;  4ZS6 A;  2UZ5 A;  4DRI A;  4MAV A;  1FD9 A;  4Z2J A;  4L72 B;  4WJX A;  1CTN A;  2L4J A;  1TK7 A;  1LJY A;  1O6I A;  5HWC A;  2AOS A;  1Q6U A;  1JND A;  4P8X A;  4Z2L A;  2E45 A;  3RME A;  2YSG A;  3CGN A;  3VAW A;  1LL7 A;  2WAE A;  1LL4 A;  1PIN A;  1FKK A;  3JXV A;  2KE0 A;  3O5M A;  3RM9 A;  3TDB A;  3B9A A;  1JCH B;  4IQ2 A;  3G6L A;  1FFR A;  1Q6H A;  4QZV B;  2EUL A;  1EQ3 A;  2MLZ A;  2Y78 A;  2RE3 A;  2M2A A;  3ARU A;  1EIB A;  4ML4 A;  3BXW A;  1NH6 A;  1ZBW A;  3WL1 A;  2DT1 A;  5BXJ A;  1J6Y A;  2M8J A;  5CQ2 A;  1J4H A;  4MTV A;  1FKF A;  1JNS A;  1HXV A;  1WB0 A;  2DSW A;  3O5R A;  3O5Q A;  1ZK6 A;  4MNM A;  4DZ2 A;  4GIV A;  1UR9 A;  4GLX A;  1LL6 A;  3ARP A;  2IUZ A;  4NSB A;  4DRO A;  5E62 A;  3CHD A;  2PPN A;  2F4E A;  2XPB A;  1RP5 A;  3JYJ A;  3LE4 A;  1D7H A;  5E65 A;  2PV1 A;  3FY1 A;  2ZR6 A;  2DMV A;  3UQI A;  3AS0 A;  5HW7 A;  4G50 A;  3MQG A;  4W9O A;  1NWS A;  2A3E A;  1K9R A;  2AWG A;  4ODQ A;  2IF4 A;  2MF9 A;  4LAY A;  3GTY X;  2DK1 A;  3FXY A;  3B9E A;  4TX0 A;  1FKD A;  3M7N A;  1R9H A;  3PR9 A;  3KZ7 A;  3WD0 A;  3QOK A;  1HJW A;  4WKF A;  2F23 A;  2DSV A;  4DRM A;  1L1P A;  1FLC A;  4LAX A;  3UQB A;  3AS2 A;  4R5E A;  2MPH A;  5DIU A;  1ROU A;  3H9R B;  4Q22 A;  3FSC A;  1ROT A;  1D7I A;  4QT2 A;  4DH0 A;  3ARY A;  2EZ5 W;  2ITK A;  5HKG A;  5HT1 A;  2ZAJ A;  4QT3 A;  1HKI A;  1JNE A;  2DT2 A;  4ODN A;  4DWS A;  3IHZ A;  3KAG A;  3RM4 A;  4A0U A;  1ZCN A;  1K9Q A;  4IPX A;  5HUA A;  2PBC A;  4DWS C;  3TC5 A;  5GPR A;  5HWB A;  3PQH A;  4TW6 A;  4XAK A;  3MDY B;  4HAR A;  2DK7 A;  3CGM A;  3NRK A;  3CHC A;  2KFW A;  5E66 A;  2WLZ A;  3O5K A;  3WIJ A;  1WNO A;  2DSU A;  4TYO A;  4JFK A;  1D2K A;  2MLY A;  2ZQS A;  3OOB A;  2PPO A;  1O6W A;  4G2P A;  1SR0 A;  2XP6 A;  4DIP A;  1N1A A;  4DRJ A;  4JFL A;  2Q5A A;  5HBF A;  2QF8 A;  3KAF A;  1YAT A;  1W9P A;  4UDM A;  2XP8 A;  3UI6 A;  4ODK A;  2XP5 A;  4FAP A;  3ART A;  3KCE A;  3ALG A;  4Z2H A;  1JMQ A;  3AQU A;  1FJD A;  1JNT A;  4JFJ A;  1QPL A;  4WKA A;  3IKG A;  2JV4 A;  1J4I A;  1Q1C A;  2M8I A;  3O5O A;  2JXW A;  3O5F A;  1KT1 A;  4HBE A;  3WD3 A;  2DJY A;  2LJ4 A;  4ITZ A;  3NTP A;  2B31 A;  3B8S A;  2A3A A;  2OLH A;  3AS1 A;  1FKJ A;  2FDM A;  1TCO C;  2OWO A;  2ZQT A;  1FKL A;  3ARV A;  1ZBV A;  5HTG A;  1FFQ A;  2RQS A;  1E15 A;  3KAD A;  5U47 A;  2P4V A;  3O5E A;  4TW7 A;  3WKZ A;  1GUV A;  3O5I A;  2XPA A;  3MQH A;  1E44 A;  3FAP A;  3LKX B;  3CHF A;  2OFN A;  3I6C A;  3KAC A;  4MNJ A;  2YSB A;  4E5R A;  2D9F A;  2KI3 A;  1A7X A;  4W5U A;  4DRP A;  2YBU A;  4WKH A;  5DIV A;  3FSB A;  1VF8 A;  1W1P A;  2KGJ A;  2VCD A;  5J6E A;  3WD4 A;  1F40 A;  2DG3 A;  2M08 A;  4ODP A;  1GRJ A;  1GOI A;  4U86 A;  3NI6 A;  1SYT A;  3GPK A;  2BA1 A;  2PV2 A;  4Z2G A;  1EG4 A;  4Z2I A;  2DT0 A;  2PV3 A;  2M1I A;  2O9O A;  4IT4 A;  1EYM A;  1WAW A;  4IQC A;  3ALF A;  4L3N A;  4PTM A;  2WLY A;  3CZ8 A;  2ZQV A;  4URI A;  1LG2 A;  4MGV A;  1EHN A;  3RFW A;  4DWS D;  3RM8 A;  2DWV A;  3MCB B;  4R0X A;  1KT0 A;  3B9D A;  2ZQU A;  1FKB A;  1OWQ A;  4NNR A;  4ZPW R;  4WIW A;  1U79 A;  2PPP A;  2RUC A;  4NZC A;  1JVW A;  2A3B A;  2DG9 A;  4J4O A;  4KQZ A;  1FAP A;  1E9L A;  2PN0 A;  2F21 A;  1NWU A;  1NMV A;  3WD1 A;  1FKG A;  3O5D A;  4ZPT R;  4S3K A;  2M3O W;  4TW8 A;  4ODO A;  2DG4 A;  4WK9 A;  3WQV A;  2O92 A;  3KAB A;  3O5G A;  3UI4 A;  1XHG A;  1OGB A;  5GPG A;  4J4N A;  3CHE A;  5D75 A;  4LAW A;  1D7J A;  4A0T A;  1HKM A;  2A3C A;  3G6M A;  3GU0 A;  3RGC A;  3PRA A;  1OGG A;  3AS3 A;  3WQW A;  2FAP A;  4JFI A;  3UI5 A;  4HBO A;  3EY6 A;  3B7X A;  2KO7 A;  1W26 A;  2G41 A;  4TNS A;  2DPE A;  1F8A B;  4LGX A;  2RUQ A;  3ODK A;  1NWT A;  2JZV A;  4GGQ A;  4W9P A;  4P8V A;  3PA7 A;  2RUD A;  2XP9 A;  1FKT A;  1Y0O A;  4QIB A;  3LUO A;  4JYS A;  4C02 B;  5AHT A;  2XP4 A;  1ZBK A;  5E64 A;  4DRN A;  1ZU8 A;  1FKR A;  4DRQ A;  4ZPV R;  2XP7 A;  1H0G A;  1FKH A;  1FKS A;  3UF8 A;  2PI6 A;  1T11 A;  2FKE A;  1WR7 A;  2YAJ B;  1KFW A;  1X6L A;  3KAH A;  3ARS A;  3PRD A;  1WMV A;  1J4R A;  1C9H A;  1B6C A;  1E6Z A;  5I98 A;  1TFV A;  3OA5 A;  1NMW A;  2B5U B;  1LQ0 A;  5DEZ A;  1HJX A;  4ODR A;  3ARR A;  2ETN A;  3O5J A;  1HJV A;  3WH0 A;  2QRV A;  2MLX A;  2KR7 A;  4LAV A;  3W4R A;  4MPK A;  2L2S A;  2DSZ A;  1M5Y A;  2RUR A;  4O2T A;  4ODM A;  5GQB A;  3CH9 A;  4MNL A;  3KAI A;  3ARZ A;  3UQA A;  5DIT A;  2RSE A;  2LPV A;  4IT6 A;  4DRH A;  4DT4 A;  1NWR A;  2LKN A;  1PBK A;  1ZB5 A;  2JMF A;  4DWS B;  1HKJ A;  1W1V A;  2G8Z A;  3ARW A;  1XRV A;  1YW5 A;  1E6R A; 
#chains in the Genus database with same CATH homology
 1EG3 A;  1IX5 A;  1I5H W;  2JX8 A;  5B8I C;  3M85 A;  3IK8 A;  3TCZ A;  1W9U A;  1K9T A;  1W1Y A;  5JH8 A;  5HW6 A;  4ODL A;  1NSG A;  4KR0 B;  3CNG A;  1P5Q A;  3IKD A;  3LKX A;  4W9Q A;  4U85 A;  1FKI A;  4N19 A;  2WAD A;  1QZ2 A;  3ARO A;  1ZL1 A;  4DRK A;  3O5L A;  2XP3 A;  2MNT A;  4REX A;  2YSI A;  3WL0 A;  4U84 A;  1EDQ A;  2YSH A;  1HKK A;  4Z2K A;  4MSP A;  3O5P A;  3WD2 A;  2LGO A;  1H0I A;  4MNK A;  1ITX A;  4FN2 A;  2WK2 A;  2VN1 A;  2F2D A;  1RD6 A;  1X6N A;  1QPF A;  3ARX A;  4Q7N A;  2ZR4 A;  2WM0 A;  2K8I A;  2KXQ A;  1TR8 A;  2LAJ A;  4S3J A;  4JFM A;  1W9V A;  1UR8 A;  2ZR5 A;  4P8W A;  1GPF A;  3PRB A;  2DT3 A;  5DO2 A;  2N87 A;  1Q6I A;  1E6P A;  1LG1 A;  1E6N A;  1BKF A;  4BF8 A;  1BL4 A;  5E5W A;  3ARQ A;  3L4H A;  3MCB A;  1W1T A;  2MDI A;  4AY1 A;  5HW8 A;  2YSF A;  2Y8N B;  4P8U A;  3FS8 A;  5DF0 A;  1D6O A;  2YBT A;  1ZBC A;  3JYM A;  2ESC A;  4DZ3 A;  4ZS6 A;  2UZ5 A;  4DRI A;  4MAV A;  1FD9 A;  4Z2J A;  4L72 B;  4WJX A;  1CTN A;  2L4J A;  1TK7 A;  1LJY A;  1O6I A;  5HWC A;  2AOS A;  1Q6U A;  1JND A;  4P8X A;  4Z2L A;  2E45 A;  3RME A;  2YSG A;  3CGN A;  3VAW A;  1LL7 A;  2WAE A;  1LL4 A;  1PIN A;  1FKK A;  3JXV A;  2KE0 A;  3O5M A;  3RM9 A;  3TDB A;  3B9A A;  4IQ2 A;  3G6L A;  1FFR A;  1Q6H A;  4QZV B;  1EQ3 A;  2MLZ A;  2Y78 A;  2RE3 A;  2M2A A;  3ARU A;  1EIB A;  4ML4 A;  3BXW A;  1NH6 A;  1ZBW A;  3WL1 A;  2DT1 A;  5BXJ A;  1J6Y A;  2M8J A;  5CQ2 A;  1J4H A;  4MTV A;  1FKF A;  1JNS A;  1HXV A;  1WB0 A;  2DSW A;  3O5R A;  3O5Q A;  1ZK6 A;  4MNM A;  4DZ2 A;  4GIV A;  1UR9 A;  4GLX A;  1LL6 A;  3ARP A;  2IUZ A;  4NSB A;  4DRO A;  5E62 A;  3CHD A;  2PPN A;  2F4E A;  2XPB A;  1RP5 A;  3JYJ A;  3LE4 A;  1D7H A;  5E65 A;  2PV1 A;  3FY1 A;  2ZR6 A;  2DMV A;  3UQI A;  3AS0 A;  5HW7 A;  4G50 A;  3MQG A;  4W9O A;  1NWS A;  2A3E A;  1K9R A;  2AWG A;  4ODQ A;  2IF4 A;  2MF9 A;  4LAY A;  2DK1 A;  3FXY A;  3B9E A;  4TX0 A;  1FKD A;  3M7N A;  1R9H A;  3PR9 A;  3KZ7 A;  3WD0 A;  3QOK A;  1HJW A;  4WKF A;  2DSV A;  4DRM A;  1L1P A;  1FLC A;  4LAX A;  3UQB A;  3AS2 A;  4R5E A;  2MPH A;  5DIU A;  1ROU A;  3H9R B;  4Q22 A;  3FSC A;  1ROT A;  1D7I A;  4QT2 A;  4DH0 A;  3ARY A;  2EZ5 W;  2ITK A;  5HKG A;  5HT1 A;  2ZAJ A;  4QT3 A;  1HKI A;  1JNE A;  2DT2 A;  4ODN A;  4DWS A;  3IHZ A;  3KAG A;  3RM4 A;  4A0U A;  1ZCN A;  1K9Q A;  4IPX A;  5HUA A;  2PBC A;  4DWS C;  3TC5 A;  5GPR A;  5HWB A;  3PQH A;  4TW6 A;  4XAK A;  3MDY B;  4HAR A;  2DK7 A;  3CGM A;  3NRK A;  3CHC A;  2KFW A;  5E66 A;  2WLZ A;  3O5K A;  3WIJ A;  1WNO A;  2DSU A;  4TYO A;  4JFK A;  1D2K A;  2MLY A;  2PPO A;  2ZQS A;  3OOB A;  1O6W A;  4G2P A;  1SR0 A;  2XP6 A;  4DIP A;  1N1A A;  4DRJ A;  4JFL A;  2Q5A A;  5HBF A;  2QF8 A;  3KAF A;  1YAT A;  1W9P A;  2XP8 A;  3UI6 A;  4ODK A;  2XP5 A;  4FAP A;  3ART A;  3KCE A;  3ALG A;  4Z2H A;  1JMQ A;  3AQU A;  1FJD A;  1JNT A;  4JFJ A;  1QPL A;  4WKA A;  3IKG A;  2JV4 A;  1J4I A;  1Q1C A;  2M8I A;  3O5O A;  2JXW A;  3O5F A;  1KT1 A;  4HBE A;  3WD3 A;  2DJY A;  2LJ4 A;  4ITZ A;  3NTP A;  2B31 A;  3B8S A;  2A3A A;  2OLH A;  3AS1 A;  1FKJ A;  2FDM A;  1TCO C;  2OWO A;  2ZQT A;  1FKL A;  3ARV A;  1ZBV A;  5HTG A;  1FFQ A;  2RQS A;  1E15 A;  3KAD A;  5U47 A;  3O5E A;  4TW7 A;  3WKZ A;  1GUV A;  3O5I A;  2XPA A;  3MQH A;  3FAP A;  3LKX B;  3CHF A;  2OFN A;  3I6C A;  3KAC A;  4MNJ A;  2YSB A;  4E5R A;  2D9F A;  2KI3 A;  1A7X A;  4W5U A;  4DRP A;  2YBU A;  4WKH A;  5DIV A;  3FSB A;  1VF8 A;  1W1P A;  2KGJ A;  2VCD A;  5J6E A;  3WD4 A;  1F40 A;  2DG3 A;  2M08 A;  4ODP A;  1GOI A;  4U86 A;  3NI6 A;  1SYT A;  3GPK A;  2BA1 A;  2PV2 A;  4Z2G A;  1EG4 A;  4Z2I A;  2DT0 A;  2PV3 A;  2M1I A;  2O9O A;  4IT4 A;  1EYM A;  1WAW A;  4IQC A;  3ALF A;  4L3N A;  4PTM A;  2WLY A;  3CZ8 A;  2ZQV A;  4URI A;  1LG2 A;  4MGV A;  1EHN A;  3RFW A;  4DWS D;  3RM8 A;  2DWV A;  3MCB B;  4R0X A;  1KT0 A;  3B9D A;  2ZQU A;  1FKB A;  1OWQ A;  4NNR A;  4ZPW R;  4WIW A;  1U79 A;  2PPP A;  2RUC A;  4NZC A;  1JVW A;  2A3B A;  2DG9 A;  4J4O A;  4KQZ A;  1FAP A;  1E9L A;  2F21 A;  1NWU A;  1NMV A;  3WD1 A;  1FKG A;  3O5D A;  4ZPT R;  4S3K A;  2M3O W;  4TW8 A;  4ODO A;  2DG4 A;  4WK9 A;  3WQV A;  2O92 A;  3KAB A;  3O5G A;  3UI4 A;  1XHG A;  1OGB A;  5GPG A;  4J4N A;  3CHE A;  5D75 A;  4LAW A;  1D7J A;  4A0T A;  1HKM A;  2A3C A;  3G6M A;  3RGC A;  3PRA A;  1OGG A;  3AS3 A;  3WQW A;  2FAP A;  4JFI A;  3UI5 A;  4HBO A;  3EY6 A;  3B7X A;  2KO7 A;  1W26 A;  2G41 A;  4TNS A;  2DPE A;  1F8A B;  4LGX A;  2RUQ A;  3ODK A;  1NWT A;  2JZV A;  4GGQ A;  4W9P A;  4P8V A;  3PA7 A;  2RUD A;  2XP9 A;  1FKT A;  1Y0O A;  4QIB A;  3LUO A;  4JYS A;  4C02 B;  5AHT A;  2XP4 A;  1ZBK A;  5E64 A;  4DRN A;  1ZU8 A;  1FKR A;  4DRQ A;  4ZPV R;  2XP7 A;  1H0G A;  1FKH A;  1FKS A;  3UF8 A;  2PI6 A;  1T11 A;  2FKE A;  1WR7 A;  2YAJ B;  1KFW A;  1X6L A;  3KAH A;  3ARS A;  3PRD A;  1WMV A;  1J4R A;  1C9H A;  1B6C A;  1E6Z A;  5I98 A;  1TFV A;  3OA5 A;  1NMW A;  1LQ0 A;  5DEZ A;  1HJX A;  4ODR A;  3ARR A;  3O5J A;  1HJV A;  3WH0 A;  2QRV A;  2MLX A;  2KR7 A;  4LAV A;  3W4R A;  4MPK A;  2L2S A;  2DSZ A;  1M5Y A;  2RUR A;  4O2T A;  4ODM A;  5GQB A;  3CH9 A;  4MNL A;  3KAI A;  3ARZ A;  3UQA A;  5DIT A;  2RSE A;  2LPV A;  4IT6 A;  4DRH A;  4DT4 A;  1NWR A;  2LKN A;  1PBK A;  1ZB5 A;  2JMF A;  4DWS B;  1HKJ A;  1W1V A;  2G8Z A;  3ARW A;  1XRV A;  1YW5 A;  1E6R A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...