2ZQUA

Crystal structure of a mutant pin1 peptidyl-prolyl cis-trans isomerase
Total Genus 42
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
42
sequence length
158
structure length
153
Chain Sequence
KLPPGWEKRMSRSSGRVYYFNHITNASQAERPSGGKNGQGEPARVRCSHLLVKHSQSRRPSSWRQEKITRTKEEALELINGYIQKIKSGEEDFESLASQFSDCSSAKARGDLGAFSRGQMQKPFEDASFALRTGEMSGPVFTDSGIHIILRTE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural studies on PIN1 mutants
rcsb
source organism Homo sapiens
molecule tags Isomerase
molecule keywords Peptidyl-prolyl cis-trans isomerase NIMA-interacting 1
total genus 42
structure length 153
sequence length 158
ec nomenclature ec 5.2.1.8: Peptidylprolyl isomerase.
pdb deposition date 2008-08-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00397 WW WW domain
A PF00639 Rotamase PPIC-type PPIASE domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.20.70.10 Mainly Beta Single Sheet Ubiquitin Ligase Nedd4; Chain: W; Ubiquitin Ligase Nedd4; Chain: W; 2zquA01
3.10.50.40 Alpha Beta Roll Chitinase A; domain 3 Chitinase A; domain 3 2zquA02
2ZQSA 1K9RA 1M5YA 1I5HW 3GPKA 3O5QA 1KT1A 1K9QA 1YATA 2KGJA 1FKFA 2KI3A 3IK8A 4U85A 1JVWA 1FKSA 3O5MA 2PV2A 4IQCA 3UQIA 4DIPA 2AWGA 1QPLA 2FAPA 2MLYA 4DT4A 5HWCA 2L4JA 2UZ5A 1NSGA 3KABA 2DK1A 3JYJA 1ROTA 2KXQA 2Y78A 3O5LA 4LAYA 1FKRA 2ZAJA 4ODNA 3OOBA 2KO7A 1FD9A 5HKGA 3O5EA 2KR7A 2LKNA 2YSBA 2RUDA 4ODQA 2DMVA 3TCZA 2MNTA 4DH0A 2YSFA 1JNTA 1T11A 5DITA 5BXJA 3O5JA 4ITZA 1J6YA 3PRBA 2YSGA 2PV1A 2XP3A 4C02B 5HW6A 4N19A 1ZK6A 1TCOC 5AHTA 1Q6UA 2MPHA 1J4RA 4DRHA 2XP9A 3NRKA 3O5GA 2LGOA 3UI5A 3KCEA 1EQ3A 2M8IA 3TDBA 4NNRA 4W9PA 1FKKA 2RSEA 2RURA 4O2TA 2LAJA 5D75A 4W9OA 1FJDA 2MDIA 2XPBA 5HWBA 2RQSA 4E5RA 4JFJA 1YW5A 4DRNA 4ODPA 3O5FA 4DRJA 4JFKA 2JMFA 4U86A 3B7XA 4U84A 2ZQUA 3EY6A 2K8IA 2E45A 4G2PA 1A7XA 3JXVA 1U79A 4R0XA 3IHZA 4QT2A 2XP4A 3RGCA 2KFWA 4DRMA 3M85A 1EYMA 1W26A 3NTPA 4FN2A 2M1IA 4DROA 5J6EA 2DG4A 1BKFA 4MSPA 1Q6HA 4ODLA 4JFMA 1JNSA 2PPPA 2DJYA 2XP6A 4W9QA 2PBCA 1ROUA 4JYSA 3ODKA 3I6CA 1ZCNA 3IKGA 4ODMA 1J4IA 1Y0OA 5HT1A 3UF8A 4DRKA 1FKJA 2JV4A 1BL4A 3KACA 4J4OA 4LAXA 3JYMA 2D9FA 4MGVA 5I98A 3UQAA 4G50A 5GPGA 3O5KA 2LJ4A 3UQBA 1Q6IA 2PV3A 1L1PA 2BA1A 2L2SA 1EG3A 1WR7A 2M08A 5DIVA 1F40A 1PBKA 5B8IC 3O5IA 1PINA 3O5OA 2ZR4A 2IF4A 2MF9A 4TW8A 2LPVA 1Q1CA 2F4EA 1D6OA 1FKHA 2VCDA 3H9RB 4DRQA 5HW7A 2XP8A 2DG3A 3WH0A 1FKIA 4LAWA 1QZ2A 2RUQA 4GGQA 4DZ2A 3CGNA 3MDYB 3UI6A 2M8JA 1KT0A 1J4HA 2YSIA 2M3OW 1FKTA 1FKDA 1EG4A 2JX8A 3KADA 1B6CA 1D7IA 5CQ2A 2PPOA 1N1AA 2ZR6A 2MLZA 4FAPA 2RUCA 2OFNA 3O5DA 2XPAA 2ITKA 2F21A 4TW7A 1FAPA 3IKDA 3FAPA 3TC5A 2ZQVA 1R9HA 4DRPA 4ODRA 5HUAA 3NI6A 4TW6A 4IQ2A 3M7NA 1WMVA 4TNSA 2PPNA 1FKGA 4ODOA 2VN1A 4ODKA 3O5RA 2KE0A 3RFWA 1NMWA 5HW8A 4DZ3A 2ZR5A 2DG9A 3KAFA 4J4NA 5DIUA 3KAGA 4GIVA 2ZQTA 1D7HA 4LAVA 3PRDA 2JXWA 4TX0A 2N87A 3UI4A 1QPFA 1NMVA 1JMQA 1TK7A 3KAIA 3KAHA 2XP5A 2DK7A 2DWVA 3L4HA 4QIBA 1FKBA 2FKEA 3PA7A 4JFLA 4TYOA 4JFIA 3LUOA 3VAWA 1C9HA 1P5QA 4IPXA 4BF8A 1HXVA 2F2DA 3CNGA 3KZ7A 1D7JA 3LE4A 4REXA 2YSHA 2JZVA 2Q5AA 2RE3A 2XP7A 3CGMA 4QT3A 4DRIA 2EZ5W 1O6WA 5HTGA 1F8AB 2MLXA 3O5PA 2M2AA 1FKLA
chains in the Genus database with same CATH superfamily
4DIPA 3O5QA 1W1VA 5I98A 2A3CA 3FSBA 1QPLA 4MNLA 4MNJA 2UZ5A 2DK1A 2B5UB 4QZVB 3OOBA 3WD0A 2KR7A 2LKNA 4MNMA 2YSBA 3AS1A 2RUDA 3BMBA 3TCZA 5BXJA 4ITZA 3ARPA 2PV1A 1H0IA 4N19A 1TCOC 4MAVA 1EHNA 1W1TA 1HKMA 4DRHA 2XP9A 4W9PA 1W1YA 3AS0A 4Q22A 2RQSA 2DSWA 1YW5A 2IUZA 4U86A 4A0TA 2ZQUA 1A7XA 1E9LA 3LKXA 1X6LA 3JXVA 3CHFA 3G6MA 3M85A 4IT6A 2M1IA 5J6EA 3WQWA 1VF8A 4JFMA 4DRKA 3IKGA 2FDMA 5HWCA 1Y0OA 2JV4A 3KACA 4MGVA 3CHDA 4KQZA 2LJ4A 2WADA 2PN0A 3AROA 5E66A 1F40A 5B8IC 4NSBA 2IF4A 4TW8A 2MF9A 5HW7A 2XP8A 5DF0A 4Z2KA 4LAWA 3PQHA 1QZ2A 3CGNA 3MDYB 1J4HA 2YSIA 1NH6A 2G41A 2YAJB 1B6CA 5CQ2A 1N1AA 2MLZA 2RUCA 3FS8A 4Z2HA 2ITKA 2F21A 4TW7A 3IKDA 4DRPA 5DO2A 5HUAA 1WMVA 4ODOA 2VN1A 4ODKA 1GPFA 1NWSA 1LJYA 4DZ3A 2ZR5A 4LAVA 1ZB5A 3UI4A 2N87A 3L4HA 4QIBA 2XP5A 2Y8NB 1FKBA 4JFIA 1C9HA 1P5QA 3ALFA 4IPXA 2F2DA 3FY1A 1D7JA 3LE4A 3LKXB 2O92A 3ARVA 3CGMA 4URIA 1TFVA 3RM4A 1XHGA 2KI3A 3O5MA 1FKFA 4P8WA 2PV2A 2L4JA 1ZL1A 1HJWA 3JYJA 1ZU8A 1ZBVA 1ZBWA 2P4VA 1TR8A 3QOKA 2ZAJA 4ODNA 3ARYA 1FD9A 3WD1A 3O5EA 5HKGA 2A3EA 2AOSA 3ARRA 1KFWA 4ODQA 1EIBA 4DH0A 3CH9A 3PRBA 2YBTA 4C02B 1ZK6A 2OLHA 5JH8A 1EQ3A 3O5GA 3UI5A 1LL4A 1JNEA 2M8IA 5GPRA 2RSEA 5D75A 5E62A 4W9OA 1FJDA 3B8SA 3MCBB 4ZPTR 3ARUA 5HWBA 4JFJA 4DRNA 3MQGA 3O5FA 1E6ZA 1NWTA 1SR0A 3ARTA 4DRJA 3B7XA 3AS2A 3ARQA 3EY6A 2K8IA 1U79A 2KFWA 4IT4A 4DRMA 1W26A 1E15A 4DROA 2B31A 4MSPA 4W9QA 2XP6A 1WNOA 2DPEA 2PBCA 3ODKA 3FXYA 1W9VA 5GPGA 3O5KA 3ARSA 2WLYA 4WKFA 1RD6A 3FSCA 2L2SA 2WAEA 1X6NA 3O5OA 2ZR4A 3PRAA 1Q1CA 2VCDA 1D6OA 3H9RB 1W9PA 1FKIA 3W4RA 4GGQA 2RUQA 3B9DA 2M8JA 2M3OW 2PPOA 1EG4A 3KADA 5E5WA 3PR9A 4L72B 4DWSC 3WD2A 2OFNA 4MTVA 2WLZA 1HJXA 1E6PA 4ODRA 4S3KA 4IQ2A 4TNSA 3O5RA 1NMWA 5HW8A 3KAFA 5DIUA 3ARWA 1QPFA 1JMQA 2FKEA 2DK7A 2DWVA 4JFLA 2DSVA 4BF8A 3CNGA 2YSHA 4QT3A 4DRIA 1F8AB 2DSUA 2MLXA 4R5EA 1FKLA 3AS3A 2ZQSA 1K9RA 3GPKA 1I5HW 4LAXA 2KGJA 4IQCA 4U85A 2FAPA 3WD3A 1NWUA 2A3AA 3O5LA 4LGXA 3WQVA 2KO7A 2DT0A 1HKJA 2DMVA 1J6YA 1T11A 2YSGA 5DEZA 1OWQA 3ARXA 1J4RA 2DT3A 3NRKA 2LGOA 3WD4A 4NNRA 3EIPA 2RURA 4O2TA 2MDIA 4UDMA 4E5RA 1OGBA 1HKKA 4ODPA 1LG1A 4JFKA 2JMFA 4U84A 1XRVA 4R0XA 3IHZA 4QT2A 2XP4A 3WKZA 1EYMA 3NTPA 2DG4A 1BKFA 1Q6HA 1D2KA 4JYSA 1ROUA 1ZCNA 3CZ8A 1J4IA 1BL4A 4J4OA 3UQAA 3JYMA 2D9FA 3WIJA 4G50A 3UQBA 3RMEA 3B9EA 1HKIA 2DSZA 1EG3A 1WR7A 1GOIA 2F4EA 4DRQA 1HJVA 3WH0A 4PTMA 1K9TA 2A3BA 3UI6A 1LQ0A 5HBFA 1FKTA 1FKDA 4ZPVR 1FFRA 4FAPA 1D7IA 4DWSD 2ZR6A 1GUVA 3O5DA 1FLCA 4WKAA 4Z2LA 2QRVA 2OWOA 3TC5A 2ZQVA 4DWSA 1RP5A 3NI6A 1ZBKA 4W5UA 2PPNA 2WK2A 3MQHA 3ARZA 1LL7A 1H0GA 2DG9A 4J4NA 1GRJA 2EULA 2ZQTA 2JXWA 4HBEA 4TX0A 1NMVA 1TK7A 2DT2A 3PA7A 4TYOA 4ZPWR 3VAWA 2WM0A 3LUOA 3ALGA 4REXA 2JZVA 2Q5AA 2RE3A 5HTGA 3WL0A 3O5PA 2M2AA 2YBUA 3CHEA 5GQBA 1M5YA 4AY1A 4Z2JA 1ITXA 1K9QA 1KT1A 1YATA 3IK8A 1JVWA 3UQIA 1FKSA 4DT4A 2AWGA 2MLYA 1NWRA 1NSGA 3KABA 1ROTA 2KXQA 2Y78A 4LAYA 1FKRA 2ESCA 4WK9A 1LG2A 5E64A 3GU0A 2MNTA 2YSFA 1JNTA 5DITA 3O5JA 1E44A 3MCBA 2XP3A 5HW6A 5AHTA 1Q6UA 2MPHA 3KCEA 3TDBA 1EDQA 2F23A 1FFQA 1FKKA 1JNDA 2LAJA 2XPBA 3RM8A 4L3NA 1W1PA 4DWSB 4G2PA 2E45A 4Z2IA 4MNKA 5U47A 4FN2A 4KR0B 1WAWA 4ZS6A 4P8VA 1OGGA 4ODLA 4NZCA 1JNSA 1JCHB 2PPPA 2DJYA 1SYTA 4HBOA 2O9OA 3GTYX 3I6CA 4ODMA 5HT1A 1UR9A 4MPKA 3UF8A 1FKJA 4WIWA 2PI6A 4A0UA 1Q6IA 2PV3A 2DT1A 3CHCA 1L1PA 2M08A 2BA1A 4P8XA 5DIVA 1PBKA 3O5IA 1PINA 1WB0A 2LPVA 4GLXA 3AQUA 1FKHA 2DG3A 4WKHA 5E65A 4DZ2A 1KT0A 4HARA 2JX8A 1O6IA 1ZBCA 2XPAA 1FAPA 3FAPA 4XAKA 1R9HA 3OA5A 4P8UA 4TW6A 2ETNA 3M7NA 4ML4A 4Q7NA 1FKGA 3RFWA 1IX5A 2KE0A 1UR8A 3B9AA 1CTNA 3RM9A 3KAGA 4GIVA 1D7HA 1LL6A 3PRDA 3BXWA 3KAIA 1W9UA 3KAHA 1E6NA 3RGCA 2G8ZA 1HXVA 3G6LA 3KZ7A 4S3JA 2XP7A 2EZ5W 1O6WA 4Z2GA 4WJXA 1E6RA 3WL1A 2QF8A
chains in the Genus database with same CATH topology
4DIPA 3O5QA 1W1VA 5I98A 2A3CA 3FSBA 1QPLA 4MNLA 4MNJA 2UZ5A 2DK1A 4QZVB 3OOBA 3WD0A 2KR7A 2LKNA 4MNMA 2YSBA 3AS1A 2RUDA 3TCZA 5BXJA 4ITZA 3ARPA 2PV1A 1H0IA 4N19A 1TCOC 4MAVA 1EHNA 1W1TA 1HKMA 4DRHA 2XP9A 4W9PA 1W1YA 3AS0A 4Q22A 2RQSA 2DSWA 1YW5A 2IUZA 4U86A 4A0TA 2ZQUA 1A7XA 1E9LA 3LKXA 1X6LA 3JXVA 3CHFA 3G6MA 3M85A 4IT6A 2M1IA 5J6EA 3WQWA 1VF8A 4JFMA 4DRKA 3IKGA 2FDMA 5HWCA 1Y0OA 2JV4A 3KACA 4MGVA 3CHDA 4KQZA 2LJ4A 2WADA 3AROA 5E66A 1F40A 5B8IC 4NSBA 2IF4A 4TW8A 2MF9A 5HW7A 2XP8A 5DF0A 4Z2KA 4LAWA 3PQHA 1QZ2A 3CGNA 3MDYB 1J4HA 2YSIA 1NH6A 2G41A 2YAJB 1B6CA 5CQ2A 1N1AA 2MLZA 2RUCA 3FS8A 4Z2HA 2ITKA 2F21A 4TW7A 3IKDA 4DRPA 5DO2A 5HUAA 1WMVA 4ODOA 2VN1A 4ODKA 1GPFA 1NWSA 1LJYA 4DZ3A 2ZR5A 4LAVA 1ZB5A 3UI4A 2N87A 3L4HA 4QIBA 2XP5A 2Y8NB 1FKBA 4JFIA 1C9HA 1P5QA 3ALFA 4IPXA 2F2DA 3FY1A 1D7JA 3LE4A 3LKXB 2O92A 3ARVA 3CGMA 4URIA 1TFVA 3RM4A 1XHGA 2KI3A 3O5MA 1FKFA 4P8WA 2PV2A 2L4JA 1ZL1A 1HJWA 3JYJA 1ZU8A 1ZBVA 1ZBWA 3QOKA 1TR8A 2ZAJA 4ODNA 3ARYA 1FD9A 3WD1A 3O5EA 5HKGA 2A3EA 2AOSA 3ARRA 1KFWA 4ODQA 1EIBA 4DH0A 3CH9A 3PRBA 2YBTA 4C02B 1ZK6A 2OLHA 5JH8A 1EQ3A 3O5GA 3UI5A 1LL4A 1JNEA 2M8IA 5GPRA 2RSEA 5D75A 5E62A 4W9OA 1FJDA 3B8SA 3MCBB 4ZPTR 3ARUA 5HWBA 4JFJA 4DRNA 3MQGA 3O5FA 1E6ZA 1NWTA 1SR0A 3ARTA 4DRJA 3B7XA 3AS2A 3ARQA 3EY6A 2K8IA 1U79A 2KFWA 4IT4A 4DRMA 1W26A 1E15A 4DROA 2B31A 4MSPA 4W9QA 2XP6A 1WNOA 2DPEA 2PBCA 3ODKA 3FXYA 1W9VA 5GPGA 3O5KA 3ARSA 2WLYA 4WKFA 1RD6A 3FSCA 2L2SA 2WAEA 1X6NA 3O5OA 2ZR4A 3PRAA 1Q1CA 2VCDA 1D6OA 3H9RB 1W9PA 1FKIA 3W4RA 4GGQA 2RUQA 3B9DA 2M8JA 2M3OW 2PPOA 1EG4A 3KADA 5E5WA 3PR9A 4L72B 4DWSC 3WD2A 2OFNA 4MTVA 2WLZA 1HJXA 1E6PA 4ODRA 4S3KA 4IQ2A 4TNSA 3O5RA 1NMWA 5HW8A 3KAFA 5DIUA 3ARWA 1QPFA 1JMQA 2FKEA 2DK7A 2DWVA 4JFLA 2DSVA 4BF8A 3CNGA 2YSHA 4QT3A 4DRIA 1F8AB 2DSUA 2MLXA 4R5EA 1FKLA 3AS3A 2ZQSA 1K9RA 3GPKA 1I5HW 4LAXA 2KGJA 4IQCA 4U85A 2FAPA 3WD3A 1NWUA 2A3AA 3O5LA 4LGXA 3WQVA 2KO7A 2DT0A 1HKJA 2DMVA 1J6YA 1T11A 2YSGA 5DEZA 1OWQA 3ARXA 1J4RA 2DT3A 3NRKA 2LGOA 3WD4A 4NNRA 2RURA 4O2TA 2MDIA 4E5RA 1OGBA 1HKKA 4ODPA 1LG1A 4JFKA 2JMFA 4U84A 1XRVA 4R0XA 3IHZA 4QT2A 2XP4A 3WKZA 1EYMA 3NTPA 2DG4A 1BKFA 1Q6HA 1D2KA 4JYSA 1ROUA 1ZCNA 3CZ8A 1J4IA 1BL4A 4J4OA 3UQAA 3JYMA 2D9FA 3WIJA 4G50A 3UQBA 3RMEA 3B9EA 1HKIA 2DSZA 1EG3A 1WR7A 1GOIA 2F4EA 4DRQA 1HJVA 3WH0A 4PTMA 1K9TA 2A3BA 3UI6A 1LQ0A 5HBFA 1FKTA 1FKDA 4ZPVR 1FFRA 4FAPA 1D7IA 4DWSD 2ZR6A 1GUVA 3O5DA 1FLCA 4WKAA 4Z2LA 2QRVA 2OWOA 3TC5A 2ZQVA 4DWSA 1RP5A 3NI6A 1ZBKA 4W5UA 2PPNA 2WK2A 3MQHA 3ARZA 1LL7A 1H0GA 2DG9A 4J4NA 2ZQTA 2JXWA 4HBEA 4TX0A 1NMVA 1TK7A 2DT2A 3PA7A 4TYOA 4ZPWR 3VAWA 2WM0A 3LUOA 3ALGA 4REXA 2JZVA 2Q5AA 2RE3A 5HTGA 3WL0A 3O5PA 2M2AA 2YBUA 3CHEA 5GQBA 1M5YA 4AY1A 4Z2JA 1ITXA 1K9QA 1KT1A 1YATA 3IK8A 1JVWA 3UQIA 1FKSA 4DT4A 2AWGA 2MLYA 1NWRA 1NSGA 3KABA 1ROTA 2KXQA 2Y78A 4LAYA 1FKRA 2ESCA 4WK9A 1LG2A 5E64A 2MNTA 2YSFA 1JNTA 5DITA 3O5JA 3MCBA 2XP3A 5HW6A 5AHTA 1Q6UA 2MPHA 3KCEA 3TDBA 1EDQA 1FFQA 1FKKA 1JNDA 2LAJA 2XPBA 3RM8A 4L3NA 1W1PA 4DWSB 4G2PA 2E45A 4Z2IA 4MNKA 5U47A 4FN2A 4KR0B 1WAWA 4ZS6A 4P8VA 1OGGA 4ODLA 4NZCA 1JNSA 2PPPA 2DJYA 1SYTA 4HBOA 2O9OA 3I6CA 4ODMA 5HT1A 1UR9A 4MPKA 3UF8A 1FKJA 4WIWA 2PI6A 4A0UA 1Q6IA 2PV3A 2DT1A 3CHCA 1L1PA 2M08A 2BA1A 4P8XA 5DIVA 1PBKA 3O5IA 1PINA 1WB0A 2LPVA 4GLXA 3AQUA 1FKHA 2DG3A 4WKHA 5E65A 4DZ2A 1KT0A 4HARA 2JX8A 1O6IA 1ZBCA 2XPAA 1FAPA 3FAPA 4XAKA 1R9HA 3OA5A 4P8UA 4TW6A 3M7NA 4ML4A 4Q7NA 1FKGA 3RFWA 1IX5A 2KE0A 1UR8A 3B9AA 1CTNA 3RM9A 3KAGA 4GIVA 1D7HA 1LL6A 3PRDA 3BXWA 3KAIA 1W9UA 3KAHA 1E6NA 3RGCA 2G8ZA 1HXVA 3G6LA 3KZ7A 4S3JA 2XP7A 2EZ5W 1O6WA 4Z2GA 4WJXA 1E6RA 3WL1A 2QF8A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2ZQS A;  1K9R A;  1M5Y A;  1I5H W;  3GPK A;  3O5Q A;  1KT1 A;  1K9Q A;  1YAT A;  2KGJ A;  1FKF A;  2KI3 A;  3IK8 A;  4U85 A;  1JVW A;  1FKS A;  3O5M A;  2PV2 A;  4IQC A;  3UQI A;  4DIP A;  2AWG A;  1QPL A;  2FAP A;  2MLY A;  4DT4 A;  5HWC A;  2L4J A;  2UZ5 A;  1NSG A;  3KAB A;  2DK1 A;  3JYJ A;  1ROT A;  2KXQ A;  2Y78 A;  3O5L A;  4LAY A;  1FKR A;  2ZAJ A;  4ODN A;  3OOB A;  2KO7 A;  1FD9 A;  5HKG A;  3O5E A;  2KR7 A;  2LKN A;  2YSB A;  2RUD A;  4ODQ A;  2DMV A;  3TCZ A;  2MNT A;  4DH0 A;  2YSF A;  1JNT A;  1T11 A;  5DIT A;  5BXJ A;  3O5J A;  4ITZ A;  1J6Y A;  3PRB A;  2YSG A;  2PV1 A;  2XP3 A;  4C02 B;  5HW6 A;  4N19 A;  1ZK6 A;  1TCO C;  5AHT A;  1Q6U A;  2MPH A;  1J4R A;  4DRH A;  2XP9 A;  3NRK A;  3O5G A;  2LGO A;  3UI5 A;  3KCE A;  1EQ3 A;  2M8I A;  3TDB A;  4NNR A;  4W9P A;  1FKK A;  2RSE A;  2RUR A;  4O2T A;  2LAJ A;  5D75 A;  4W9O A;  1FJD A;  2MDI A;  2XPB A;  5HWB A;  2RQS A;  4E5R A;  4JFJ A;  1YW5 A;  4DRN A;  4ODP A;  3O5F A;  4DRJ A;  4JFK A;  2JMF A;  4U86 A;  3B7X A;  4U84 A;  2ZQU A;  3EY6 A;  2K8I A;  2E45 A;  4G2P A;  1A7X A;  3JXV A;  1U79 A;  4R0X A;  3IHZ A;  4QT2 A;  2XP4 A;  3RGC A;  2KFW A;  4DRM A;  3M85 A;  1EYM A;  1W26 A;  3NTP A;  4FN2 A;  2M1I A;  4DRO A;  5J6E A;  2DG4 A;  1BKF A;  4MSP A;  1Q6H A;  4ODL A;  4JFM A;  1JNS A;  2PPP A;  2DJY A;  2XP6 A;  4W9Q A;  2PBC A;  1ROU A;  4JYS A;  3ODK A;  3I6C A;  1ZCN A;  3IKG A;  4ODM A;  1J4I A;  1Y0O A;  5HT1 A;  3UF8 A;  4DRK A;  1FKJ A;  2JV4 A;  1BL4 A;  3KAC A;  4J4O A;  4LAX A;  3JYM A;  2D9F A;  4MGV A;  5I98 A;  3UQA A;  4G50 A;  5GPG A;  3O5K A;  2LJ4 A;  3UQB A;  1Q6I A;  2PV3 A;  1L1P A;  2BA1 A;  2L2S A;  1EG3 A;  1WR7 A;  2M08 A;  5DIV A;  1F40 A;  1PBK A;  5B8I C;  3O5I A;  1PIN A;  3O5O A;  2ZR4 A;  2IF4 A;  2MF9 A;  4TW8 A;  2LPV A;  1Q1C A;  2F4E A;  1D6O A;  1FKH A;  2VCD A;  3H9R B;  4DRQ A;  5HW7 A;  2XP8 A;  2DG3 A;  3WH0 A;  1FKI A;  4LAW A;  1QZ2 A;  2RUQ A;  4GGQ A;  4DZ2 A;  3CGN A;  3MDY B;  3UI6 A;  2M8J A;  1KT0 A;  1J4H A;  2YSI A;  2M3O W;  1FKT A;  1FKD A;  1EG4 A;  2JX8 A;  3KAD A;  1B6C A;  1D7I A;  5CQ2 A;  2PPO A;  1N1A A;  2ZR6 A;  2MLZ A;  4FAP A;  2RUC A;  2OFN A;  3O5D A;  2XPA A;  2ITK A;  2F21 A;  4TW7 A;  1FAP A;  3IKD A;  3FAP A;  3TC5 A;  2ZQV A;  1R9H A;  4DRP A;  4ODR A;  5HUA A;  3NI6 A;  4TW6 A;  4IQ2 A;  3M7N A;  1WMV A;  4TNS A;  2PPN A;  1FKG A;  4ODO A;  2VN1 A;  4ODK A;  3O5R A;  2KE0 A;  3RFW A;  1NMW A;  5HW8 A;  4DZ3 A;  2ZR5 A;  2DG9 A;  3KAF A;  4J4N A;  5DIU A;  3KAG A;  4GIV A;  2ZQT A;  1D7H A;  4LAV A;  3PRD A;  2JXW A;  4TX0 A;  2N87 A;  3UI4 A;  1QPF A;  1NMV A;  1JMQ A;  1TK7 A;  3KAI A;  3KAH A;  2XP5 A;  2DK7 A;  2DWV A;  3L4H A;  4QIB A;  1FKB A;  2FKE A;  3PA7 A;  4JFL A;  4TYO A;  4JFI A;  3LUO A;  3VAW A;  1C9H A;  1P5Q A;  4IPX A;  4BF8 A;  1HXV A;  2F2D A;  3CNG A;  3KZ7 A;  1D7J A;  3LE4 A;  4REX A;  2YSH A;  2JZV A;  2Q5A A;  2RE3 A;  2XP7 A;  3CGM A;  4QT3 A;  4DRI A;  2EZ5 W;  1O6W A;  5HTG A;  1F8A B;  2MLX A;  3O5P A;  2M2A A;  1FKL A; 
#chains in the Genus database with same CATH topology
 4DIP A;  3O5Q A;  1W1V A;  5I98 A;  2A3C A;  3FSB A;  1QPL A;  4MNL A;  4MNJ A;  2UZ5 A;  2DK1 A;  2B5U B;  4QZV B;  3OOB A;  3WD0 A;  2KR7 A;  2LKN A;  4MNM A;  2YSB A;  3AS1 A;  2RUD A;  3BMB A;  3TCZ A;  5BXJ A;  4ITZ A;  3ARP A;  2PV1 A;  1H0I A;  4N19 A;  1TCO C;  4MAV A;  1EHN A;  1W1T A;  1HKM A;  4DRH A;  2XP9 A;  4W9P A;  1W1Y A;  3AS0 A;  4Q22 A;  2RQS A;  2DSW A;  1YW5 A;  2IUZ A;  4U86 A;  4A0T A;  2ZQU A;  1A7X A;  1E9L A;  3LKX A;  1X6L A;  3JXV A;  3CHF A;  3G6M A;  3M85 A;  4IT6 A;  2M1I A;  5J6E A;  3WQW A;  1VF8 A;  4JFM A;  4DRK A;  3IKG A;  2FDM A;  5HWC A;  1Y0O A;  2JV4 A;  3KAC A;  4MGV A;  3CHD A;  4KQZ A;  2LJ4 A;  2WAD A;  2PN0 A;  3ARO A;  5E66 A;  1F40 A;  5B8I C;  4NSB A;  2IF4 A;  4TW8 A;  2MF9 A;  5HW7 A;  2XP8 A;  5DF0 A;  4Z2K A;  4LAW A;  3PQH A;  1QZ2 A;  3CGN A;  3MDY B;  1J4H A;  2YSI A;  1NH6 A;  2G41 A;  2YAJ B;  1B6C A;  5CQ2 A;  1N1A A;  2MLZ A;  2RUC A;  3FS8 A;  4Z2H A;  2ITK A;  2F21 A;  4TW7 A;  3IKD A;  4DRP A;  5DO2 A;  5HUA A;  1WMV A;  4ODO A;  2VN1 A;  4ODK A;  1GPF A;  1NWS A;  1LJY A;  4DZ3 A;  2ZR5 A;  4LAV A;  1ZB5 A;  3UI4 A;  2N87 A;  3L4H A;  4QIB A;  2XP5 A;  2Y8N B;  1FKB A;  4JFI A;  1C9H A;  1P5Q A;  3ALF A;  4IPX A;  2F2D A;  3FY1 A;  1D7J A;  3LE4 A;  3LKX B;  2O92 A;  3ARV A;  3CGM A;  4URI A;  1TFV A;  3RM4 A;  1XHG A;  2KI3 A;  3O5M A;  1FKF A;  4P8W A;  2PV2 A;  2L4J A;  1ZL1 A;  1HJW A;  3JYJ A;  1ZU8 A;  1ZBV A;  1ZBW A;  2P4V A;  1TR8 A;  3QOK A;  2ZAJ A;  4ODN A;  3ARY A;  1FD9 A;  3WD1 A;  3O5E A;  5HKG A;  2A3E A;  2AOS A;  3ARR A;  1KFW A;  4ODQ A;  1EIB A;  4DH0 A;  3CH9 A;  3PRB A;  2YBT A;  4C02 B;  1ZK6 A;  2OLH A;  5JH8 A;  1EQ3 A;  3O5G A;  3UI5 A;  1LL4 A;  1JNE A;  2M8I A;  5GPR A;  2RSE A;  5D75 A;  5E62 A;  4W9O A;  1FJD A;  3B8S A;  3MCB B;  4ZPT R;  3ARU A;  5HWB A;  4JFJ A;  4DRN A;  3MQG A;  3O5F A;  1E6Z A;  1NWT A;  1SR0 A;  3ART A;  4DRJ A;  3B7X A;  3AS2 A;  3ARQ A;  3EY6 A;  2K8I A;  1U79 A;  2KFW A;  4IT4 A;  4DRM A;  1W26 A;  1E15 A;  4DRO A;  2B31 A;  4MSP A;  4W9Q A;  2XP6 A;  1WNO A;  2DPE A;  2PBC A;  3ODK A;  3FXY A;  1W9V A;  5GPG A;  3O5K A;  3ARS A;  2WLY A;  4WKF A;  1RD6 A;  3FSC A;  2L2S A;  2WAE A;  1X6N A;  3O5O A;  2ZR4 A;  3PRA A;  1Q1C A;  2VCD A;  1D6O A;  3H9R B;  1W9P A;  1FKI A;  3W4R A;  4GGQ A;  2RUQ A;  3B9D A;  2M8J A;  2M3O W;  2PPO A;  1EG4 A;  3KAD A;  5E5W A;  3PR9 A;  4L72 B;  4DWS C;  3WD2 A;  2OFN A;  4MTV A;  2WLZ A;  1HJX A;  1E6P A;  4ODR A;  4S3K A;  4IQ2 A;  4TNS A;  3O5R A;  1NMW A;  5HW8 A;  3KAF A;  5DIU A;  3ARW A;  1QPF A;  1JMQ A;  2FKE A;  2DK7 A;  2DWV A;  4JFL A;  2DSV A;  4BF8 A;  3CNG A;  2YSH A;  4QT3 A;  4DRI A;  1F8A B;  2DSU A;  2MLX A;  4R5E A;  1FKL A;  3AS3 A;  2ZQS A;  1K9R A;  3GPK A;  1I5H W;  4LAX A;  2KGJ A;  4IQC A;  4U85 A;  2FAP A;  3WD3 A;  1NWU A;  2A3A A;  3O5L A;  4LGX A;  3WQV A;  2KO7 A;  2DT0 A;  1HKJ A;  2DMV A;  1J6Y A;  1T11 A;  2YSG A;  5DEZ A;  1OWQ A;  3ARX A;  1J4R A;  2DT3 A;  3NRK A;  2LGO A;  3WD4 A;  4NNR A;  3EIP A;  2RUR A;  4O2T A;  2MDI A;  4UDM A;  4E5R A;  1OGB A;  1HKK A;  4ODP A;  1LG1 A;  4JFK A;  2JMF A;  4U84 A;  1XRV A;  4R0X A;  3IHZ A;  4QT2 A;  2XP4 A;  3WKZ A;  1EYM A;  3NTP A;  2DG4 A;  1BKF A;  1Q6H A;  1D2K A;  4JYS A;  1ROU A;  1ZCN A;  3CZ8 A;  1J4I A;  1BL4 A;  4J4O A;  3UQA A;  3JYM A;  2D9F A;  3WIJ A;  4G50 A;  3UQB A;  3RME A;  3B9E A;  1HKI A;  2DSZ A;  1EG3 A;  1WR7 A;  1GOI A;  2F4E A;  4DRQ A;  1HJV A;  3WH0 A;  4PTM A;  1K9T A;  2A3B A;  3UI6 A;  1LQ0 A;  5HBF A;  1FKT A;  1FKD A;  4ZPV R;  1FFR A;  4FAP A;  1D7I A;  4DWS D;  2ZR6 A;  1GUV A;  3O5D A;  1FLC A;  4WKA A;  4Z2L A;  2QRV A;  2OWO A;  3TC5 A;  2ZQV A;  4DWS A;  1RP5 A;  3NI6 A;  1ZBK A;  4W5U A;  2PPN A;  2WK2 A;  3MQH A;  3ARZ A;  1LL7 A;  1H0G A;  2DG9 A;  4J4N A;  1GRJ A;  2EUL A;  2ZQT A;  2JXW A;  4HBE A;  4TX0 A;  1NMV A;  1TK7 A;  2DT2 A;  3PA7 A;  4TYO A;  4ZPW R;  3VAW A;  2WM0 A;  3LUO A;  3ALG A;  4REX A;  2JZV A;  2Q5A A;  2RE3 A;  5HTG A;  3WL0 A;  3O5P A;  2M2A A;  2YBU A;  3CHE A;  5GQB A;  1M5Y A;  4AY1 A;  4Z2J A;  1ITX A;  1K9Q A;  1KT1 A;  1YAT A;  3IK8 A;  1JVW A;  3UQI A;  1FKS A;  4DT4 A;  2AWG A;  2MLY A;  1NWR A;  1NSG A;  3KAB A;  1ROT A;  2KXQ A;  2Y78 A;  4LAY A;  1FKR A;  2ESC A;  4WK9 A;  1LG2 A;  5E64 A;  3GU0 A;  2MNT A;  2YSF A;  1JNT A;  5DIT A;  3O5J A;  1E44 A;  3MCB A;  2XP3 A;  5HW6 A;  5AHT A;  1Q6U A;  2MPH A;  3KCE A;  3TDB A;  1EDQ A;  2F23 A;  1FFQ A;  1FKK A;  1JND A;  2LAJ A;  2XPB A;  3RM8 A;  4L3N A;  1W1P A;  4DWS B;  4G2P A;  2E45 A;  4Z2I A;  4MNK A;  5U47 A;  4FN2 A;  4KR0 B;  1WAW A;  4ZS6 A;  4P8V A;  1OGG A;  4ODL A;  4NZC A;  1JNS A;  1JCH B;  2PPP A;  2DJY A;  1SYT A;  4HBO A;  2O9O A;  3GTY X;  3I6C A;  4ODM A;  5HT1 A;  1UR9 A;  4MPK A;  3UF8 A;  1FKJ A;  4WIW A;  2PI6 A;  4A0U A;  1Q6I A;  2PV3 A;  2DT1 A;  3CHC A;  1L1P A;  2M08 A;  2BA1 A;  4P8X A;  5DIV A;  1PBK A;  3O5I A;  1PIN A;  1WB0 A;  2LPV A;  4GLX A;  3AQU A;  1FKH A;  2DG3 A;  4WKH A;  5E65 A;  4DZ2 A;  1KT0 A;  4HAR A;  2JX8 A;  1O6I A;  1ZBC A;  2XPA A;  1FAP A;  3FAP A;  4XAK A;  1R9H A;  3OA5 A;  4P8U A;  4TW6 A;  2ETN A;  3M7N A;  4ML4 A;  4Q7N A;  1FKG A;  3RFW A;  1IX5 A;  2KE0 A;  1UR8 A;  3B9A A;  1CTN A;  3RM9 A;  3KAG A;  4GIV A;  1D7H A;  1LL6 A;  3PRD A;  3BXW A;  3KAI A;  1W9U A;  3KAH A;  1E6N A;  3RGC A;  2G8Z A;  1HXV A;  3G6L A;  3KZ7 A;  4S3J A;  2XP7 A;  2EZ5 W;  1O6W A;  4Z2G A;  4WJX A;  1E6R A;  3WL1 A;  2QF8 A; 
#chains in the Genus database with same CATH homology
 4DIP A;  3O5Q A;  1W1V A;  5I98 A;  2A3C A;  3FSB A;  1QPL A;  4MNL A;  4MNJ A;  2UZ5 A;  2DK1 A;  4QZV B;  3OOB A;  3WD0 A;  2KR7 A;  2LKN A;  4MNM A;  2YSB A;  3AS1 A;  2RUD A;  3TCZ A;  5BXJ A;  4ITZ A;  3ARP A;  2PV1 A;  1H0I A;  4N19 A;  1TCO C;  4MAV A;  1EHN A;  1W1T A;  1HKM A;  4DRH A;  2XP9 A;  4W9P A;  1W1Y A;  3AS0 A;  4Q22 A;  2RQS A;  2DSW A;  1YW5 A;  2IUZ A;  4U86 A;  4A0T A;  2ZQU A;  1A7X A;  1E9L A;  3LKX A;  1X6L A;  3JXV A;  3CHF A;  3G6M A;  3M85 A;  4IT6 A;  2M1I A;  5J6E A;  3WQW A;  1VF8 A;  4JFM A;  4DRK A;  3IKG A;  2FDM A;  5HWC A;  1Y0O A;  2JV4 A;  3KAC A;  4MGV A;  3CHD A;  4KQZ A;  2LJ4 A;  2WAD A;  3ARO A;  5E66 A;  1F40 A;  5B8I C;  4NSB A;  2IF4 A;  4TW8 A;  2MF9 A;  5HW7 A;  2XP8 A;  5DF0 A;  4Z2K A;  4LAW A;  3PQH A;  1QZ2 A;  3CGN A;  3MDY B;  1J4H A;  2YSI A;  1NH6 A;  2G41 A;  2YAJ B;  1B6C A;  5CQ2 A;  1N1A A;  2MLZ A;  2RUC A;  3FS8 A;  4Z2H A;  2ITK A;  2F21 A;  4TW7 A;  3IKD A;  4DRP A;  5DO2 A;  5HUA A;  1WMV A;  4ODO A;  2VN1 A;  4ODK A;  1GPF A;  1NWS A;  1LJY A;  4DZ3 A;  2ZR5 A;  4LAV A;  1ZB5 A;  3UI4 A;  2N87 A;  3L4H A;  4QIB A;  2XP5 A;  2Y8N B;  1FKB A;  4JFI A;  1C9H A;  1P5Q A;  3ALF A;  4IPX A;  2F2D A;  3FY1 A;  1D7J A;  3LE4 A;  3LKX B;  2O92 A;  3ARV A;  3CGM A;  4URI A;  1TFV A;  3RM4 A;  1XHG A;  2KI3 A;  3O5M A;  1FKF A;  4P8W A;  2PV2 A;  2L4J A;  1ZL1 A;  1HJW A;  3JYJ A;  1ZU8 A;  1ZBV A;  1ZBW A;  3QOK A;  1TR8 A;  2ZAJ A;  4ODN A;  3ARY A;  1FD9 A;  3WD1 A;  3O5E A;  5HKG A;  2A3E A;  2AOS A;  3ARR A;  1KFW A;  4ODQ A;  1EIB A;  4DH0 A;  3CH9 A;  3PRB A;  2YBT A;  4C02 B;  1ZK6 A;  2OLH A;  5JH8 A;  1EQ3 A;  3O5G A;  3UI5 A;  1LL4 A;  1JNE A;  2M8I A;  5GPR A;  2RSE A;  5D75 A;  5E62 A;  4W9O A;  1FJD A;  3B8S A;  3MCB B;  4ZPT R;  3ARU A;  5HWB A;  4JFJ A;  4DRN A;  3MQG A;  3O5F A;  1E6Z A;  1NWT A;  1SR0 A;  3ART A;  4DRJ A;  3B7X A;  3AS2 A;  3ARQ A;  3EY6 A;  2K8I A;  1U79 A;  2KFW A;  4IT4 A;  4DRM A;  1W26 A;  1E15 A;  4DRO A;  2B31 A;  4MSP A;  4W9Q A;  2XP6 A;  1WNO A;  2DPE A;  2PBC A;  3ODK A;  3FXY A;  1W9V A;  5GPG A;  3O5K A;  3ARS A;  2WLY A;  4WKF A;  1RD6 A;  3FSC A;  2L2S A;  2WAE A;  1X6N A;  3O5O A;  2ZR4 A;  3PRA A;  1Q1C A;  2VCD A;  1D6O A;  3H9R B;  1W9P A;  1FKI A;  3W4R A;  4GGQ A;  2RUQ A;  3B9D A;  2M8J A;  2M3O W;  2PPO A;  1EG4 A;  3KAD A;  5E5W A;  3PR9 A;  4L72 B;  4DWS C;  3WD2 A;  2OFN A;  4MTV A;  2WLZ A;  1HJX A;  1E6P A;  4ODR A;  4S3K A;  4IQ2 A;  4TNS A;  3O5R A;  1NMW A;  5HW8 A;  3KAF A;  5DIU A;  3ARW A;  1QPF A;  1JMQ A;  2FKE A;  2DK7 A;  2DWV A;  4JFL A;  2DSV A;  4BF8 A;  3CNG A;  2YSH A;  4QT3 A;  4DRI A;  1F8A B;  2DSU A;  2MLX A;  4R5E A;  1FKL A;  3AS3 A;  2ZQS A;  1K9R A;  3GPK A;  1I5H W;  4LAX A;  2KGJ A;  4IQC A;  4U85 A;  2FAP A;  3WD3 A;  1NWU A;  2A3A A;  3O5L A;  4LGX A;  3WQV A;  2KO7 A;  2DT0 A;  1HKJ A;  2DMV A;  1J6Y A;  1T11 A;  2YSG A;  5DEZ A;  1OWQ A;  3ARX A;  1J4R A;  2DT3 A;  3NRK A;  2LGO A;  3WD4 A;  4NNR A;  2RUR A;  4O2T A;  2MDI A;  4E5R A;  1OGB A;  1HKK A;  4ODP A;  1LG1 A;  4JFK A;  2JMF A;  4U84 A;  1XRV A;  4R0X A;  3IHZ A;  4QT2 A;  2XP4 A;  3WKZ A;  1EYM A;  3NTP A;  2DG4 A;  1BKF A;  1Q6H A;  1D2K A;  4JYS A;  1ROU A;  1ZCN A;  3CZ8 A;  1J4I A;  1BL4 A;  4J4O A;  3UQA A;  3JYM A;  2D9F A;  3WIJ A;  4G50 A;  3UQB A;  3RME A;  3B9E A;  1HKI A;  2DSZ A;  1EG3 A;  1WR7 A;  1GOI A;  2F4E A;  4DRQ A;  1HJV A;  3WH0 A;  4PTM A;  1K9T A;  2A3B A;  3UI6 A;  1LQ0 A;  5HBF A;  1FKT A;  1FKD A;  4ZPV R;  1FFR A;  4FAP A;  1D7I A;  4DWS D;  2ZR6 A;  1GUV A;  3O5D A;  1FLC A;  4WKA A;  4Z2L A;  2QRV A;  2OWO A;  3TC5 A;  2ZQV A;  4DWS A;  1RP5 A;  3NI6 A;  1ZBK A;  4W5U A;  2PPN A;  2WK2 A;  3MQH A;  3ARZ A;  1LL7 A;  1H0G A;  2DG9 A;  4J4N A;  2ZQT A;  2JXW A;  4HBE A;  4TX0 A;  1NMV A;  1TK7 A;  2DT2 A;  3PA7 A;  4TYO A;  4ZPW R;  3VAW A;  2WM0 A;  3LUO A;  3ALG A;  4REX A;  2JZV A;  2Q5A A;  2RE3 A;  5HTG A;  3WL0 A;  3O5P A;  2M2A A;  2YBU A;  3CHE A;  5GQB A;  1M5Y A;  4AY1 A;  4Z2J A;  1ITX A;  1K9Q A;  1KT1 A;  1YAT A;  3IK8 A;  1JVW A;  3UQI A;  1FKS A;  4DT4 A;  2AWG A;  2MLY A;  1NWR A;  1NSG A;  3KAB A;  1ROT A;  2KXQ A;  2Y78 A;  4LAY A;  1FKR A;  2ESC A;  4WK9 A;  1LG2 A;  5E64 A;  2MNT A;  2YSF A;  1JNT A;  5DIT A;  3O5J A;  3MCB A;  2XP3 A;  5HW6 A;  5AHT A;  1Q6U A;  2MPH A;  3KCE A;  3TDB A;  1EDQ A;  1FFQ A;  1FKK A;  1JND A;  2LAJ A;  2XPB A;  3RM8 A;  4L3N A;  1W1P A;  4DWS B;  4G2P A;  2E45 A;  4Z2I A;  4MNK A;  5U47 A;  4FN2 A;  4KR0 B;  1WAW A;  4ZS6 A;  4P8V A;  1OGG A;  4ODL A;  4NZC A;  1JNS A;  2PPP A;  2DJY A;  1SYT A;  4HBO A;  2O9O A;  3I6C A;  4ODM A;  5HT1 A;  1UR9 A;  4MPK A;  3UF8 A;  1FKJ A;  4WIW A;  2PI6 A;  4A0U A;  1Q6I A;  2PV3 A;  2DT1 A;  3CHC A;  1L1P A;  2M08 A;  2BA1 A;  4P8X A;  5DIV A;  1PBK A;  3O5I A;  1PIN A;  1WB0 A;  2LPV A;  4GLX A;  3AQU A;  1FKH A;  2DG3 A;  4WKH A;  5E65 A;  4DZ2 A;  1KT0 A;  4HAR A;  2JX8 A;  1O6I A;  1ZBC A;  2XPA A;  1FAP A;  3FAP A;  4XAK A;  1R9H A;  3OA5 A;  4P8U A;  4TW6 A;  3M7N A;  4ML4 A;  4Q7N A;  1FKG A;  3RFW A;  1IX5 A;  2KE0 A;  1UR8 A;  3B9A A;  1CTN A;  3RM9 A;  3KAG A;  4GIV A;  1D7H A;  1LL6 A;  3PRD A;  3BXW A;  3KAI A;  1W9U A;  3KAH A;  1E6N A;  3RGC A;  2G8Z A;  1HXV A;  3G6L A;  3KZ7 A;  4S3J A;  2XP7 A;  2EZ5 W;  1O6W A;  4Z2G A;  4WJX A;  1E6R A;  3WL1 A;  2QF8 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...