2ZQUA

Crystal structure of a mutant pin1 peptidyl-prolyl cis-trans isomerase
Total Genus 42
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
42
sequence length
158
structure length
153
Chain Sequence
KLPPGWEKRMSRSSGRVYYFNHITNASQAERPSGGKNGQGEPARVRCSHLLVKHSQSRRPSSWRQEKITRTKEEALELINGYIQKIKSGEEDFESLASQFSDCSSAKARGDLGAFSRGQMQKPFEDASFALRTGEMSGPVFTDSGIHIILRTE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural studies on PIN1 mutants
rcsb
source organism Homo sapiens
molecule tags Isomerase
molecule keywords Peptidyl-prolyl cis-trans isomerase NIMA-interacting 1
total genus 42
structure length 153
sequence length 158
ec nomenclature ec 5.2.1.8: Peptidylprolyl isomerase.
pdb deposition date 2008-08-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00397 WW WW domain
A PF00639 Rotamase PPIC-type PPIASE domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.20.70.10 Mainly Beta Single Sheet Ubiquitin Ligase Nedd4; Chain: W; Ubiquitin Ligase Nedd4; Chain: W; 2zquA01
3.10.50.40 Alpha Beta Roll Chitinase A; domain 3 Chitinase A; domain 3 2zquA02
4G50A 2JXWA 4IPXA 2MDIA 4TW6A 3KZ7A 1B6CA 1D7IA 1NMWA 2LJ4A 2MF9A 3IHZA 3O5LA 3O5RA 4FAPA 2D9FA 4MGVA 2RUQA 4DROA 1PBKA 4DT4A 1ZCNA 1FKHA 1FKIA 2Y78A 1FKFA 4JFKA 2PPOA 4JFLA 5D75A 1PINA 1FJDA 3EY6A 1Q6IA 2ZR5A 1J4IA 1D6OA 2KE0A 4JFIA 4ODPA 1FKDA 2LKNA 4ODRA 4QT2A 4DRKA 5HWBA 1NSGA 2KO7A 2RURA 2F21A 2VN1A 4TYOA 2KXQA 3L4HA 5CQ2A 2M08A 3O5JA 4JFMA 1QPFA 4MSPA 1W26A 1FKRA 2MLYA 3RFWA 4DZ3A 3FAPA 2FKEA 3GPKA 1K9QA 4LAXA 4ODNA 3O5FA 2XP3A 1YW5A 1BKFA 3IKDA 4C02B 3LUOA 1C9HA 4R0XA 4LAVA 5HTGA 4DRQA 1M5YA 2M8JA 1KT1A 1ROUA 1F8AB 2PV2A 3CGMA 1NMVA 2LPVA 3KAFA 3OOBA 1FKJA 1KT0A 1YATA 2PV3A 1HXVA 2PPNA 2RUCA 3UQAA 5HUAA 2XP4A 1Q1CA 1QPLA 2XP5A 2PV1A 1EG3A 2JZVA 2M1IA 3M85A 2UZ5A 3H9RB 3TDBA 1WMVA 4TX0A 2KR7A 4DRPA 2VCDA 4NNRA 4J4NA 5HW6A 2XPBA 2KFWA 1JMQA 1L1PA 1EQ3A 4W9OA 4U84A 2RUDA 1I5HW 5GPGA 2ZQVA 3O5DA 4TW7A 2JV4A 4U86A 2JMFA 3KAIA 1K9RA 2K8IA 4GIVA 5B8IC 3KAHA 1JNTA 3IKGA 2M3OW 1O6WA 1U79A 1D7HA 1FKLA 3CGNA 4N19A 3O5IA 4ODLA 4DRJA 4W9PA 2M8IA 2M2AA 2PBCA 1TK7A 1P5QA 4IQ2A 4DRMA 4DH0A 2MLZA 3JXVA 1A7XA 4IQCA 4TNSA 4LAWA 2PPPA 1Q6UA 5HT1A 5HKGA 2KI3A 4FN2A 3WH0A 1BL4A 3NTPA 1FKTA 3UI6A 2L4JA 2DK1A 2ZAJA 1Y0OA 3JYJA 4ODMA 5J6EA 1JVWA 1Q6HA 1ZK6A 4GGQA 2ITKA 2DWVA 2YSGA 1JNSA 1J4RA 1FKBA 5DITA 1TCOC 2MLXA 2F2DA 2FAPA 2ZQSA 3KADA 2DK7A 2DG9A 4DIPA 2MNTA 1J4HA 3NI6A 3UQBA 3B7XA 2RQSA 3UI5A 3VAWA 3IK8A 5HW7A 5I98A 2DJYA 4QIBA 4U85A 2MPHA 3KAGA 3O5GA 1T11A 4ODQA 3UI4A 5HW8A 4ITZA 1QZ2A 3JYMA 3O5KA 2XP9A 2XP8A 4TW8A 4BF8A 4DRHA 1FKGA 1FKKA 2RSEA 2YSFA 4QT3A 2Q5AA 4DRIA 3O5EA 2KGJA 4DZ2A 5BXJA 1N1AA 3KCEA 2DG4A 1D7JA 2BA1A 2IF4A 4J4OA 5DIUA 3M7NA 3CNGA 4G2PA 2DG3A 5AHTA 4REXA 2F4EA 3RGCA 4ODOA 1F40A 4LAYA 3O5PA 3UQIA 2XP7A 2LAJA 1FAPA 2E45A 4E5RA 2ZR6A 3O5OA 4JYSA 4O2TA 2XPAA 2LGOA 2EZ5W 3ODKA 4ODKA 1FD9A 2OFNA 3I6CA 3O5QA 1R9HA 4JFJA 2YSBA 1J6YA 2ZQTA 5HWCA 1FKSA 5DIVA 1EYMA 2L2SA 3NRKA 3PRDA 4W9QA 2YSHA 3KABA 1ROTA 2JX8A 3TCZA 3KACA 4DRNA 1WR7A 3LE4A 3O5MA 2ZR4A 3PA7A 2ZQUA 2RE3A 2N87A 2AWGA 3MDYB 3PRBA 3UF8A 2DMVA 1EG4A 2YSIA 2XP6A 3TC5A
chains in the Genus database with same CATH superfamily
2JXWA 3ARSA 4TW6A 1W9VA 1B6CA 4FAPA 2D9FA 2RUQA 4DROA 1HJVA 2DSZA 5D75A 1SYTA 4PTMA 1WNOA 1Q6IA 2ZR5A 2KO7A 4TYOA 2KXQA 1W1PA 2M08A 3O5JA 4JFMA 1FKRA 1O6IA 1W26A 2WM0A 3GPKA 4ODNA 3O5FA 5HTGA 1M5YA 2M8JA 1ROUA 2PV2A 3CGMA 1FKJA 1KT0A 2PPNA 5HUAA 2YAJB 1X6NA 4URIA 2UZ5A 3H9RB 1CTNA 3ARPA 2VCDA 4WKFA 2XPBA 1VF8A 2KFWA 1JMQA 4W9OA 3AS2A 2RUDA 5GPGA 3O5DA 4GLXA 2JV4A 4Z2LA 1U79A 4N19A 4ODLA 1ZU8A 2M8IA 3CHFA 1P5QA 1TFVA 3WD3A 4MNLA 3JXVA 5DEZA 1WB0A 3EIPA 4FN2A 1LL4A 1EHNA 4A0UA 4GGQA 4IT6A 3WQVA 2EULA 3BXWA 2F2DA 2FAPA 4P8WA 2DK7A 1UR9A 4DIPA 2WLZA 1X6LA 1JNDA 3ALFA 1XHGA 2O92A 5I98A 3VAWA 1LQ0A 2OLHA 4ODQA 2G41A 3ARQA 2XP8A 4WK9A 1FKKA 2RSEA 2YSFA 2Q5AA 1E15A 3W4RA 4DZ2A 2BA1A 1ZBVA 1GPFA 4G2PA 4W5UA 5AHTA 1H0IA 3O5PA 2LAJA 1NWTA 2ZR6A 4Q7NA 2DT1A 2XPAA 3G6LA 2QF8A 4NZCA 2B5UB 3NRKA 3PRDA 3GU0A 4W9QA 3KABA 1ROTA 1ZBWA 3LE4A 2ZR4A 3PA7A 2N87A 2RE3A 2PI6A 1EG4A 2YSIA 4ODRA 3PR9A 1RD6A 4G50A 4S3JA 1K9TA 2MDIA 1JCHB 2G8ZA 1NMWA 1UR8A 1E44A 3IHZA 3O5RA 4DT4A 1PBKA 1ZCNA 4JFLA 1FKFA 4JFKA 1ZBCA 3ALGA 3ARUA 1PINA 1FJDA 4JFIA 4QT2A 1FKDA 3FSCA 3PQHA 1NSGA 3MCBB 2F21A 2RURA 1LL7A 3WKZA 4DZ3A 3RM4A 2XP3A 4R0XA 4LAVA 3WQWA 1F8AB 3WD4A 4P8VA 1YATA 2PV3A 5DO2A 1Q1CA 1QPLA 3LKXA 2M1IA 4NNRA 1NWSA 3AQUA 3CZ8A 2ZQVA 3MQHA 4GIVA 3AS3A 1JNTA 1W1TA 1ZB5A 3O5IA 3WL0A 4DRJA 4LGXA 2PBCA 4IQ2A 4DRMA 2MLZA 4IQCA 4MAVA 3CHEA 3ARRA 2KI3A 3WH0A 1BL4A 3NTPA 4Z2KA 4A0TA 1Y0OA 2DT0A 4ODMA 1Q6HA 1JNSA 2DWVA 1LG2A 5DITA 1TCOC 4ZPWR 1IX5A 3KADA 1ITXA 2WADA 2AOSA 3MCBA 2RQSA 3IK8A 2DJYA 2F23A 5JH8A 3AS1A 4ITZA 3ARXA 4BF8A 3FY1A 1OWQA 1N1AA 3KCEA 2DG4A 5DIUA 3M7NA 1F40A 3RGCA 3O5OA 4JYSA 1ZBKA 1HJXA 2LGOA 2OFNA 3B9DA 1J6YA 2DSVA 4Z2IA 5HWCA 5DIVA 2L2SA 3TCZA 2IUZA 4S3KA 1WR7A 2DT2A 1W9UA 3CH9A 3PRBA 3B7XA 2XP6A 4WIWA 4IPXA 3KZ7A 4Z2JA 2LJ4A 3O5LA 4MGVA 1FKIA 5U47A 3EY6A 1D6OA 4DRKA 4ODPA 1FFRA 5HWBA 2VN1A 4QZVB 1E9LA 2MLYA 3QOKA 3FAPA 2FKEA 4L72B 1BKFA 3IKDA 4C02B 3LUOA 1C9HA 4DRQA 1NMVA 3G6MA 3KAFA 5E65A 1W1VA 2XP4A 3BMBA 2XP5A 4MNJA 3WD1A 2KR7A 4DRPA 1HKIA 4J4NA 5HW6A 1EQ3A 1ZL1A 4U84A 2A3EA 1I5HW 1JNEA 4TW7A 3LKXB 2Y8NB 2JMFA 1K9RA 2K8IA 3KAHA 1NWUA 1FKLA 5E66A 4ML4A 1TK7A 4Z2GA 5E5WA 1OGBA 4LAWA 2B31A 5DF0A 1Q6UA 5HKGA 1HJWA 2L4JA 2ZAJA 2A3CA 2DT3A 1ZK6A 1EDQA 4DWSC 2YSGA 2DSWA 1FKBA 1H0GA 1KFWA 4P8XA 1E6RA 4MTVA 1E6ZA 3PRAA 1W1YA 2MNTA 4L3NA 3UQBA 5HW7A 4QIBA 3UI4A 3KAGA 1QZ2A 3JYMA 3WL1A 4KQZA 2XP9A 1FKGA 3ARWA 4DRIA 3O5EA 2KGJA 5BXJA 2IF4A 4J4OA 4ZPVR 1HKMA 4ZPTR 2DG3A 2F4EA 4REXA 4ODOA 4LAYA 3UQIA 4R5EA 1NWRA 2XP7A 4O2TA 2E45A 4DWSA 1E6PA 1FLCA 4JFJA 1R9HA 1FFQA 2YSBA 2O9OA 2P4VA 4WJXA 4UDMA 1EYMA 4MPKA 1HKKA 4WKAA 1W9PA 2WK2A 3KACA 2DSUA 3RMEA 4AY1A 3O5MA 2QRVA 3UF8A 2ZQUA 3CHDA 5GPRA 2AWGA 3UI6A 2A3AA 1NH6A 1OGGA 5E64A 3B9AA 1D7IA 2MF9A 3ARVA 1XRVA 1FKHA 1GUVA 2Y78A 2PPOA 1GRJA 3FS8A 1J4IA 1EIBA 2KE0A 2LKNA 4HARA 3FXYA 2PN0A 3L4HA 5CQ2A 4MSPA 1QPFA 5GQBA 3RFWA 4LAXA 1K9QA 2DPEA 1YW5A 1KT1A 2LPVA 3OOBA 2A3BA 3WD2A 1HXVA 2RUCA 1WAWA 3UQAA 2PV1A 1EG3A 2JZVA 4TX0A 3M85A 3TDBA 1TR8A 1WMVA 4Q22A 1D2KA 4DWSB 4P8UA 3AS0A 1L1PA 4WKHA 5E62A 4U86A 3KAIA 5B8IC 1GOIA 1E6NA 3IKGA 2M3OW 1O6WA 3GTYX 1D7HA 3CGNA 1LG1A 4HBOA 4MNMA 4KR0B 4W9PA 4HBEA 2M2AA 2OWOA 3WIJA 3RM8A 4DH0A 2WLYA 1A7XA 4TNSA 1HKJA 2PPPA 5HT1A 1FKTA 4IT4A 2DK1A 3JYJA 4NSBA 5J6EA 1JVWA 2ITKA 2ETNA 1J4RA 3OA5A 2YBUA 3MQGA 2MLXA 4XAKA 2ZQSA 2DG9A 1J4HA 3NI6A 1RP5A 1LJYA 3UI5A 5HW8A 4U85A 2MPHA 3O5GA 1T11A 3O5KA 4TW8A 4DRHA 3ARYA 4QT3A 3B8SA 1D7JA 4Z2HA 3CNGA 3RM9A 1LL6A 1SR0A 2FDMA 3CHCA 1FAPA 4E5RA 4MNKA 5HBFA 3WD0A 2WAEA 2EZ5W 3ODKA 3ARTA 4DWSD 4ODKA 1FD9A 3I6CA 3O5QA 3FSBA 2ZQTA 1FKSA 3B9EA 2YSHA 2JX8A 4DRNA 3AROA 3MDYB 4ZS6A 2ESCA 3ARZA 2DMVA 2YBTA 3TC5A
chains in the Genus database with same CATH topology
2JXWA 3ARSA 4TW6A 1W9VA 1B6CA 4FAPA 2D9FA 2RUQA 4DROA 1HJVA 2DSZA 5D75A 1SYTA 4PTMA 1WNOA 1Q6IA 2ZR5A 2KO7A 4TYOA 2KXQA 1W1PA 2M08A 3O5JA 4JFMA 1FKRA 1O6IA 1W26A 2WM0A 3GPKA 4ODNA 3O5FA 5HTGA 1M5YA 2M8JA 1ROUA 2PV2A 3CGMA 1FKJA 1KT0A 2PPNA 5HUAA 2YAJB 1X6NA 4URIA 2UZ5A 3H9RB 1CTNA 3ARPA 2VCDA 4WKFA 2XPBA 1VF8A 2KFWA 1JMQA 4W9OA 3AS2A 2RUDA 5GPGA 3O5DA 4GLXA 2JV4A 4Z2LA 1U79A 4N19A 4ODLA 1ZU8A 2M8IA 3CHFA 1P5QA 1TFVA 3WD3A 4MNLA 3JXVA 5DEZA 1WB0A 4FN2A 1LL4A 1EHNA 4A0UA 4GGQA 4IT6A 3WQVA 3BXWA 2F2DA 2FAPA 4P8WA 2DK7A 1UR9A 4DIPA 2WLZA 1X6LA 1JNDA 3ALFA 1XHGA 2O92A 5I98A 3VAWA 1LQ0A 2OLHA 4ODQA 2G41A 3ARQA 2XP8A 4WK9A 1FKKA 2RSEA 2YSFA 2Q5AA 1E15A 3W4RA 4DZ2A 2BA1A 1ZBVA 1GPFA 4G2PA 4W5UA 5AHTA 1H0IA 3O5PA 2LAJA 1NWTA 2ZR6A 4Q7NA 2DT1A 2XPAA 3G6LA 2QF8A 4NZCA 3NRKA 3PRDA 4W9QA 3KABA 1ROTA 1ZBWA 3LE4A 2ZR4A 3PA7A 2N87A 2RE3A 2PI6A 1EG4A 2YSIA 4ODRA 3PR9A 1RD6A 4G50A 4S3JA 1K9TA 2MDIA 2G8ZA 1NMWA 1UR8A 3IHZA 3O5RA 4DT4A 1PBKA 1ZCNA 4JFLA 1FKFA 4JFKA 1ZBCA 3ALGA 3ARUA 1PINA 1FJDA 4JFIA 4QT2A 1FKDA 3FSCA 3PQHA 1NSGA 3MCBB 2F21A 2RURA 1LL7A 3WKZA 4DZ3A 3RM4A 2XP3A 4R0XA 4LAVA 3WQWA 1F8AB 3WD4A 4P8VA 1YATA 2PV3A 5DO2A 1Q1CA 1QPLA 3LKXA 2M1IA 4NNRA 1NWSA 3AQUA 3CZ8A 2ZQVA 3MQHA 4GIVA 3AS3A 1JNTA 1W1TA 1ZB5A 3O5IA 3WL0A 4DRJA 4LGXA 2PBCA 4IQ2A 4DRMA 2MLZA 4IQCA 4MAVA 3CHEA 3ARRA 2KI3A 3WH0A 1BL4A 3NTPA 4Z2KA 4A0TA 1Y0OA 2DT0A 4ODMA 1Q6HA 1JNSA 2DWVA 1LG2A 5DITA 1TCOC 4ZPWR 1IX5A 3KADA 1ITXA 2WADA 2AOSA 3MCBA 2RQSA 3IK8A 2DJYA 5JH8A 3AS1A 4ITZA 3ARXA 4BF8A 3FY1A 1OWQA 1N1AA 3KCEA 2DG4A 5DIUA 3M7NA 1F40A 3RGCA 3O5OA 4JYSA 1ZBKA 1HJXA 2LGOA 2OFNA 3B9DA 1J6YA 2DSVA 4Z2IA 5HWCA 5DIVA 2L2SA 3TCZA 2IUZA 4S3KA 1WR7A 2DT2A 1W9UA 3CH9A 3PRBA 3B7XA 2XP6A 4WIWA 4IPXA 3KZ7A 4Z2JA 2LJ4A 3O5LA 4MGVA 1FKIA 5U47A 3EY6A 1D6OA 4DRKA 4ODPA 1FFRA 5HWBA 2VN1A 4QZVB 1E9LA 2MLYA 3QOKA 3FAPA 2FKEA 4L72B 1BKFA 3IKDA 4C02B 3LUOA 1C9HA 4DRQA 1NMVA 3G6MA 3KAFA 5E65A 1W1VA 2XP4A 2XP5A 4MNJA 3WD1A 2KR7A 4DRPA 1HKIA 4J4NA 5HW6A 1EQ3A 1ZL1A 4U84A 2A3EA 1I5HW 1JNEA 4TW7A 3LKXB 2Y8NB 2JMFA 1K9RA 2K8IA 3KAHA 1NWUA 1FKLA 5E66A 4ML4A 1TK7A 4Z2GA 5E5WA 1OGBA 4LAWA 2B31A 5DF0A 1Q6UA 5HKGA 1HJWA 2L4JA 2ZAJA 2A3CA 2DT3A 1ZK6A 1EDQA 4DWSC 2YSGA 2DSWA 1FKBA 1H0GA 1KFWA 4P8XA 1E6RA 4MTVA 1E6ZA 3PRAA 1W1YA 2MNTA 4L3NA 3UQBA 5HW7A 4QIBA 3UI4A 3KAGA 1QZ2A 3JYMA 3WL1A 4KQZA 2XP9A 1FKGA 3ARWA 4DRIA 3O5EA 2KGJA 5BXJA 2IF4A 4J4OA 4ZPVR 1HKMA 4ZPTR 2DG3A 2F4EA 4REXA 4ODOA 4LAYA 3UQIA 4R5EA 1NWRA 2XP7A 4O2TA 2E45A 4DWSA 1E6PA 1FLCA 4JFJA 1R9HA 1FFQA 2YSBA 2O9OA 4WJXA 1EYMA 4MPKA 1HKKA 4WKAA 1W9PA 2WK2A 3KACA 2DSUA 3RMEA 4AY1A 3O5MA 2QRVA 3UF8A 2ZQUA 3CHDA 5GPRA 2AWGA 3UI6A 2A3AA 1NH6A 1OGGA 5E64A 3B9AA 1D7IA 2MF9A 3ARVA 1XRVA 1FKHA 1GUVA 2Y78A 2PPOA 3FS8A 1J4IA 1EIBA 2KE0A 2LKNA 4HARA 3FXYA 3L4HA 5CQ2A 4MSPA 1QPFA 5GQBA 3RFWA 4LAXA 1K9QA 2DPEA 1YW5A 1KT1A 2LPVA 3OOBA 2A3BA 3WD2A 1HXVA 2RUCA 1WAWA 3UQAA 2PV1A 1EG3A 2JZVA 4TX0A 3M85A 3TDBA 1TR8A 1WMVA 4Q22A 1D2KA 4DWSB 4P8UA 3AS0A 1L1PA 4WKHA 5E62A 4U86A 3KAIA 5B8IC 1GOIA 1E6NA 3IKGA 2M3OW 1O6WA 1D7HA 3CGNA 1LG1A 4HBOA 4MNMA 4KR0B 4W9PA 4HBEA 2M2AA 2OWOA 3WIJA 3RM8A 4DH0A 2WLYA 1A7XA 4TNSA 1HKJA 2PPPA 5HT1A 1FKTA 4IT4A 2DK1A 3JYJA 4NSBA 5J6EA 1JVWA 2ITKA 1J4RA 3OA5A 2YBUA 3MQGA 2MLXA 4XAKA 2ZQSA 2DG9A 1J4HA 3NI6A 1RP5A 1LJYA 3UI5A 5HW8A 4U85A 2MPHA 3O5GA 1T11A 3O5KA 4TW8A 4DRHA 3ARYA 4QT3A 3B8SA 1D7JA 4Z2HA 3CNGA 3RM9A 1LL6A 1SR0A 2FDMA 3CHCA 1FAPA 4E5RA 4MNKA 5HBFA 3WD0A 2WAEA 2EZ5W 3ODKA 3ARTA 4DWSD 4ODKA 1FD9A 3I6CA 3O5QA 3FSBA 2ZQTA 1FKSA 3B9EA 2YSHA 2JX8A 4DRNA 3AROA 3MDYB 4ZS6A 2ESCA 3ARZA 2DMVA 2YBTA 3TC5A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4G50 A;  2JXW A;  4IPX A;  2MDI A;  4TW6 A;  3KZ7 A;  1B6C A;  1D7I A;  1NMW A;  2LJ4 A;  2MF9 A;  3IHZ A;  3O5L A;  3O5R A;  4FAP A;  2D9F A;  4MGV A;  2RUQ A;  4DRO A;  1PBK A;  4DT4 A;  1ZCN A;  1FKH A;  1FKI A;  2Y78 A;  1FKF A;  4JFK A;  2PPO A;  4JFL A;  5D75 A;  1PIN A;  1FJD A;  3EY6 A;  1Q6I A;  2ZR5 A;  1J4I A;  1D6O A;  2KE0 A;  4JFI A;  4ODP A;  1FKD A;  2LKN A;  4ODR A;  4QT2 A;  4DRK A;  5HWB A;  1NSG A;  2KO7 A;  2RUR A;  2F21 A;  2VN1 A;  4TYO A;  2KXQ A;  3L4H A;  5CQ2 A;  2M08 A;  3O5J A;  4JFM A;  1QPF A;  4MSP A;  1W26 A;  1FKR A;  2MLY A;  3RFW A;  4DZ3 A;  3FAP A;  2FKE A;  3GPK A;  1K9Q A;  4LAX A;  4ODN A;  3O5F A;  2XP3 A;  1YW5 A;  1BKF A;  3IKD A;  4C02 B;  3LUO A;  1C9H A;  4R0X A;  4LAV A;  5HTG A;  4DRQ A;  1M5Y A;  2M8J A;  1KT1 A;  1ROU A;  1F8A B;  2PV2 A;  3CGM A;  1NMV A;  2LPV A;  3KAF A;  3OOB A;  1FKJ A;  1KT0 A;  1YAT A;  2PV3 A;  1HXV A;  2PPN A;  2RUC A;  3UQA A;  5HUA A;  2XP4 A;  1Q1C A;  1QPL A;  2XP5 A;  2PV1 A;  1EG3 A;  2JZV A;  2M1I A;  3M85 A;  2UZ5 A;  3H9R B;  3TDB A;  1WMV A;  4TX0 A;  2KR7 A;  4DRP A;  2VCD A;  4NNR A;  4J4N A;  5HW6 A;  2XPB A;  2KFW A;  1JMQ A;  1L1P A;  1EQ3 A;  4W9O A;  4U84 A;  2RUD A;  1I5H W;  5GPG A;  2ZQV A;  3O5D A;  4TW7 A;  2JV4 A;  4U86 A;  2JMF A;  3KAI A;  1K9R A;  2K8I A;  4GIV A;  5B8I C;  3KAH A;  1JNT A;  3IKG A;  2M3O W;  1O6W A;  1U79 A;  1D7H A;  1FKL A;  3CGN A;  4N19 A;  3O5I A;  4ODL A;  4DRJ A;  4W9P A;  2M8I A;  2M2A A;  2PBC A;  1TK7 A;  1P5Q A;  4IQ2 A;  4DRM A;  4DH0 A;  2MLZ A;  3JXV A;  1A7X A;  4IQC A;  4TNS A;  4LAW A;  2PPP A;  1Q6U A;  5HT1 A;  5HKG A;  2KI3 A;  4FN2 A;  3WH0 A;  1BL4 A;  3NTP A;  1FKT A;  3UI6 A;  2L4J A;  2DK1 A;  2ZAJ A;  1Y0O A;  3JYJ A;  4ODM A;  5J6E A;  1JVW A;  1Q6H A;  1ZK6 A;  4GGQ A;  2ITK A;  2DWV A;  2YSG A;  1JNS A;  1J4R A;  1FKB A;  5DIT A;  1TCO C;  2MLX A;  2F2D A;  2FAP A;  2ZQS A;  3KAD A;  2DK7 A;  2DG9 A;  4DIP A;  2MNT A;  1J4H A;  3NI6 A;  3UQB A;  3B7X A;  2RQS A;  3UI5 A;  3VAW A;  3IK8 A;  5HW7 A;  5I98 A;  2DJY A;  4QIB A;  4U85 A;  2MPH A;  3KAG A;  3O5G A;  1T11 A;  4ODQ A;  3UI4 A;  5HW8 A;  4ITZ A;  1QZ2 A;  3JYM A;  3O5K A;  2XP9 A;  2XP8 A;  4TW8 A;  4BF8 A;  4DRH A;  1FKG A;  1FKK A;  2RSE A;  2YSF A;  4QT3 A;  2Q5A A;  4DRI A;  3O5E A;  2KGJ A;  4DZ2 A;  5BXJ A;  1N1A A;  3KCE A;  2DG4 A;  1D7J A;  2BA1 A;  2IF4 A;  4J4O A;  5DIU A;  3M7N A;  3CNG A;  4G2P A;  2DG3 A;  5AHT A;  4REX A;  2F4E A;  3RGC A;  4ODO A;  1F40 A;  4LAY A;  3O5P A;  3UQI A;  2XP7 A;  2LAJ A;  1FAP A;  2E45 A;  4E5R A;  2ZR6 A;  3O5O A;  4JYS A;  4O2T A;  2XPA A;  2LGO A;  2EZ5 W;  3ODK A;  4ODK A;  1FD9 A;  2OFN A;  3I6C A;  3O5Q A;  1R9H A;  4JFJ A;  2YSB A;  1J6Y A;  2ZQT A;  5HWC A;  1FKS A;  5DIV A;  1EYM A;  2L2S A;  3NRK A;  3PRD A;  4W9Q A;  2YSH A;  3KAB A;  1ROT A;  2JX8 A;  3TCZ A;  3KAC A;  4DRN A;  1WR7 A;  3LE4 A;  3O5M A;  2ZR4 A;  3PA7 A;  2ZQU A;  2RE3 A;  2N87 A;  2AWG A;  3MDY B;  3PRB A;  3UF8 A;  2DMV A;  1EG4 A;  2YSI A;  2XP6 A;  3TC5 A; 
#chains in the Genus database with same CATH topology
 2JXW A;  3ARS A;  4TW6 A;  1W9V A;  1B6C A;  4FAP A;  2D9F A;  2RUQ A;  4DRO A;  1HJV A;  2DSZ A;  5D75 A;  1SYT A;  4PTM A;  1WNO A;  1Q6I A;  2ZR5 A;  2KO7 A;  4TYO A;  2KXQ A;  1W1P A;  2M08 A;  3O5J A;  4JFM A;  1FKR A;  1O6I A;  1W26 A;  2WM0 A;  3GPK A;  4ODN A;  3O5F A;  5HTG A;  1M5Y A;  2M8J A;  1ROU A;  2PV2 A;  3CGM A;  1FKJ A;  1KT0 A;  2PPN A;  5HUA A;  2YAJ B;  1X6N A;  4URI A;  2UZ5 A;  3H9R B;  1CTN A;  3ARP A;  2VCD A;  4WKF A;  2XPB A;  1VF8 A;  2KFW A;  1JMQ A;  4W9O A;  3AS2 A;  2RUD A;  5GPG A;  3O5D A;  4GLX A;  2JV4 A;  4Z2L A;  1U79 A;  4N19 A;  4ODL A;  1ZU8 A;  2M8I A;  3CHF A;  1P5Q A;  1TFV A;  3WD3 A;  4MNL A;  3JXV A;  5DEZ A;  1WB0 A;  3EIP A;  4FN2 A;  1LL4 A;  1EHN A;  4A0U A;  4GGQ A;  4IT6 A;  3WQV A;  2EUL A;  3BXW A;  2F2D A;  2FAP A;  4P8W A;  2DK7 A;  1UR9 A;  4DIP A;  2WLZ A;  1X6L A;  1JND A;  3ALF A;  1XHG A;  2O92 A;  5I98 A;  3VAW A;  1LQ0 A;  2OLH A;  4ODQ A;  2G41 A;  3ARQ A;  2XP8 A;  4WK9 A;  1FKK A;  2RSE A;  2YSF A;  2Q5A A;  1E15 A;  3W4R A;  4DZ2 A;  2BA1 A;  1ZBV A;  1GPF A;  4G2P A;  4W5U A;  5AHT A;  1H0I A;  3O5P A;  2LAJ A;  1NWT A;  2ZR6 A;  4Q7N A;  2DT1 A;  2XPA A;  3G6L A;  2QF8 A;  4NZC A;  2B5U B;  3NRK A;  3PRD A;  3GU0 A;  4W9Q A;  3KAB A;  1ROT A;  1ZBW A;  3LE4 A;  2ZR4 A;  3PA7 A;  2N87 A;  2RE3 A;  2PI6 A;  1EG4 A;  2YSI A;  4ODR A;  3PR9 A;  1RD6 A;  4G50 A;  4S3J A;  1K9T A;  2MDI A;  1JCH B;  2G8Z A;  1NMW A;  1UR8 A;  1E44 A;  3IHZ A;  3O5R A;  4DT4 A;  1PBK A;  1ZCN A;  4JFL A;  1FKF A;  4JFK A;  1ZBC A;  3ALG A;  3ARU A;  1PIN A;  1FJD A;  4JFI A;  4QT2 A;  1FKD A;  3FSC A;  3PQH A;  1NSG A;  3MCB B;  2F21 A;  2RUR A;  1LL7 A;  3WKZ A;  4DZ3 A;  3RM4 A;  2XP3 A;  4R0X A;  4LAV A;  3WQW A;  1F8A B;  3WD4 A;  4P8V A;  1YAT A;  2PV3 A;  5DO2 A;  1Q1C A;  1QPL A;  3LKX A;  2M1I A;  4NNR A;  1NWS A;  3AQU A;  3CZ8 A;  2ZQV A;  3MQH A;  4GIV A;  3AS3 A;  1JNT A;  1W1T A;  1ZB5 A;  3O5I A;  3WL0 A;  4DRJ A;  4LGX A;  2PBC A;  4IQ2 A;  4DRM A;  2MLZ A;  4IQC A;  4MAV A;  3CHE A;  3ARR A;  2KI3 A;  3WH0 A;  1BL4 A;  3NTP A;  4Z2K A;  4A0T A;  1Y0O A;  2DT0 A;  4ODM A;  1Q6H A;  1JNS A;  2DWV A;  1LG2 A;  5DIT A;  1TCO C;  4ZPW R;  1IX5 A;  3KAD A;  1ITX A;  2WAD A;  2AOS A;  3MCB A;  2RQS A;  3IK8 A;  2DJY A;  2F23 A;  5JH8 A;  3AS1 A;  4ITZ A;  3ARX A;  4BF8 A;  3FY1 A;  1OWQ A;  1N1A A;  3KCE A;  2DG4 A;  5DIU A;  3M7N A;  1F40 A;  3RGC A;  3O5O A;  4JYS A;  1ZBK A;  1HJX A;  2LGO A;  2OFN A;  3B9D A;  1J6Y A;  2DSV A;  4Z2I A;  5HWC A;  5DIV A;  2L2S A;  3TCZ A;  2IUZ A;  4S3K A;  1WR7 A;  2DT2 A;  1W9U A;  3CH9 A;  3PRB A;  3B7X A;  2XP6 A;  4WIW A;  4IPX A;  3KZ7 A;  4Z2J A;  2LJ4 A;  3O5L A;  4MGV A;  1FKI A;  5U47 A;  3EY6 A;  1D6O A;  4DRK A;  4ODP A;  1FFR A;  5HWB A;  2VN1 A;  4QZV B;  1E9L A;  2MLY A;  3QOK A;  3FAP A;  2FKE A;  4L72 B;  1BKF A;  3IKD A;  4C02 B;  3LUO A;  1C9H A;  4DRQ A;  1NMV A;  3G6M A;  3KAF A;  5E65 A;  1W1V A;  2XP4 A;  3BMB A;  2XP5 A;  4MNJ A;  3WD1 A;  2KR7 A;  4DRP A;  1HKI A;  4J4N A;  5HW6 A;  1EQ3 A;  1ZL1 A;  4U84 A;  2A3E A;  1I5H W;  1JNE A;  4TW7 A;  3LKX B;  2Y8N B;  2JMF A;  1K9R A;  2K8I A;  3KAH A;  1NWU A;  1FKL A;  5E66 A;  4ML4 A;  1TK7 A;  4Z2G A;  5E5W A;  1OGB A;  4LAW A;  2B31 A;  5DF0 A;  1Q6U A;  5HKG A;  1HJW A;  2L4J A;  2ZAJ A;  2A3C A;  2DT3 A;  1ZK6 A;  1EDQ A;  4DWS C;  2YSG A;  2DSW A;  1FKB A;  1H0G A;  1KFW A;  4P8X A;  1E6R A;  4MTV A;  1E6Z A;  3PRA A;  1W1Y A;  2MNT A;  4L3N A;  3UQB A;  5HW7 A;  4QIB A;  3UI4 A;  3KAG A;  1QZ2 A;  3JYM A;  3WL1 A;  4KQZ A;  2XP9 A;  1FKG A;  3ARW A;  4DRI A;  3O5E A;  2KGJ A;  5BXJ A;  2IF4 A;  4J4O A;  4ZPV R;  1HKM A;  4ZPT R;  2DG3 A;  2F4E A;  4REX A;  4ODO A;  4LAY A;  3UQI A;  4R5E A;  1NWR A;  2XP7 A;  4O2T A;  2E45 A;  4DWS A;  1E6P A;  1FLC A;  4JFJ A;  1R9H A;  1FFQ A;  2YSB A;  2O9O A;  2P4V A;  4WJX A;  4UDM A;  1EYM A;  4MPK A;  1HKK A;  4WKA A;  1W9P A;  2WK2 A;  3KAC A;  2DSU A;  3RME A;  4AY1 A;  3O5M A;  2QRV A;  3UF8 A;  2ZQU A;  3CHD A;  5GPR A;  2AWG A;  3UI6 A;  2A3A A;  1NH6 A;  1OGG A;  5E64 A;  3B9A A;  1D7I A;  2MF9 A;  3ARV A;  1XRV A;  1FKH A;  1GUV A;  2Y78 A;  2PPO A;  1GRJ A;  3FS8 A;  1J4I A;  1EIB A;  2KE0 A;  2LKN A;  4HAR A;  3FXY A;  2PN0 A;  3L4H A;  5CQ2 A;  4MSP A;  1QPF A;  5GQB A;  3RFW A;  4LAX A;  1K9Q A;  2DPE A;  1YW5 A;  1KT1 A;  2LPV A;  3OOB A;  2A3B A;  3WD2 A;  1HXV A;  2RUC A;  1WAW A;  3UQA A;  2PV1 A;  1EG3 A;  2JZV A;  4TX0 A;  3M85 A;  3TDB A;  1TR8 A;  1WMV A;  4Q22 A;  1D2K A;  4DWS B;  4P8U A;  3AS0 A;  1L1P A;  4WKH A;  5E62 A;  4U86 A;  3KAI A;  5B8I C;  1GOI A;  1E6N A;  3IKG A;  2M3O W;  1O6W A;  3GTY X;  1D7H A;  3CGN A;  1LG1 A;  4HBO A;  4MNM A;  4KR0 B;  4W9P A;  4HBE A;  2M2A A;  2OWO A;  3WIJ A;  3RM8 A;  4DH0 A;  2WLY A;  1A7X A;  4TNS A;  1HKJ A;  2PPP A;  5HT1 A;  1FKT A;  4IT4 A;  2DK1 A;  3JYJ A;  4NSB A;  5J6E A;  1JVW A;  2ITK A;  2ETN A;  1J4R A;  3OA5 A;  2YBU A;  3MQG A;  2MLX A;  4XAK A;  2ZQS A;  2DG9 A;  1J4H A;  3NI6 A;  1RP5 A;  1LJY A;  3UI5 A;  5HW8 A;  4U85 A;  2MPH A;  3O5G A;  1T11 A;  3O5K A;  4TW8 A;  4DRH A;  3ARY A;  4QT3 A;  3B8S A;  1D7J A;  4Z2H A;  3CNG A;  3RM9 A;  1LL6 A;  1SR0 A;  2FDM A;  3CHC A;  1FAP A;  4E5R A;  4MNK A;  5HBF A;  3WD0 A;  2WAE A;  2EZ5 W;  3ODK A;  3ART A;  4DWS D;  4ODK A;  1FD9 A;  3I6C A;  3O5Q A;  3FSB A;  2ZQT A;  1FKS A;  3B9E A;  2YSH A;  2JX8 A;  4DRN A;  3ARO A;  3MDY B;  4ZS6 A;  2ESC A;  3ARZ A;  2DMV A;  2YBT A;  3TC5 A; 
#chains in the Genus database with same CATH homology
 2JXW A;  3ARS A;  4TW6 A;  1W9V A;  1B6C A;  4FAP A;  2D9F A;  2RUQ A;  4DRO A;  1HJV A;  2DSZ A;  5D75 A;  1SYT A;  4PTM A;  1WNO A;  1Q6I A;  2ZR5 A;  2KO7 A;  4TYO A;  2KXQ A;  1W1P A;  2M08 A;  3O5J A;  4JFM A;  1FKR A;  1O6I A;  1W26 A;  2WM0 A;  3GPK A;  4ODN A;  3O5F A;  5HTG A;  1M5Y A;  2M8J A;  1ROU A;  2PV2 A;  3CGM A;  1FKJ A;  1KT0 A;  2PPN A;  5HUA A;  2YAJ B;  1X6N A;  4URI A;  2UZ5 A;  3H9R B;  1CTN A;  3ARP A;  2VCD A;  4WKF A;  2XPB A;  1VF8 A;  2KFW A;  1JMQ A;  4W9O A;  3AS2 A;  2RUD A;  5GPG A;  3O5D A;  4GLX A;  2JV4 A;  4Z2L A;  1U79 A;  4N19 A;  4ODL A;  1ZU8 A;  2M8I A;  3CHF A;  1P5Q A;  1TFV A;  3WD3 A;  4MNL A;  3JXV A;  5DEZ A;  1WB0 A;  4FN2 A;  1LL4 A;  1EHN A;  4A0U A;  4GGQ A;  4IT6 A;  3WQV A;  3BXW A;  2F2D A;  2FAP A;  4P8W A;  2DK7 A;  1UR9 A;  4DIP A;  2WLZ A;  1X6L A;  1JND A;  3ALF A;  1XHG A;  2O92 A;  5I98 A;  3VAW A;  1LQ0 A;  2OLH A;  4ODQ A;  2G41 A;  3ARQ A;  2XP8 A;  4WK9 A;  1FKK A;  2RSE A;  2YSF A;  2Q5A A;  1E15 A;  3W4R A;  4DZ2 A;  2BA1 A;  1ZBV A;  1GPF A;  4G2P A;  4W5U A;  5AHT A;  1H0I A;  3O5P A;  2LAJ A;  1NWT A;  2ZR6 A;  4Q7N A;  2DT1 A;  2XPA A;  3G6L A;  2QF8 A;  4NZC A;  3NRK A;  3PRD A;  4W9Q A;  3KAB A;  1ROT A;  1ZBW A;  3LE4 A;  2ZR4 A;  3PA7 A;  2N87 A;  2RE3 A;  2PI6 A;  1EG4 A;  2YSI A;  4ODR A;  3PR9 A;  1RD6 A;  4G50 A;  4S3J A;  1K9T A;  2MDI A;  2G8Z A;  1NMW A;  1UR8 A;  3IHZ A;  3O5R A;  4DT4 A;  1PBK A;  1ZCN A;  4JFL A;  1FKF A;  4JFK A;  1ZBC A;  3ALG A;  3ARU A;  1PIN A;  1FJD A;  4JFI A;  4QT2 A;  1FKD A;  3FSC A;  3PQH A;  1NSG A;  3MCB B;  2F21 A;  2RUR A;  1LL7 A;  3WKZ A;  4DZ3 A;  3RM4 A;  2XP3 A;  4R0X A;  4LAV A;  3WQW A;  1F8A B;  3WD4 A;  4P8V A;  1YAT A;  2PV3 A;  5DO2 A;  1Q1C A;  1QPL A;  3LKX A;  2M1I A;  4NNR A;  1NWS A;  3AQU A;  3CZ8 A;  2ZQV A;  3MQH A;  4GIV A;  3AS3 A;  1JNT A;  1W1T A;  1ZB5 A;  3O5I A;  3WL0 A;  4DRJ A;  4LGX A;  2PBC A;  4IQ2 A;  4DRM A;  2MLZ A;  4IQC A;  4MAV A;  3CHE A;  3ARR A;  2KI3 A;  3WH0 A;  1BL4 A;  3NTP A;  4Z2K A;  4A0T A;  1Y0O A;  2DT0 A;  4ODM A;  1Q6H A;  1JNS A;  2DWV A;  1LG2 A;  5DIT A;  1TCO C;  4ZPW R;  1IX5 A;  3KAD A;  1ITX A;  2WAD A;  2AOS A;  3MCB A;  2RQS A;  3IK8 A;  2DJY A;  5JH8 A;  3AS1 A;  4ITZ A;  3ARX A;  4BF8 A;  3FY1 A;  1OWQ A;  1N1A A;  3KCE A;  2DG4 A;  5DIU A;  3M7N A;  1F40 A;  3RGC A;  3O5O A;  4JYS A;  1ZBK A;  1HJX A;  2LGO A;  2OFN A;  3B9D A;  1J6Y A;  2DSV A;  4Z2I A;  5HWC A;  5DIV A;  2L2S A;  3TCZ A;  2IUZ A;  4S3K A;  1WR7 A;  2DT2 A;  1W9U A;  3CH9 A;  3PRB A;  3B7X A;  2XP6 A;  4WIW A;  4IPX A;  3KZ7 A;  4Z2J A;  2LJ4 A;  3O5L A;  4MGV A;  1FKI A;  5U47 A;  3EY6 A;  1D6O A;  4DRK A;  4ODP A;  1FFR A;  5HWB A;  2VN1 A;  4QZV B;  1E9L A;  2MLY A;  3QOK A;  3FAP A;  2FKE A;  4L72 B;  1BKF A;  3IKD A;  4C02 B;  3LUO A;  1C9H A;  4DRQ A;  1NMV A;  3G6M A;  3KAF A;  5E65 A;  1W1V A;  2XP4 A;  2XP5 A;  4MNJ A;  3WD1 A;  2KR7 A;  4DRP A;  1HKI A;  4J4N A;  5HW6 A;  1EQ3 A;  1ZL1 A;  4U84 A;  2A3E A;  1I5H W;  1JNE A;  4TW7 A;  3LKX B;  2Y8N B;  2JMF A;  1K9R A;  2K8I A;  3KAH A;  1NWU A;  1FKL A;  5E66 A;  4ML4 A;  1TK7 A;  4Z2G A;  5E5W A;  1OGB A;  4LAW A;  2B31 A;  5DF0 A;  1Q6U A;  5HKG A;  1HJW A;  2L4J A;  2ZAJ A;  2A3C A;  2DT3 A;  1ZK6 A;  1EDQ A;  4DWS C;  2YSG A;  2DSW A;  1FKB A;  1H0G A;  1KFW A;  4P8X A;  1E6R A;  4MTV A;  1E6Z A;  3PRA A;  1W1Y A;  2MNT A;  4L3N A;  3UQB A;  5HW7 A;  4QIB A;  3UI4 A;  3KAG A;  1QZ2 A;  3JYM A;  3WL1 A;  4KQZ A;  2XP9 A;  1FKG A;  3ARW A;  4DRI A;  3O5E A;  2KGJ A;  5BXJ A;  2IF4 A;  4J4O A;  4ZPV R;  1HKM A;  4ZPT R;  2DG3 A;  2F4E A;  4REX A;  4ODO A;  4LAY A;  3UQI A;  4R5E A;  1NWR A;  2XP7 A;  4O2T A;  2E45 A;  4DWS A;  1E6P A;  1FLC A;  4JFJ A;  1R9H A;  1FFQ A;  2YSB A;  2O9O A;  4WJX A;  1EYM A;  4MPK A;  1HKK A;  4WKA A;  1W9P A;  2WK2 A;  3KAC A;  2DSU A;  3RME A;  4AY1 A;  3O5M A;  2QRV A;  3UF8 A;  2ZQU A;  3CHD A;  5GPR A;  2AWG A;  3UI6 A;  2A3A A;  1NH6 A;  1OGG A;  5E64 A;  3B9A A;  1D7I A;  2MF9 A;  3ARV A;  1XRV A;  1FKH A;  1GUV A;  2Y78 A;  2PPO A;  3FS8 A;  1J4I A;  1EIB A;  2KE0 A;  2LKN A;  4HAR A;  3FXY A;  3L4H A;  5CQ2 A;  4MSP A;  1QPF A;  5GQB A;  3RFW A;  4LAX A;  1K9Q A;  2DPE A;  1YW5 A;  1KT1 A;  2LPV A;  3OOB A;  2A3B A;  3WD2 A;  1HXV A;  2RUC A;  1WAW A;  3UQA A;  2PV1 A;  1EG3 A;  2JZV A;  4TX0 A;  3M85 A;  3TDB A;  1TR8 A;  1WMV A;  4Q22 A;  1D2K A;  4DWS B;  4P8U A;  3AS0 A;  1L1P A;  4WKH A;  5E62 A;  4U86 A;  3KAI A;  5B8I C;  1GOI A;  1E6N A;  3IKG A;  2M3O W;  1O6W A;  1D7H A;  3CGN A;  1LG1 A;  4HBO A;  4MNM A;  4KR0 B;  4W9P A;  4HBE A;  2M2A A;  2OWO A;  3WIJ A;  3RM8 A;  4DH0 A;  2WLY A;  1A7X A;  4TNS A;  1HKJ A;  2PPP A;  5HT1 A;  1FKT A;  4IT4 A;  2DK1 A;  3JYJ A;  4NSB A;  5J6E A;  1JVW A;  2ITK A;  1J4R A;  3OA5 A;  2YBU A;  3MQG A;  2MLX A;  4XAK A;  2ZQS A;  2DG9 A;  1J4H A;  3NI6 A;  1RP5 A;  1LJY A;  3UI5 A;  5HW8 A;  4U85 A;  2MPH A;  3O5G A;  1T11 A;  3O5K A;  4TW8 A;  4DRH A;  3ARY A;  4QT3 A;  3B8S A;  1D7J A;  4Z2H A;  3CNG A;  3RM9 A;  1LL6 A;  1SR0 A;  2FDM A;  3CHC A;  1FAP A;  4E5R A;  4MNK A;  5HBF A;  3WD0 A;  2WAE A;  2EZ5 W;  3ODK A;  3ART A;  4DWS D;  4ODK A;  1FD9 A;  3I6C A;  3O5Q A;  3FSB A;  2ZQT A;  1FKS A;  3B9E A;  2YSH A;  2JX8 A;  4DRN A;  3ARO A;  3MDY B;  4ZS6 A;  2ESC A;  3ARZ A;  2DMV A;  2YBT A;  3TC5 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...