2ZQUA

Crystal structure of a mutant pin1 peptidyl-prolyl cis-trans isomerase
Total Genus 42
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
42
sequence length
158
structure length
153
Chain Sequence
KLPPGWEKRMSRSSGRVYYFNHITNASQAERPSGGKNGQGEPARVRCSHLLVKHSQSRRPSSWRQEKITRTKEEALELINGYIQKIKSGEEDFESLASQFSDCSSAKARGDLGAFSRGQMQKPFEDASFALRTGEMSGPVFTDSGIHIILRTE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Isomerase
molecule keywords Peptidyl-prolyl cis-trans isomerase NIMA-interacting 1
publication title Structural studies on PIN1 mutants
rcsb
source organism Homo sapiens
total genus 42
structure length 153
sequence length 158
ec nomenclature ec 5.2.1.8: Peptidylprolyl isomerase.
pdb deposition date 2008-08-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00397 WW WW domain
A PF00639 Rotamase PPIC-type PPIASE domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.20.70.10 Mainly Beta Single Sheet Ubiquitin Ligase Nedd4; Chain: W; Ubiquitin Ligase Nedd4; Chain: W; 2zquA01
3.10.50.40 Alpha Beta Roll Chitinase A; domain 3 Chitinase A; domain 3 2zquA02
3VAWA 1TCOC 5HW7A 2BA1A 5DIUA 4TW8A 4U86A 2KGJA 1PBKA 1BL4A 4GIVA 3O5DA 2KFWA 2ITKA 1FD9A 1J4HA 3CNGA 1EG4A 3WH0A 2UZ5A 4GGQA 2M8IA 1I5HW 4J4OA 2VN1A 1F8AB 2ZAJA 1NMVA 2PPPA 2ZR4A 3PA7A 3UI4A 4DRKA 1NSGA 1Q6HA 3RFWA 2LGOA 1FKDA 5AHTA 4REXA 3O5IA 4LAWA 1U79A 1YATA 1EG3A 4W9OA 4U84A 2DK1A 5HW6A 2MF9A 2FKEA 3TC5A 1W26A 4DRNA 1J6YA 2JX8A 2PV1A 2F4EA 4NNRA 1ROUA 3O5PA 3PRBA 2MDIA 4FAPA 2RE3A 4QT3A 2RQSA 4DZ2A 4DRHA 1YW5A 5GPGA 1JMQA 1WMVA 4ODKA 2MNTA 3JYJA 4G50A 3O5JA 2M08A 2DMVA 2KXQA 3KAIA 3IKDA 1FKRA 2XPBA 2M1IA 5HW8A 4FN2A 4MSPA 1B6CA 1K9QA 5D75A 3UI6A 5J6EA 1FAPA 4G2PA 4U85A 1BKFA 1Q6UA 1FKJA 3UQAA 4DZ3A 2LJ4A 2DG4A 3O5LA 3UF8A 2IF4A 2VCDA 3B7XA 2RUDA 4ODLA 2DG3A 2ZQUA 3LE4A 3UI5A 2ZR5A 2MLYA 3IHZA 2Y78A 1R9HA 5CQ2A 3CGNA 4JYSA 4W9PA 1D7IA 3M7NA 3L4HA 3O5MA 2ZQSA 3O5GA 1KT1A 2F21A 3O5RA 3NTPA 2DK7A 3TCZA 2LKNA 2N87A 3LUOA 2RSEA 1FJDA 3O5QA 2ZQTA 4N19A 1FKGA 4TW7A 2KR7A 1M5YA 4IQCA 2PPOA 2K8IA 1JVWA 4JFKA 4DRIA 3IK8A 3KCEA 2XP8A 2JMFA 2LPVA 2MPHA 5DITA 3O5EA 3KAHA 4ODNA 1FKHA 3ODKA 3KABA 2XP6A 1ZK6A 3NRKA 1P5QA 4DRQA 1Y0OA 2AWGA 2RUQA 3NI6A 3KZ7A 3KADA 5HUAA 1WR7A 3JYMA 2PV3A 2JV4A 1Q6IA 3O5KA 2XP5A 4J4NA 1J4IA 2KI3A 2Q5AA 5HWBA 1QPLA 2MLZA 2DG9A 2YSFA 2PBCA 2EZ5W 1EQ3A 1D7HA 3IKGA 4LAYA 2M2AA 2LAJA 1EYMA 2PV2A 5HWCA 4MGVA 2M3OW 2FAPA 1NMWA 4LAVA 1Q1CA 1FKKA 2PPNA 4ODOA 5BXJA 5HKGA 4W9QA 2DJYA 2E45A 2YSIA 2ZQVA 3UQIA 3KACA 4TNSA 4ITZA 1N1AA 3MDYB 5HT1A 1ROTA 1ZCNA 2ZR6A 2XP4A 4LAXA 4DIPA 1F40A 2DWVA 2RURA 3EY6A 1J4RA 4JFIA 4JFMA 2YSGA 4R0XA 5HTGA 2XP9A 5I98A 4ODPA 4O2TA 3GPKA 4TX0A 2XP3A 4BF8A 1FKTA 4JFLA 3TDBA 1TK7A 4TW6A 4DT4A 1HXVA 1KT0A 5DIVA 4DRJA 1QPFA 1D7JA 2XP7A 3PRDA 3M85A 1D6OA 4JFJA 1FKSA 1FKIA 2YSHA 4ODQA 3KAGA 4QIBA 3CGMA 4ODMA 1FKLA 3O5OA 4E5RA 1K9RA 2D9FA 3H9RB 4IPXA 3RGCA 4DH0A 2KE0A 1O6WA 2XPAA 1A7XA 4DROA 4TYOA 2JXWA 4DRMA 4ODRA 3JXVA 1L1PA 1T11A 3O5FA 2JZVA 4C02B 3FAPA 2RUCA 3KAFA 2YSBA 3OOBA 2L4JA 3I6CA 3UQBA 1FKBA 1C9HA 4DRPA 2F2DA 2KO7A 1JNSA 2M8JA 4QT2A 1PINA 1QZ2A 5B8IC 1FKFA 2L2SA 2OFNA 2MLXA 4IQ2A 1JNTA
chains in the Genus database with same CATH superfamily
3B9DA 2DT0A 3VAWA 1TCOC 5HW7A 2BA1A 5DIUA 4TW8A 4U86A 4S3KA 2KGJA 1PBKA 1BL4A 4GIVA 3O5DA 2A3BA 2KFWA 2ITKA 2A3AA 1FD9A 1J4HA 3CNGA 1EG4A 3WH0A 2UZ5A 4GGQA 3B9AA 4HBEA 2M8IA 1ITXA 1I5HW 3MQGA 4J4OA 3RMEA 4ML4A 4P8VA 5E64A 2VN1A 1F8AB 2ZAJA 4KQZA 1NMVA 2PPPA 2ZR4A 1NWSA 3PA7A 1EDQA 3UI4A 4DRKA 4L3NA 1NSGA 1Q6HA 3RFWA 1W1YA 2LGOA 4HBOA 1FKDA 1E6RA 5AHTA 1K9TA 2G41A 4REXA 4MAVA 1JNDA 3O5IA 2WAEA 4LAWA 1U79A 1NWTA 1OGGA 1YATA 1NWRA 3AS1A 1EG3A 5E5WA 3G6LA 2IUZA 1O6IA 1H0IA 4Z2LA 4W9OA 4U84A 4PTMA 2DK1A 1GRJA 1ZBVA 5HW6A 2MF9A 2FKEA 3EIPA 3TC5A 1W26A 4DRNA 1J6YA 1RD6A 3PQHA 2JX8A 2PV1A 2F4EA 4P8WA 4NNRA 3W4RA 1ROUA 3PRAA 3O5PA 3PRBA 3WQWA 2QRVA 4MTVA 2MDIA 1X6LA 3FXYA 4FAPA 2RE3A 5E62A 4QT3A 1TFVA 3ARPA 3WD1A 2RQSA 4DZ2A 1E6NA 3GU0A 4DRHA 1E44A 1YW5A 5GPGA 1SR0A 1EHNA 1JMQA 1OGBA 3ARXA 1WMVA 3ARYA 4ODKA 2MNTA 3JYJA 4G50A 5DO2A 3O5JA 2M08A 1W1TA 3WKZA 4WKFA 4DWSA 3WQVA 1H0GA 2DSZA 1HKKA 2DMVA 2KXQA 3KAIA 3IKDA 4ZPTR 3WD0A 1FKRA 2XPBA 2M1IA 5HW8A 4FN2A 4MSPA 1B6CA 4A0UA 1K9QA 5D75A 3UI6A 5J6EA 1FAPA 4G2PA 4U85A 1BKFA 2DSVA 1Q6UA 1FKJA 3UQAA 4DZ3A 2LJ4A 3ARRA 2P4VA 2DG4A 2ETNA 2YBUA 3O5LA 1E9LA 3CZ8A 3UF8A 4Z2IA 1D2KA 1XHGA 2IF4A 2VCDA 1GUVA 3B7XA 4S3JA 2RUDA 4ODLA 2DG3A 1ZL1A 2ZQUA 2FDMA 3LE4A 3UI5A 1X6NA 3AROA 4DWSD 2ZR5A 2MLYA 4NZCA 1W9UA 3IHZA 4ZPWR 3BMBA 2Y78A 3FY1A 1ZBCA 1R9HA 5CQ2A 3CGNA 4JYSA 4W9PA 3CHEA 5DEZA 2WADA 1D7IA 3LKXA 3M7NA 1E15A 4Z2KA 4IT6A 3L4HA 1EIBA 3O5MA 1ZBWA 1GOIA 4Q7NA 3QOKA 2ZQSA 3O5GA 1E6ZA 1KT1A 1W9PA 2F21A 3ARQA 3WL1A 3O5RA 3NTPA 3MCBA 2DK7A 4HARA 1GPFA 1NH6A 3ALGA 3TCZA 1WNOA 2LKNA 1LL4A 3ARTA 1W1PA 4MNKA 2N87A 3LUOA 2RSEA 1FJDA 1IX5A 3RM9A 4WKHA 3O5QA 2DT2A 2ZQTA 4AY1A 1FLCA 1UR8A 4N19A 1FKGA 5DF0A 4TW7A 2KR7A 2Y8NB 1M5YA 4IQCA 2PPOA 4L72B 3ARUA 2K8IA 1JVWA 4LGXA 4JFKA 3BXWA 4R5EA 4DRIA 3IK8A 2YBTA 3KCEA 2XP8A 2JMFA 5HBFA 2LPVA 2MPHA 1LL7A 5DITA 3AS3A 3O5EA 3KAHA 3CH9A 4ODNA 1FKHA 1HKJA 4Q22A 3CHCA 3ODKA 3KABA 3CHFA 2WM0A 2XP6A 1ZK6A 2ESCA 1RP5A 3NRKA 1LJYA 1P5QA 4DRQA 4GLXA 2B31A 2A3CA 1Y0OA 2AWGA 3FS8A 2EULA 2RUQA 3NI6A 3KZ7A 3KADA 5HUAA 1WR7A 2YAJB 2PV3A 3JYMA 2JV4A 1Q6IA 3O5KA 3OA5A 2XP5A 2O9OA 4Z2JA 4J4NA 1FFRA 1CTNA 1J4IA 1HJVA 3AS2A 2KI3A 2Q5AA 4QZVB 5HWBA 4DWSB 1QPLA 2MLZA 1JNEA 3ARVA 4WJXA 2DG9A 2PN0A 3WD2A 2YSFA 4MPKA 2PBCA 1OWQA 3PR9A 3ALFA 2EZ5W 4URIA 1D7HA 1EQ3A 3IKGA 4LAYA 1NWUA 2M2AA 2LAJA 4XAKA 1EYMA 2PV2A 5HWCA 1LG1A 4MGVA 2M3OW 2FAPA 1JCHB 1NMWA 2WLYA 3WIJA 2DT3A 4LAVA 3WD3A 1Q1CA 1FKKA 2PPNA 4DWSC 4ODOA 3RM8A 5BXJA 1LQ0A 4MNMA 4WKAA 4Z2HA 4KR0B 5HKGA 4W9QA 2DJYA 2E45A 2YSIA 2ZQVA 1XRVA 3KACA 1W9VA 3UQIA 3AS0A 4TNSA 4ITZA 1N1AA 1LL6A 2DT1A 3MDYB 3WL0A 5HT1A 1ROTA 1ZCNA 2ZR6A 1WAWA 4UDMA 2XP4A 4LAXA 4DIPA 5E65A 2DWVA 1F40A 3LKXB 2RURA 3EY6A 1J4RA 4JFIA 4JFMA 2YSGA 5GQBA 4R0XA 5HTGA 2XP9A 5I98A 4ODPA 4O2TA 3GPKA 2B5UB 2G8ZA 4IT4A 4MNLA 4TX0A 2XP3A 3GTYX 4BF8A 3MCBB 4A0TA 2WLZA 2OLHA 1HKIA 1FKTA 4JFLA 3TDBA 1TK7A 4WK9A 4TW6A 3ARSA 4DT4A 1HXVA 1KT0A 5DIVA 3B8SA 4DRJA 1QPFA 4W5UA 1D7JA 2XP7A 3FSCA 1HKMA 3PRDA 3M85A 3WD4A 1D6OA 4JFJA 5JH8A 1FKSA 1FKIA 3ARWA 2YSHA 4ODQA 1LG2A 3KAGA 4QIBA 3CGMA 4ODMA 1ZB5A 1FKLA 2DPEA 2DSUA 1E6PA 3O5OA 3B9EA 2WK2A 1KFWA 4ZS6A 4E5RA 1K9RA 2D9FA 2F23A 3H9RB 4IPXA 3RGCA 2AOSA 1SYTA 4DH0A 2KE0A 1O6WA 2A3EA 2XPAA 1HJWA 1A7XA 4DROA 4TYOA 4NSBA 2JXWA 5GPRA 4DRMA 2DSWA 4ODRA 3JXVA 1L1PA 4WIWA 1T11A 3O5FA 4MNJA 4ZPVR 2JZVA 3AQUA 2QF8A 4C02B 1HJXA 3MQHA 1ZBKA 2O92A 3FAPA 4P8UA 3FSBA 2RUCA 3KAFA 3G6MA 2YSBA 3OOBA 2L4JA 2OWOA 3I6CA 1ZU8A 1UR9A 1TR8A 1VF8A 3UQBA 4Z2GA 1FKBA 1C9HA 4DRPA 2F2DA 2KO7A 1JNSA 3RM4A 2M8JA 1FFQA 4QT2A 5E66A 4P8XA 5U47A 1PINA 1QZ2A 2PI6A 5B8IC 1FKFA 2L2SA 3CHDA 1W1VA 1WB0A 2OFNA 3ARZA 2MLXA 4IQ2A 1JNTA
chains in the Genus database with same CATH topology
3B9DA 2DT0A 3VAWA 1TCOC 5HW7A 2BA1A 5DIUA 4TW8A 4U86A 4S3KA 2KGJA 1PBKA 1BL4A 4GIVA 3O5DA 2A3BA 2KFWA 2ITKA 2A3AA 1FD9A 1J4HA 3CNGA 1EG4A 3WH0A 2UZ5A 4GGQA 3B9AA 4HBEA 2M8IA 1ITXA 1I5HW 3MQGA 4J4OA 3RMEA 4ML4A 4P8VA 5E64A 2VN1A 1F8AB 2ZAJA 4KQZA 1NMVA 2PPPA 2ZR4A 1NWSA 3PA7A 1EDQA 3UI4A 4DRKA 4L3NA 1NSGA 1Q6HA 3RFWA 1W1YA 2LGOA 4HBOA 1FKDA 1E6RA 5AHTA 1K9TA 2G41A 4REXA 4MAVA 1JNDA 3O5IA 2WAEA 4LAWA 1U79A 1NWTA 1OGGA 1YATA 1NWRA 3AS1A 1EG3A 5E5WA 3G6LA 2IUZA 1O6IA 1H0IA 4Z2LA 4W9OA 4U84A 4PTMA 2DK1A 5HW6A 1ZBVA 2MF9A 2FKEA 3TC5A 1W26A 4DRNA 1J6YA 1RD6A 3PQHA 2PV1A 2JX8A 2F4EA 4P8WA 4NNRA 3W4RA 1ROUA 3PRAA 3O5PA 3PRBA 3WQWA 2QRVA 4MTVA 2MDIA 1X6LA 3FXYA 4FAPA 2RE3A 5E62A 4QT3A 1TFVA 3ARPA 3WD1A 2RQSA 4DZ2A 1E6NA 4DRHA 1YW5A 5GPGA 1SR0A 1EHNA 1JMQA 1OGBA 3ARXA 1WMVA 3ARYA 4ODKA 2MNTA 3JYJA 4G50A 5DO2A 3O5JA 2M08A 1W1TA 3WKZA 4WKFA 4DWSA 3WQVA 1H0GA 2DSZA 1HKKA 2DMVA 2KXQA 3KAIA 3IKDA 4ZPTR 3WD0A 1FKRA 2XPBA 2M1IA 5HW8A 4FN2A 4MSPA 1B6CA 4A0UA 1K9QA 5D75A 3UI6A 5J6EA 1FAPA 4G2PA 4U85A 1BKFA 2DSVA 1Q6UA 1FKJA 3UQAA 4DZ3A 2LJ4A 3ARRA 2DG4A 2YBUA 3O5LA 1E9LA 3CZ8A 3UF8A 4Z2IA 1D2KA 1XHGA 2IF4A 2VCDA 1GUVA 3B7XA 4S3JA 2RUDA 4ODLA 2DG3A 1ZL1A 2ZQUA 2FDMA 3LE4A 3UI5A 1X6NA 3AROA 4DWSD 2ZR5A 2MLYA 4NZCA 1W9UA 3IHZA 4ZPWR 2Y78A 3FY1A 1ZBCA 1R9HA 5CQ2A 3CGNA 4JYSA 4W9PA 3CHEA 5DEZA 2WADA 1D7IA 3LKXA 3M7NA 1E15A 4Z2KA 4IT6A 3L4HA 1EIBA 3O5MA 1ZBWA 1GOIA 4Q7NA 3QOKA 2ZQSA 3O5GA 1E6ZA 1KT1A 1W9PA 2F21A 3ARQA 3WL1A 3O5RA 3NTPA 3MCBA 2DK7A 4HARA 1GPFA 1NH6A 3ALGA 3TCZA 1WNOA 2LKNA 1LL4A 3ARTA 1W1PA 4MNKA 2N87A 3LUOA 2RSEA 1FJDA 1IX5A 3RM9A 4WKHA 3O5QA 2DT2A 2ZQTA 4AY1A 1FLCA 1UR8A 4N19A 1FKGA 5DF0A 4TW7A 2KR7A 2Y8NB 1M5YA 4IQCA 2PPOA 4L72B 3ARUA 2K8IA 1JVWA 4LGXA 4JFKA 3BXWA 4R5EA 4DRIA 3IK8A 2YBTA 3KCEA 2XP8A 2JMFA 5HBFA 2LPVA 2MPHA 1LL7A 5DITA 3AS3A 3O5EA 3KAHA 3CH9A 4ODNA 1FKHA 1HKJA 4Q22A 3CHCA 3ODKA 3KABA 3CHFA 2WM0A 2XP6A 1ZK6A 2ESCA 1RP5A 3NRKA 1LJYA 1P5QA 4DRQA 4GLXA 2B31A 2A3CA 1Y0OA 2AWGA 3FS8A 2RUQA 3NI6A 3KZ7A 3KADA 5HUAA 1WR7A 2YAJB 2PV3A 3JYMA 2JV4A 1Q6IA 3O5KA 3OA5A 2XP5A 2O9OA 4Z2JA 4J4NA 1FFRA 1CTNA 1J4IA 1HJVA 3AS2A 2KI3A 2Q5AA 4QZVB 5HWBA 4DWSB 1QPLA 2MLZA 1JNEA 3ARVA 4WJXA 2DG9A 3WD2A 2YSFA 4MPKA 2PBCA 1OWQA 3PR9A 3ALFA 2EZ5W 4URIA 1D7HA 1EQ3A 3IKGA 4LAYA 1NWUA 2M2AA 2LAJA 4XAKA 1EYMA 2PV2A 5HWCA 1LG1A 4MGVA 2M3OW 2FAPA 1NMWA 2WLYA 3WIJA 2DT3A 4LAVA 3WD3A 1Q1CA 1FKKA 2PPNA 4DWSC 4ODOA 3RM8A 5BXJA 1LQ0A 4MNMA 4WKAA 4Z2HA 4KR0B 5HKGA 4W9QA 2DJYA 2E45A 2YSIA 2ZQVA 1XRVA 3KACA 1W9VA 3UQIA 3AS0A 4TNSA 4ITZA 1N1AA 1LL6A 2DT1A 3MDYB 3WL0A 5HT1A 1ROTA 1ZCNA 2ZR6A 1WAWA 2XP4A 4LAXA 4DIPA 5E65A 2DWVA 1F40A 3LKXB 2RURA 3EY6A 1J4RA 4JFIA 4JFMA 2YSGA 5GQBA 4R0XA 5HTGA 2XP9A 5I98A 4ODPA 4O2TA 3GPKA 2G8ZA 4IT4A 4MNLA 4TX0A 2XP3A 4BF8A 3MCBB 4A0TA 2WLZA 2OLHA 1HKIA 1FKTA 4JFLA 3TDBA 1TK7A 4WK9A 4TW6A 3ARSA 4DT4A 1HXVA 1KT0A 5DIVA 3B8SA 4DRJA 1QPFA 4W5UA 1D7JA 2XP7A 3FSCA 1HKMA 3PRDA 3M85A 3WD4A 1D6OA 4JFJA 5JH8A 1FKSA 1FKIA 3ARWA 2YSHA 4ODQA 1LG2A 3KAGA 4QIBA 3CGMA 4ODMA 1ZB5A 1FKLA 2DPEA 2DSUA 1E6PA 3O5OA 3B9EA 2WK2A 1KFWA 4ZS6A 4E5RA 1K9RA 2D9FA 3H9RB 4IPXA 3RGCA 2AOSA 1SYTA 4DH0A 2KE0A 1O6WA 2A3EA 2XPAA 1HJWA 1A7XA 4DROA 4TYOA 4NSBA 2JXWA 5GPRA 4DRMA 2DSWA 4ODRA 3JXVA 1L1PA 4WIWA 1T11A 3O5FA 4MNJA 4ZPVR 2JZVA 3AQUA 2QF8A 4C02B 1HJXA 3MQHA 1ZBKA 2O92A 3FAPA 4P8UA 3FSBA 2RUCA 3KAFA 3G6MA 2YSBA 3OOBA 2L4JA 2OWOA 3I6CA 1ZU8A 1UR9A 1TR8A 1VF8A 3UQBA 4Z2GA 1FKBA 1C9HA 4DRPA 2F2DA 2KO7A 1JNSA 3RM4A 2M8JA 1FFQA 4QT2A 5E66A 4P8XA 5U47A 1PINA 1QZ2A 2PI6A 5B8IC 1FKFA 2L2SA 3CHDA 1W1VA 1WB0A 2OFNA 3ARZA 2MLXA 4IQ2A 1JNTA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3VAW A;  1TCO C;  5HW7 A;  2BA1 A;  5DIU A;  4TW8 A;  4U86 A;  2KGJ A;  1PBK A;  1BL4 A;  4GIV A;  3O5D A;  2KFW A;  2ITK A;  1FD9 A;  1J4H A;  3CNG A;  1EG4 A;  3WH0 A;  2UZ5 A;  4GGQ A;  2M8I A;  1I5H W;  4J4O A;  2VN1 A;  1F8A B;  2ZAJ A;  1NMV A;  2PPP A;  2ZR4 A;  3PA7 A;  3UI4 A;  4DRK A;  1NSG A;  1Q6H A;  3RFW A;  2LGO A;  1FKD A;  5AHT A;  4REX A;  3O5I A;  4LAW A;  1U79 A;  1YAT A;  1EG3 A;  4W9O A;  4U84 A;  2DK1 A;  5HW6 A;  2MF9 A;  2FKE A;  3TC5 A;  1W26 A;  4DRN A;  1J6Y A;  2JX8 A;  2PV1 A;  2F4E A;  4NNR A;  1ROU A;  3O5P A;  3PRB A;  2MDI A;  4FAP A;  2RE3 A;  4QT3 A;  2RQS A;  4DZ2 A;  4DRH A;  1YW5 A;  5GPG A;  1JMQ A;  1WMV A;  4ODK A;  2MNT A;  3JYJ A;  4G50 A;  3O5J A;  2M08 A;  2DMV A;  2KXQ A;  3KAI A;  3IKD A;  1FKR A;  2XPB A;  2M1I A;  5HW8 A;  4FN2 A;  4MSP A;  1B6C A;  1K9Q A;  5D75 A;  3UI6 A;  5J6E A;  1FAP A;  4G2P A;  4U85 A;  1BKF A;  1Q6U A;  1FKJ A;  3UQA A;  4DZ3 A;  2LJ4 A;  2DG4 A;  3O5L A;  3UF8 A;  2IF4 A;  2VCD A;  3B7X A;  2RUD A;  4ODL A;  2DG3 A;  2ZQU A;  3LE4 A;  3UI5 A;  2ZR5 A;  2MLY A;  3IHZ A;  2Y78 A;  1R9H A;  5CQ2 A;  3CGN A;  4JYS A;  4W9P A;  1D7I A;  3M7N A;  3L4H A;  3O5M A;  2ZQS A;  3O5G A;  1KT1 A;  2F21 A;  3O5R A;  3NTP A;  2DK7 A;  3TCZ A;  2LKN A;  2N87 A;  3LUO A;  2RSE A;  1FJD A;  3O5Q A;  2ZQT A;  4N19 A;  1FKG A;  4TW7 A;  2KR7 A;  1M5Y A;  4IQC A;  2PPO A;  2K8I A;  1JVW A;  4JFK A;  4DRI A;  3IK8 A;  3KCE A;  2XP8 A;  2JMF A;  2LPV A;  2MPH A;  5DIT A;  3O5E A;  3KAH A;  4ODN A;  1FKH A;  3ODK A;  3KAB A;  2XP6 A;  1ZK6 A;  3NRK A;  1P5Q A;  4DRQ A;  1Y0O A;  2AWG A;  2RUQ A;  3NI6 A;  3KZ7 A;  3KAD A;  5HUA A;  1WR7 A;  3JYM A;  2PV3 A;  2JV4 A;  1Q6I A;  3O5K A;  2XP5 A;  4J4N A;  1J4I A;  2KI3 A;  2Q5A A;  5HWB A;  1QPL A;  2MLZ A;  2DG9 A;  2YSF A;  2PBC A;  2EZ5 W;  1EQ3 A;  1D7H A;  3IKG A;  4LAY A;  2M2A A;  2LAJ A;  1EYM A;  2PV2 A;  5HWC A;  4MGV A;  2M3O W;  2FAP A;  1NMW A;  4LAV A;  1Q1C A;  1FKK A;  2PPN A;  4ODO A;  5BXJ A;  5HKG A;  4W9Q A;  2DJY A;  2E45 A;  2YSI A;  2ZQV A;  3UQI A;  3KAC A;  4TNS A;  4ITZ A;  1N1A A;  3MDY B;  5HT1 A;  1ROT A;  1ZCN A;  2ZR6 A;  2XP4 A;  4LAX A;  4DIP A;  1F40 A;  2DWV A;  2RUR A;  3EY6 A;  1J4R A;  4JFI A;  4JFM A;  2YSG A;  4R0X A;  5HTG A;  2XP9 A;  5I98 A;  4ODP A;  4O2T A;  3GPK A;  4TX0 A;  2XP3 A;  4BF8 A;  1FKT A;  4JFL A;  3TDB A;  1TK7 A;  4TW6 A;  4DT4 A;  1HXV A;  1KT0 A;  5DIV A;  4DRJ A;  1QPF A;  1D7J A;  2XP7 A;  3PRD A;  3M85 A;  1D6O A;  4JFJ A;  1FKS A;  1FKI A;  2YSH A;  4ODQ A;  3KAG A;  4QIB A;  3CGM A;  4ODM A;  1FKL A;  3O5O A;  4E5R A;  1K9R A;  2D9F A;  3H9R B;  4IPX A;  3RGC A;  4DH0 A;  2KE0 A;  1O6W A;  2XPA A;  1A7X A;  4DRO A;  4TYO A;  2JXW A;  4DRM A;  4ODR A;  3JXV A;  1L1P A;  1T11 A;  3O5F A;  2JZV A;  4C02 B;  3FAP A;  2RUC A;  3KAF A;  2YSB A;  3OOB A;  2L4J A;  3I6C A;  3UQB A;  1FKB A;  1C9H A;  4DRP A;  2F2D A;  2KO7 A;  1JNS A;  2M8J A;  4QT2 A;  1PIN A;  1QZ2 A;  5B8I C;  1FKF A;  2L2S A;  2OFN A;  2MLX A;  4IQ2 A;  1JNT A; 
#chains in the Genus database with same CATH topology
 3B9D A;  2DT0 A;  3VAW A;  1TCO C;  5HW7 A;  2BA1 A;  5DIU A;  4TW8 A;  4U86 A;  4S3K A;  2KGJ A;  1PBK A;  1BL4 A;  4GIV A;  3O5D A;  2A3B A;  2KFW A;  2ITK A;  2A3A A;  1FD9 A;  1J4H A;  3CNG A;  1EG4 A;  3WH0 A;  2UZ5 A;  4GGQ A;  3B9A A;  4HBE A;  2M8I A;  1ITX A;  1I5H W;  3MQG A;  4J4O A;  3RME A;  4ML4 A;  4P8V A;  5E64 A;  2VN1 A;  1F8A B;  2ZAJ A;  4KQZ A;  1NMV A;  2PPP A;  2ZR4 A;  1NWS A;  3PA7 A;  1EDQ A;  3UI4 A;  4DRK A;  4L3N A;  1NSG A;  1Q6H A;  3RFW A;  1W1Y A;  2LGO A;  4HBO A;  1FKD A;  1E6R A;  5AHT A;  1K9T A;  2G41 A;  4REX A;  4MAV A;  1JND A;  3O5I A;  2WAE A;  4LAW A;  1U79 A;  1NWT A;  1OGG A;  1YAT A;  1NWR A;  3AS1 A;  1EG3 A;  5E5W A;  3G6L A;  2IUZ A;  1O6I A;  1H0I A;  4Z2L A;  4W9O A;  4U84 A;  4PTM A;  2DK1 A;  1GRJ A;  1ZBV A;  5HW6 A;  2MF9 A;  2FKE A;  3EIP A;  3TC5 A;  1W26 A;  4DRN A;  1J6Y A;  1RD6 A;  3PQH A;  2JX8 A;  2PV1 A;  2F4E A;  4P8W A;  4NNR A;  3W4R A;  1ROU A;  3PRA A;  3O5P A;  3PRB A;  3WQW A;  2QRV A;  4MTV A;  2MDI A;  1X6L A;  3FXY A;  4FAP A;  2RE3 A;  5E62 A;  4QT3 A;  1TFV A;  3ARP A;  3WD1 A;  2RQS A;  4DZ2 A;  1E6N A;  3GU0 A;  4DRH A;  1E44 A;  1YW5 A;  5GPG A;  1SR0 A;  1EHN A;  1JMQ A;  1OGB A;  3ARX A;  1WMV A;  3ARY A;  4ODK A;  2MNT A;  3JYJ A;  4G50 A;  5DO2 A;  3O5J A;  2M08 A;  1W1T A;  3WKZ A;  4WKF A;  4DWS A;  3WQV A;  1H0G A;  2DSZ A;  1HKK A;  2DMV A;  2KXQ A;  3KAI A;  3IKD A;  4ZPT R;  3WD0 A;  1FKR A;  2XPB A;  2M1I A;  5HW8 A;  4FN2 A;  4MSP A;  1B6C A;  4A0U A;  1K9Q A;  5D75 A;  3UI6 A;  5J6E A;  1FAP A;  4G2P A;  4U85 A;  1BKF A;  2DSV A;  1Q6U A;  1FKJ A;  3UQA A;  4DZ3 A;  2LJ4 A;  3ARR A;  2P4V A;  2DG4 A;  2ETN A;  2YBU A;  3O5L A;  1E9L A;  3CZ8 A;  3UF8 A;  4Z2I A;  1D2K A;  1XHG A;  2IF4 A;  2VCD A;  1GUV A;  3B7X A;  4S3J A;  2RUD A;  4ODL A;  2DG3 A;  1ZL1 A;  2ZQU A;  2FDM A;  3LE4 A;  3UI5 A;  1X6N A;  3ARO A;  4DWS D;  2ZR5 A;  2MLY A;  4NZC A;  1W9U A;  3IHZ A;  4ZPW R;  3BMB A;  2Y78 A;  3FY1 A;  1ZBC A;  1R9H A;  5CQ2 A;  3CGN A;  4JYS A;  4W9P A;  3CHE A;  5DEZ A;  2WAD A;  1D7I A;  3LKX A;  3M7N A;  1E15 A;  4Z2K A;  4IT6 A;  3L4H A;  1EIB A;  3O5M A;  1ZBW A;  1GOI A;  4Q7N A;  3QOK A;  2ZQS A;  3O5G A;  1E6Z A;  1KT1 A;  1W9P A;  2F21 A;  3ARQ A;  3WL1 A;  3O5R A;  3NTP A;  3MCB A;  2DK7 A;  4HAR A;  1GPF A;  1NH6 A;  3ALG A;  3TCZ A;  1WNO A;  2LKN A;  1LL4 A;  3ART A;  1W1P A;  4MNK A;  2N87 A;  3LUO A;  2RSE A;  1FJD A;  1IX5 A;  3RM9 A;  4WKH A;  3O5Q A;  2DT2 A;  2ZQT A;  4AY1 A;  1FLC A;  1UR8 A;  4N19 A;  1FKG A;  5DF0 A;  4TW7 A;  2KR7 A;  2Y8N B;  1M5Y A;  4IQC A;  2PPO A;  4L72 B;  3ARU A;  2K8I A;  1JVW A;  4LGX A;  4JFK A;  3BXW A;  4R5E A;  4DRI A;  3IK8 A;  2YBT A;  3KCE A;  2XP8 A;  2JMF A;  5HBF A;  2LPV A;  2MPH A;  1LL7 A;  5DIT A;  3AS3 A;  3O5E A;  3KAH A;  3CH9 A;  4ODN A;  1FKH A;  1HKJ A;  4Q22 A;  3CHC A;  3ODK A;  3KAB A;  3CHF A;  2WM0 A;  2XP6 A;  1ZK6 A;  2ESC A;  1RP5 A;  3NRK A;  1LJY A;  1P5Q A;  4DRQ A;  4GLX A;  2B31 A;  2A3C A;  1Y0O A;  2AWG A;  3FS8 A;  2EUL A;  2RUQ A;  3NI6 A;  3KZ7 A;  3KAD A;  5HUA A;  1WR7 A;  2YAJ B;  2PV3 A;  3JYM A;  2JV4 A;  1Q6I A;  3O5K A;  3OA5 A;  2XP5 A;  2O9O A;  4Z2J A;  4J4N A;  1FFR A;  1CTN A;  1J4I A;  1HJV A;  3AS2 A;  2KI3 A;  2Q5A A;  4QZV B;  5HWB A;  4DWS B;  1QPL A;  2MLZ A;  1JNE A;  3ARV A;  4WJX A;  2DG9 A;  2PN0 A;  3WD2 A;  2YSF A;  4MPK A;  2PBC A;  1OWQ A;  3PR9 A;  3ALF A;  2EZ5 W;  4URI A;  1D7H A;  1EQ3 A;  3IKG A;  4LAY A;  1NWU A;  2M2A A;  2LAJ A;  4XAK A;  1EYM A;  2PV2 A;  5HWC A;  1LG1 A;  4MGV A;  2M3O W;  2FAP A;  1JCH B;  1NMW A;  2WLY A;  3WIJ A;  2DT3 A;  4LAV A;  3WD3 A;  1Q1C A;  1FKK A;  2PPN A;  4DWS C;  4ODO A;  3RM8 A;  5BXJ A;  1LQ0 A;  4MNM A;  4WKA A;  4Z2H A;  4KR0 B;  5HKG A;  4W9Q A;  2DJY A;  2E45 A;  2YSI A;  2ZQV A;  1XRV A;  3KAC A;  1W9V A;  3UQI A;  3AS0 A;  4TNS A;  4ITZ A;  1N1A A;  1LL6 A;  2DT1 A;  3MDY B;  3WL0 A;  5HT1 A;  1ROT A;  1ZCN A;  2ZR6 A;  1WAW A;  4UDM A;  2XP4 A;  4LAX A;  4DIP A;  5E65 A;  2DWV A;  1F40 A;  3LKX B;  2RUR A;  3EY6 A;  1J4R A;  4JFI A;  4JFM A;  2YSG A;  5GQB A;  4R0X A;  5HTG A;  2XP9 A;  5I98 A;  4ODP A;  4O2T A;  3GPK A;  2B5U B;  2G8Z A;  4IT4 A;  4MNL A;  4TX0 A;  2XP3 A;  3GTY X;  4BF8 A;  3MCB B;  4A0T A;  2WLZ A;  2OLH A;  1HKI A;  1FKT A;  4JFL A;  3TDB A;  1TK7 A;  4WK9 A;  4TW6 A;  3ARS A;  4DT4 A;  1HXV A;  1KT0 A;  5DIV A;  3B8S A;  4DRJ A;  1QPF A;  4W5U A;  1D7J A;  2XP7 A;  3FSC A;  1HKM A;  3PRD A;  3M85 A;  3WD4 A;  1D6O A;  4JFJ A;  5JH8 A;  1FKS A;  1FKI A;  3ARW A;  2YSH A;  4ODQ A;  1LG2 A;  3KAG A;  4QIB A;  3CGM A;  4ODM A;  1ZB5 A;  1FKL A;  2DPE A;  2DSU A;  1E6P A;  3O5O A;  3B9E A;  2WK2 A;  1KFW A;  4ZS6 A;  4E5R A;  1K9R A;  2D9F A;  2F23 A;  3H9R B;  4IPX A;  3RGC A;  2AOS A;  1SYT A;  4DH0 A;  2KE0 A;  1O6W A;  2A3E A;  2XPA A;  1HJW A;  1A7X A;  4DRO A;  4TYO A;  4NSB A;  2JXW A;  5GPR A;  4DRM A;  2DSW A;  4ODR A;  3JXV A;  1L1P A;  4WIW A;  1T11 A;  3O5F A;  4MNJ A;  4ZPV R;  2JZV A;  3AQU A;  2QF8 A;  4C02 B;  1HJX A;  3MQH A;  1ZBK A;  2O92 A;  3FAP A;  4P8U A;  3FSB A;  2RUC A;  3KAF A;  3G6M A;  2YSB A;  3OOB A;  2L4J A;  2OWO A;  3I6C A;  1ZU8 A;  1UR9 A;  1TR8 A;  1VF8 A;  3UQB A;  4Z2G A;  1FKB A;  1C9H A;  4DRP A;  2F2D A;  2KO7 A;  1JNS A;  3RM4 A;  2M8J A;  1FFQ A;  4QT2 A;  5E66 A;  4P8X A;  5U47 A;  1PIN A;  1QZ2 A;  2PI6 A;  5B8I C;  1FKF A;  2L2S A;  3CHD A;  1W1V A;  1WB0 A;  2OFN A;  3ARZ A;  2MLX A;  4IQ2 A;  1JNT A; 
#chains in the Genus database with same CATH homology
 3B9D A;  2DT0 A;  3VAW A;  1TCO C;  5HW7 A;  2BA1 A;  5DIU A;  4TW8 A;  4U86 A;  4S3K A;  2KGJ A;  1PBK A;  1BL4 A;  4GIV A;  3O5D A;  2A3B A;  2KFW A;  2ITK A;  2A3A A;  1FD9 A;  1J4H A;  3CNG A;  1EG4 A;  3WH0 A;  2UZ5 A;  4GGQ A;  3B9A A;  4HBE A;  2M8I A;  1ITX A;  1I5H W;  3MQG A;  4J4O A;  3RME A;  4ML4 A;  4P8V A;  5E64 A;  2VN1 A;  1F8A B;  2ZAJ A;  4KQZ A;  1NMV A;  2PPP A;  2ZR4 A;  1NWS A;  3PA7 A;  1EDQ A;  3UI4 A;  4DRK A;  4L3N A;  1NSG A;  1Q6H A;  3RFW A;  1W1Y A;  2LGO A;  4HBO A;  1FKD A;  1E6R A;  5AHT A;  1K9T A;  2G41 A;  4REX A;  4MAV A;  1JND A;  3O5I A;  2WAE A;  4LAW A;  1U79 A;  1NWT A;  1OGG A;  1YAT A;  1NWR A;  3AS1 A;  1EG3 A;  5E5W A;  3G6L A;  2IUZ A;  1O6I A;  1H0I A;  4Z2L A;  4W9O A;  4U84 A;  4PTM A;  2DK1 A;  5HW6 A;  1ZBV A;  2MF9 A;  2FKE A;  3TC5 A;  1W26 A;  4DRN A;  1J6Y A;  1RD6 A;  3PQH A;  2PV1 A;  2JX8 A;  2F4E A;  4P8W A;  4NNR A;  3W4R A;  1ROU A;  3PRA A;  3O5P A;  3PRB A;  3WQW A;  2QRV A;  4MTV A;  2MDI A;  1X6L A;  3FXY A;  4FAP A;  2RE3 A;  5E62 A;  4QT3 A;  1TFV A;  3ARP A;  3WD1 A;  2RQS A;  4DZ2 A;  1E6N A;  4DRH A;  1YW5 A;  5GPG A;  1SR0 A;  1EHN A;  1JMQ A;  1OGB A;  3ARX A;  1WMV A;  3ARY A;  4ODK A;  2MNT A;  3JYJ A;  4G50 A;  5DO2 A;  3O5J A;  2M08 A;  1W1T A;  3WKZ A;  4WKF A;  4DWS A;  3WQV A;  1H0G A;  2DSZ A;  1HKK A;  2DMV A;  2KXQ A;  3KAI A;  3IKD A;  4ZPT R;  3WD0 A;  1FKR A;  2XPB A;  2M1I A;  5HW8 A;  4FN2 A;  4MSP A;  1B6C A;  4A0U A;  1K9Q A;  5D75 A;  3UI6 A;  5J6E A;  1FAP A;  4G2P A;  4U85 A;  1BKF A;  2DSV A;  1Q6U A;  1FKJ A;  3UQA A;  4DZ3 A;  2LJ4 A;  3ARR A;  2DG4 A;  2YBU A;  3O5L A;  1E9L A;  3CZ8 A;  3UF8 A;  4Z2I A;  1D2K A;  1XHG A;  2IF4 A;  2VCD A;  1GUV A;  3B7X A;  4S3J A;  2RUD A;  4ODL A;  2DG3 A;  1ZL1 A;  2ZQU A;  2FDM A;  3LE4 A;  3UI5 A;  1X6N A;  3ARO A;  4DWS D;  2ZR5 A;  2MLY A;  4NZC A;  1W9U A;  3IHZ A;  4ZPW R;  2Y78 A;  3FY1 A;  1ZBC A;  1R9H A;  5CQ2 A;  3CGN A;  4JYS A;  4W9P A;  3CHE A;  5DEZ A;  2WAD A;  1D7I A;  3LKX A;  3M7N A;  1E15 A;  4Z2K A;  4IT6 A;  3L4H A;  1EIB A;  3O5M A;  1ZBW A;  1GOI A;  4Q7N A;  3QOK A;  2ZQS A;  3O5G A;  1E6Z A;  1KT1 A;  1W9P A;  2F21 A;  3ARQ A;  3WL1 A;  3O5R A;  3NTP A;  3MCB A;  2DK7 A;  4HAR A;  1GPF A;  1NH6 A;  3ALG A;  3TCZ A;  1WNO A;  2LKN A;  1LL4 A;  3ART A;  1W1P A;  4MNK A;  2N87 A;  3LUO A;  2RSE A;  1FJD A;  1IX5 A;  3RM9 A;  4WKH A;  3O5Q A;  2DT2 A;  2ZQT A;  4AY1 A;  1FLC A;  1UR8 A;  4N19 A;  1FKG A;  5DF0 A;  4TW7 A;  2KR7 A;  2Y8N B;  1M5Y A;  4IQC A;  2PPO A;  4L72 B;  3ARU A;  2K8I A;  1JVW A;  4LGX A;  4JFK A;  3BXW A;  4R5E A;  4DRI A;  3IK8 A;  2YBT A;  3KCE A;  2XP8 A;  2JMF A;  5HBF A;  2LPV A;  2MPH A;  1LL7 A;  5DIT A;  3AS3 A;  3O5E A;  3KAH A;  3CH9 A;  4ODN A;  1FKH A;  1HKJ A;  4Q22 A;  3CHC A;  3ODK A;  3KAB A;  3CHF A;  2WM0 A;  2XP6 A;  1ZK6 A;  2ESC A;  1RP5 A;  3NRK A;  1LJY A;  1P5Q A;  4DRQ A;  4GLX A;  2B31 A;  2A3C A;  1Y0O A;  2AWG A;  3FS8 A;  2RUQ A;  3NI6 A;  3KZ7 A;  3KAD A;  5HUA A;  1WR7 A;  2YAJ B;  2PV3 A;  3JYM A;  2JV4 A;  1Q6I A;  3O5K A;  3OA5 A;  2XP5 A;  2O9O A;  4Z2J A;  4J4N A;  1FFR A;  1CTN A;  1J4I A;  1HJV A;  3AS2 A;  2KI3 A;  2Q5A A;  4QZV B;  5HWB A;  4DWS B;  1QPL A;  2MLZ A;  1JNE A;  3ARV A;  4WJX A;  2DG9 A;  3WD2 A;  2YSF A;  4MPK A;  2PBC A;  1OWQ A;  3PR9 A;  3ALF A;  2EZ5 W;  4URI A;  1D7H A;  1EQ3 A;  3IKG A;  4LAY A;  1NWU A;  2M2A A;  2LAJ A;  4XAK A;  1EYM A;  2PV2 A;  5HWC A;  1LG1 A;  4MGV A;  2M3O W;  2FAP A;  1NMW A;  2WLY A;  3WIJ A;  2DT3 A;  4LAV A;  3WD3 A;  1Q1C A;  1FKK A;  2PPN A;  4DWS C;  4ODO A;  3RM8 A;  5BXJ A;  1LQ0 A;  4MNM A;  4WKA A;  4Z2H A;  4KR0 B;  5HKG A;  4W9Q A;  2DJY A;  2E45 A;  2YSI A;  2ZQV A;  1XRV A;  3KAC A;  1W9V A;  3UQI A;  3AS0 A;  4TNS A;  4ITZ A;  1N1A A;  1LL6 A;  2DT1 A;  3MDY B;  3WL0 A;  5HT1 A;  1ROT A;  1ZCN A;  2ZR6 A;  1WAW A;  2XP4 A;  4LAX A;  4DIP A;  5E65 A;  2DWV A;  1F40 A;  3LKX B;  2RUR A;  3EY6 A;  1J4R A;  4JFI A;  4JFM A;  2YSG A;  5GQB A;  4R0X A;  5HTG A;  2XP9 A;  5I98 A;  4ODP A;  4O2T A;  3GPK A;  2G8Z A;  4IT4 A;  4MNL A;  4TX0 A;  2XP3 A;  4BF8 A;  3MCB B;  4A0T A;  2WLZ A;  2OLH A;  1HKI A;  1FKT A;  4JFL A;  3TDB A;  1TK7 A;  4WK9 A;  4TW6 A;  3ARS A;  4DT4 A;  1HXV A;  1KT0 A;  5DIV A;  3B8S A;  4DRJ A;  1QPF A;  4W5U A;  1D7J A;  2XP7 A;  3FSC A;  1HKM A;  3PRD A;  3M85 A;  3WD4 A;  1D6O A;  4JFJ A;  5JH8 A;  1FKS A;  1FKI A;  3ARW A;  2YSH A;  4ODQ A;  1LG2 A;  3KAG A;  4QIB A;  3CGM A;  4ODM A;  1ZB5 A;  1FKL A;  2DPE A;  2DSU A;  1E6P A;  3O5O A;  3B9E A;  2WK2 A;  1KFW A;  4ZS6 A;  4E5R A;  1K9R A;  2D9F A;  3H9R B;  4IPX A;  3RGC A;  2AOS A;  1SYT A;  4DH0 A;  2KE0 A;  1O6W A;  2A3E A;  2XPA A;  1HJW A;  1A7X A;  4DRO A;  4TYO A;  4NSB A;  2JXW A;  5GPR A;  4DRM A;  2DSW A;  4ODR A;  3JXV A;  1L1P A;  4WIW A;  1T11 A;  3O5F A;  4MNJ A;  4ZPV R;  2JZV A;  3AQU A;  2QF8 A;  4C02 B;  1HJX A;  3MQH A;  1ZBK A;  2O92 A;  3FAP A;  4P8U A;  3FSB A;  2RUC A;  3KAF A;  3G6M A;  2YSB A;  3OOB A;  2L4J A;  2OWO A;  3I6C A;  1ZU8 A;  1UR9 A;  1TR8 A;  1VF8 A;  3UQB A;  4Z2G A;  1FKB A;  1C9H A;  4DRP A;  2F2D A;  2KO7 A;  1JNS A;  3RM4 A;  2M8J A;  1FFQ A;  4QT2 A;  5E66 A;  4P8X A;  5U47 A;  1PIN A;  1QZ2 A;  2PI6 A;  5B8I C;  1FKF A;  2L2S A;  3CHD A;  1W1V A;  1WB0 A;  2OFN A;  3ARZ A;  2MLX A;  4IQ2 A;  1JNT A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...