1YW5A

Peptidyl-prolyl isomerase ess1 from candida albicans
Total Genus 55
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
55
sequence length
177
structure length
177
Chain Sequence
MASTSTGLPPNWTIRVSRSHNKEYFLNQSTNESSWDPPYGTDKEVLNAYIAKFKNNGYKPLVNEDGQVRVSHLLIKNNQSRKPKSWKSPDGISRTRDESIQILKKHLERILSGEVKLSELANTESDCSSHDRGGDLGFFSKGQMQPPFEEAAFNLHVGEVSNIIETNSGVHILQRTG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords peptidyl prolyl cis/trans isomerase
publication title The Structure of the Candida albicans Ess1 Prolyl Isomerase Reveals a Well-Ordered Linker that Restricts Domain Mobility
pubmed doi rcsb
source organism Candida albicans
molecule tags Isomerase
total genus 55
structure length 177
sequence length 177
ec nomenclature ec 5.2.1.8: Peptidylprolyl isomerase.
pdb deposition date 2005-02-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00397 WW WW domain
A PF00639 Rotamase PPIC-type PPIASE domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.20.70.10 Mainly Beta Single Sheet Ubiquitin Ligase Nedd4; Chain: W; Ubiquitin Ligase Nedd4; Chain: W; 1yw5A01
3.10.50.40 Alpha Beta Roll Chitinase A; domain 3 Chitinase A; domain 3 1yw5A02
1F8AB 4W9PA 2Y78A 2M8JA 1C9HA 1FKSA 1FAPA 4G2PA 3IKGA 2RQSA 2M8IA 2M08A 1EYMA 1F40A 2ITKA 1YATA 2KE0A 2YSHA 3NTPA 3B7XA 4TW8A 3KAIA 4W9QA 1TCOC 4ITZA 3LE4A 3H9RB 2E45A 1FKTA 3CGMA 2JX8A 4DRIA 3O5EA 1NMVA 5HKGA 1N1AA 3I6CA 1J4IA 1NSGA 1KT0A 2PPPA 2MF9A 1P5QA 3UQAA 2LPVA 3O5JA 1D7HA 5I98A 3UQIA 2KI3A 4MSPA 4BF8A 4JFIA 4DRJA 4IQ2A 4ODRA 4ODNA 1KT1A 3JYMA 4DROA 4JFMA 4R0XA 4TW7A 2YSFA 1R9HA 3NRKA 5HT1A 4G50A 2XPAA 4E5RA 3MDYB 1Q6UA 2BA1A 3CNGA 4DRMA 2VCDA 2MNTA 4TX0A 1J6YA 2KR7A 3EY6A 1EG3A 2FAPA 1D6OA 2XP9A 4JFKA 5AHTA 1Y0OA 2N87A 2DG3A 4ODKA 2RURA 4TW6A 2XP7A 1D7IA 2MLYA 1Q6IA 4NNRA 1EG4A 3KABA 2XP8A 4FN2A 1ZCNA 4DH0A 3OOBA 2F21A 2M1IA 3RFWA 5HW8A 1QPLA 5HWBA 2JXWA 3M85A 3TCZA 5DITA 1ROTA 3FAPA 4U86A 2D9FA 2RUDA 2XP4A 3M7NA 4U85A 2KFWA 2PV1A 3KAHA 4W9OA 1JNSA 1FKJA 4DZ2A 2PPNA 3O5DA 4DIPA 1JMQA 5CQ2A 1FKIA 5DIVA 1WMVA 3KAFA 2JMFA 3ODKA 4FAPA 2L4JA 2AWGA 1D7JA 2ZQVA 4ODLA 4DRPA 3IKDA 2DWVA 3TDBA 1WR7A 1FKRA 4TNSA 3IHZA 1EQ3A 1FKFA 3RGCA 2LAJA 1K9QA 4JFLA 4LAWA 4DZ3A 1O6WA 1HXVA 1A7XA 1FKHA 5HW7A 2F2DA 3O5KA 1ROUA 4J4OA 2DMVA 2K8IA 1J4HA 1BKFA 3O5IA 1FKKA 2EZ5W 1TK7A 2RUQA 1JVWA 4ODMA 3JXVA 1FKBA 5DIUA 3O5GA 4QT3A 3JYJA 4IPXA 1Q6HA 1L1PA 2RSEA 2MPHA 2ZAJA 3GPKA 3KADA 5HWCA 3O5LA 1M5YA 3VAWA 4J4NA 2MLXA 4DT4A 2YSBA 2ZQTA 4GIVA 3TC5A 2LKNA 3UI6A 1NMWA 3O5MA 2ZR4A 1W26A 2PBCA 4MGVA 2RUCA 3KAGA 3O5PA 5D75A 1FKGA 2Q5AA 2UZ5A 1T11A 2LJ4A 2DJYA 1ZK6A 3O5FA 4O2TA 2PPOA 4QT2A 4DRHA 4ODPA 3CGNA 3IK8A 2DG4A 2JV4A 2MDIA 3O5RA 2KGJA 2VN1A 2KXQA 4ODOA 5B8IC 5BXJA 1FJDA 2F4EA 5HW6A 3PA7A 2DK7A 3UI4A 3L4HA 2XPBA 1YW5A 2OFNA 5GPGA 1K9RA 1QPFA 1QZ2A 4LAXA 2ZR6A 4N19A 3O5OA 2XP5A 5HTGA 4ODQA 1I5HW 1JNTA 3KACA 4TYOA 4DRNA 4QIBA 2IF4A 3O5QA 4DRQA 3KCEA 1B6CA 3UQBA 4C02B 4DRKA 2PV3A 2FKEA 2MLZA 2LGOA 2YSIA 3UF8A 3PRDA 1FKDA 4GGQA 2XP3A 2ZQSA 1U79A 3PRBA 1BL4A 3WH0A 4JYSA 4JFJA 1PBKA 2L2SA 1FKLA 2DG9A 1J4RA 4REXA 4LAYA 2YSGA 3UI5A 2KO7A 4IQCA 4LAVA 2PV2A 2RE3A 5HUAA 3NI6A 2M3OW 3LUOA 1PINA 1FD9A 1Q1CA 5J6EA 2JZVA 4U84A 3KZ7A 2ZQUA 2M2AA 2ZR5A 2XP6A 2DK1A
chains in the Genus database with same CATH superfamily
5E66A 3LKXB 4UDMA 1ZU8A 3MQHA 1F8AB 4W9PA 2Y78A 1NH6A 2M8JA 2OWOA 1C9HA 4LGXA 3RM8A 1FKSA 3AS3A 1FAPA 1WNOA 4G2PA 1W9PA 3CHDA 3IKGA 2RQSA 4URIA 2O92A 1UR9A 2M8IA 3ARYA 1W9VA 4PTMA 2M08A 1SYTA 1EYMA 1F40A 2ITKA 1EIBA 1YATA 3PR9A 2KE0A 2YSHA 3NTPA 2A3EA 1W9UA 1X6LA 3B7XA 4TW8A 3KAIA 4ZPVR 2EULA 4W9QA 1TCOC 4ITZA 3LE4A 3H9RB 2E45A 1TFVA 1FKTA 3CGMA 2JX8A 4QZVB 4DRIA 3O5EA 1NMVA 1LJYA 5HBFA 5HKGA 3ARZA 1N1AA 3I6CA 1J4IA 1NSGA 3FY1A 3MCBB 2IUZA 4Q22A 1KT0A 2PPPA 2MF9A 1P5QA 3UQAA 1NWRA 2LPVA 3EIPA 3O5JA 1D7HA 1VF8A 5I98A 3UQIA 1LG1A 4HARA 2KI3A 4MSPA 4BF8A 4JFIA 4Z2KA 3RM9A 1E44A 4KR0B 4DRJA 4IQ2A 4ODRA 1CTNA 5DF0A 4ODNA 1KT1A 3JYMA 1GUVA 4DROA 4JFMA 2DT1A 1GOIA 1HJXA 1E6RA 4R0XA 4TW7A 3WKZA 2YSFA 1R9HA 3NRKA 5HT1A 3PRAA 4G50A 1HJVA 2XPAA 4E5RA 3MDYB 5DO2A 1Q6UA 2BA1A 3CNGA 1LL7A 5JH8A 4DRMA 3BMBA 1K9TA 2VCDA 4WKHA 2MNTA 4TX0A 2ETNA 1J6YA 2KR7A 1EG3A 3EY6A 2FAPA 1D6OA 1D2KA 2XP9A 4JFKA 2DSZA 2WAEA 1ITXA 3PQHA 5AHTA 1Y0OA 2N87A 2DG3A 1IX5A 4WKAA 1E6NA 2O9OA 2P4VA 4ODKA 2RURA 1H0GA 1GPFA 4L3NA 2YBUA 4DWSC 4TW6A 2XP7A 1D7IA 2MLYA 4DWSB 1Q6IA 4NNRA 1EG4A 3AS0A 4P8WA 3KABA 2XP8A 3GTYX 1NWUA 4FN2A 1ZCNA 5GPRA 4DH0A 4MNMA 3ARWA 3OOBA 1H0IA 2DT2A 4P8VA 2F21A 5GQBA 2M1IA 3GU0A 3RFWA 1XRVA 1QPLA 5HW8A 5HWBA 1JCHB 2JXWA 3M85A 2WM0A 3TCZA 5DITA 3QOKA 1HKKA 4ZPWR 1ROTA 3FAPA 4U86A 2D9FA 2RUDA 4S3JA 2XP4A 4WK9A 4R5EA 1JNEA 3RMEA 1KFWA 3M7NA 4U85A 5E62A 1HKJA 2KFWA 4GLXA 1HKMA 2PV1A 3KAHA 4W9OA 1JNSA 1EHNA 1FKJA 4DZ2A 1UR8A 2PPNA 3O5DA 1ZBVA 3WQWA 4DIPA 1JMQA 5CQ2A 1FKIA 1W1PA 5DEZA 5DIVA 1LL6A 3W4RA 3ARRA 1WMVA 3KAFA 1OWQA 2JMFA 3AS2A 5E64A 3MQGA 3ODKA 2QF8A 4HBOA 4FAPA 2L4JA 2AWGA 1TR8A 1D7JA 2ZQVA 4ODLA 4DRPA 1ZL1A 2F23A 2PN0A 3IKDA 2DWVA 3TDBA 1WR7A 1FKRA 2G41A 4TNSA 4W5UA 4WIWA 1NWTA 3IHZA 1EQ3A 1FKFA 3ALGA 2DSVA 3RGCA 2LAJA 1K9QA 4JFLA 4LAWA 3ARVA 4DZ3A 1O6WA 1HXVA 5U47A 1A7XA 1FKHA 2DT3A 1ZB5A 5HW7A 2F2DA 3LKXA 1E9LA 3O5KA 4Z2JA 1GRJA 4MNLA 1ROUA 4J4OA 2DMVA 2K8IA 1J4HA 1BKFA 3O5IA 4IT6A 1FKKA 2EZ5W 1TK7A 2WK2A 2RUQA 1JVWA 3CZ8A 4ODMA 3JXVA 1FKBA 1E6PA 3ARSA 1HJWA 5DIUA 2B31A 3WD3A 3O5GA 1FFRA 1FFQA 4QT3A 3AROA 1ZBWA 3JYJA 4IPXA 4MNKA 1Q6HA 3WD0A 1L1PA 2RSEA 2MPHA 3ARTA 3OA5A 2ZAJA 1WAWA 3GPKA 1W1YA 3KADA 5HWCA 2Y8NB 3O5LA 1M5YA 3CHCA 3VAWA 4P8UA 4J4NA 4MTVA 4Z2IA 2MLXA 4DT4A 2YSBA 4Z2GA 3CHFA 2ZQTA 3BXWA 4GIVA 4NZCA 3TC5A 2LKNA 1EDQA 3UI6A 1NMWA 1FLCA 2ESCA 3O5MA 2ZR4A 3ARXA 1W26A 2PBCA 4MGVA 2RUCA 3FSCA 3KAGA 3O5PA 5D75A 4WKFA 1FKGA 4S3KA 2Q5AA 2UZ5A 1T11A 2LJ4A 2B5UB 3WD1A 1ZBCA 1JNDA 2DJYA 3WD2A 1ZK6A 3O5FA 4O2TA 2PPOA 4QT2A 1WB0A 4AY1A 4Z2HA 4ZPTR 4DRHA 3G6LA 4ODPA 3CGNA 2A3BA 1ZBKA 4XAKA 5E65A 3IK8A 2DG4A 2JV4A 2MDIA 1W1TA 3O5RA 2KGJA 2VN1A 2KXQA 4ODOA 3RM4A 5B8IC 5BXJA 1FJDA 3FS8A 3B8SA 4KQZA 4L72B 2F4EA 5HW6A 1RP5A 3PA7A 2DK7A 1E15A 2A3AA 3UI4A 4MNJA 3L4HA 2XPBA 3WL0A 1YW5A 2OFNA 2YAJB 5GPGA 3AS1A 3G6MA 4A0TA 1O6IA 4P8XA 1NWSA 4MAVA 3ARUA 1K9RA 3ARQA 1QPFA 1QZ2A 4LAXA 2YBTA 2ZR6A 4N19A 1LL4A 2PI6A 2WLYA 1X6NA 3O5OA 1LQ0A 4DWSA 2XP5A 4NSBA 4ODQA 3WQVA 1I5HW 5HTGA 1JNTA 5E5WA 3KACA 3AQUA 2WLZA 4TYOA 1SR0A 4QIBA 4WJXA 4DRNA 4Q7NA 2IF4A 3B9EA 3WIJA 2OLHA 3B9AA 4MPKA 2DSUA 1OGGA 4A0UA 3O5QA 3FSBA 4DRQA 4DWSD 3KCEA 1B6CA 3UQBA 4C02B 4DRKA 2PV3A 2FKEA 2MLZA 2LGOA 2YSIA 3UF8A 2G8ZA 3PRDA 2AOSA 1FKDA 4GGQA 2XP3A 2ZQSA 1U79A 3PRBA 2DPEA 1BL4A 3FXYA 3WH0A 4JYSA 1XHGA 4JFJA 1PBKA 2L2SA 2WADA 1FKLA 2DG9A 1J4RA 3ALFA 3WD4A 2DT0A 4IT4A 4REXA 4LAYA 2YSGA 3CHEA 4ZS6A 3UI5A 1HKIA 1LG2A 2KO7A 4IQCA 4LAVA 3WL1A 1W1VA 2PV2A 2RE3A 4Z2LA 5HUAA 1E6ZA 3NI6A 1RD6A 2M3OW 3ARPA 2DSWA 4HBEA 3MCBA 1PINA 1FD9A 1Q1CA 3LUOA 4ML4A 5J6EA 2FDMA 3CH9A 2JZVA 4U84A 3KZ7A 2ZQUA 1OGBA 2A3CA 2M2AA 3B9DA 2ZR5A 2XP6A 2DK1A 2QRVA
chains in the Genus database with same CATH topology
5E66A 3LKXB 1ZU8A 3MQHA 1F8AB 4W9PA 2Y78A 1NH6A 2M8JA 2OWOA 1C9HA 4LGXA 3RM8A 1FKSA 3AS3A 1FAPA 1WNOA 4G2PA 1W9PA 3CHDA 3IKGA 2RQSA 4URIA 2O92A 1UR9A 2M8IA 3ARYA 1W9VA 4PTMA 2M08A 1SYTA 1EYMA 1F40A 2ITKA 1EIBA 1YATA 3PR9A 2KE0A 2YSHA 3NTPA 2A3EA 1W9UA 1X6LA 3B7XA 4TW8A 3KAIA 4ZPVR 4W9QA 1TCOC 4ITZA 3LE4A 3H9RB 2E45A 1TFVA 1FKTA 3CGMA 2JX8A 4QZVB 4DRIA 3O5EA 1NMVA 1LJYA 5HBFA 5HKGA 3ARZA 1N1AA 3I6CA 1J4IA 1NSGA 3FY1A 3MCBB 2IUZA 4Q22A 1KT0A 2PPPA 2MF9A 1P5QA 3UQAA 1NWRA 2LPVA 3O5JA 1D7HA 1VF8A 5I98A 3UQIA 1LG1A 4HARA 2KI3A 4MSPA 4BF8A 4JFIA 4Z2KA 3RM9A 4KR0B 4DRJA 4IQ2A 4ODRA 1CTNA 5DF0A 4ODNA 1KT1A 3JYMA 1GUVA 4DROA 4JFMA 2DT1A 1GOIA 1HJXA 1E6RA 4R0XA 4TW7A 3WKZA 2YSFA 1R9HA 3NRKA 5HT1A 3PRAA 4G50A 1HJVA 2XPAA 4E5RA 3MDYB 5DO2A 1Q6UA 2BA1A 3CNGA 1LL7A 5JH8A 4DRMA 1K9TA 2VCDA 4WKHA 2MNTA 4TX0A 1J6YA 2KR7A 1EG3A 3EY6A 2FAPA 1D6OA 1D2KA 2XP9A 4JFKA 2DSZA 2WAEA 1ITXA 3PQHA 5AHTA 1Y0OA 2N87A 2DG3A 1IX5A 4WKAA 1E6NA 2O9OA 4ODKA 2RURA 1H0GA 1GPFA 4L3NA 2YBUA 4DWSC 4TW6A 2XP7A 1D7IA 2MLYA 4DWSB 1Q6IA 4NNRA 1EG4A 3AS0A 4P8WA 3KABA 2XP8A 1NWUA 4FN2A 1ZCNA 5GPRA 4DH0A 4MNMA 3ARWA 3OOBA 1H0IA 2DT2A 4P8VA 2F21A 5GQBA 2M1IA 3RFWA 1XRVA 1QPLA 5HW8A 5HWBA 2WM0A 2JXWA 3M85A 3TCZA 5DITA 3QOKA 1HKKA 4ZPWR 1ROTA 3FAPA 4U86A 2D9FA 2RUDA 4S3JA 2XP4A 4WK9A 4R5EA 1JNEA 3RMEA 1KFWA 3M7NA 4U85A 5E62A 1HKJA 2KFWA 4GLXA 1HKMA 2PV1A 3KAHA 4W9OA 1JNSA 1EHNA 1FKJA 4DZ2A 1UR8A 2PPNA 3O5DA 1ZBVA 3WQWA 4DIPA 1JMQA 5CQ2A 1FKIA 1W1PA 5DEZA 5DIVA 1LL6A 3W4RA 3ARRA 1WMVA 3KAFA 1OWQA 2JMFA 3AS2A 5E64A 3MQGA 3ODKA 2QF8A 4HBOA 4FAPA 2L4JA 2AWGA 1TR8A 1D7JA 2ZQVA 4ODLA 4DRPA 1ZL1A 3IKDA 2DWVA 3TDBA 1WR7A 1FKRA 2G41A 4TNSA 4W5UA 4WIWA 1NWTA 3IHZA 1EQ3A 1FKFA 3ALGA 2DSVA 3RGCA 2LAJA 1K9QA 4JFLA 4LAWA 3ARVA 4DZ3A 1O6WA 1HXVA 5U47A 1A7XA 1FKHA 2DT3A 1ZB5A 5HW7A 2F2DA 3LKXA 1E9LA 3O5KA 4Z2JA 4MNLA 1ROUA 4J4OA 2DMVA 2K8IA 1J4HA 1BKFA 3O5IA 4IT6A 1FKKA 2EZ5W 1TK7A 2WK2A 2RUQA 1JVWA 3CZ8A 4ODMA 3JXVA 1FKBA 1E6PA 3ARSA 1HJWA 5DIUA 2B31A 3WD3A 3O5GA 1FFRA 1FFQA 4QT3A 3AROA 1ZBWA 3JYJA 4IPXA 4MNKA 1Q6HA 3WD0A 1L1PA 2RSEA 2MPHA 3ARTA 3OA5A 2ZAJA 1WAWA 3GPKA 1W1YA 3KADA 5HWCA 2Y8NB 3O5LA 1M5YA 3CHCA 3VAWA 4P8UA 4J4NA 4MTVA 4Z2IA 2MLXA 4DT4A 2YSBA 4Z2GA 3CHFA 2ZQTA 3BXWA 4GIVA 4NZCA 3TC5A 2LKNA 1EDQA 3UI6A 1NMWA 1FLCA 2ESCA 3O5MA 2ZR4A 3ARXA 1W26A 2PBCA 4MGVA 2RUCA 3FSCA 3KAGA 3O5PA 5D75A 4WKFA 1FKGA 4S3KA 2Q5AA 2UZ5A 1T11A 2LJ4A 3WD1A 1ZBCA 1JNDA 2DJYA 3WD2A 1ZK6A 3O5FA 4O2TA 2PPOA 4QT2A 1WB0A 4AY1A 4Z2HA 4ZPTR 4DRHA 3G6LA 4ODPA 3CGNA 2A3BA 1ZBKA 4XAKA 5E65A 3IK8A 2DG4A 2JV4A 2MDIA 1W1TA 3O5RA 2KGJA 2VN1A 2KXQA 4ODOA 3RM4A 5B8IC 5BXJA 1FJDA 3FS8A 3B8SA 4KQZA 4L72B 2F4EA 5HW6A 1RP5A 3PA7A 2DK7A 1E15A 2A3AA 3UI4A 4MNJA 3L4HA 2XPBA 3WL0A 1YW5A 2OFNA 2YAJB 5GPGA 3AS1A 3G6MA 4A0TA 1O6IA 4P8XA 1NWSA 4MAVA 3ARUA 1K9RA 3ARQA 1QPFA 1QZ2A 4LAXA 2YBTA 2ZR6A 4N19A 1LL4A 2PI6A 2WLYA 1X6NA 3O5OA 1LQ0A 4DWSA 2XP5A 4NSBA 4ODQA 3WQVA 1I5HW 5HTGA 1JNTA 5E5WA 3KACA 3AQUA 2WLZA 4TYOA 1SR0A 4QIBA 4WJXA 4DRNA 4Q7NA 2IF4A 3B9EA 3WIJA 2OLHA 3B9AA 4MPKA 2DSUA 1OGGA 4A0UA 3O5QA 3FSBA 4DRQA 4DWSD 3KCEA 1B6CA 3UQBA 4C02B 4DRKA 2PV3A 2FKEA 2MLZA 2LGOA 2YSIA 3UF8A 2G8ZA 3PRDA 2AOSA 1FKDA 4GGQA 2XP3A 2ZQSA 1U79A 3PRBA 2DPEA 1BL4A 3FXYA 3WH0A 4JYSA 1XHGA 4JFJA 1PBKA 2L2SA 2WADA 1FKLA 2DG9A 1J4RA 3ALFA 3WD4A 2DT0A 4IT4A 4REXA 4LAYA 2YSGA 3CHEA 4ZS6A 3UI5A 1HKIA 1LG2A 2KO7A 4IQCA 4LAVA 3WL1A 1W1VA 2PV2A 2RE3A 4Z2LA 5HUAA 1E6ZA 3NI6A 1RD6A 2M3OW 3ARPA 2DSWA 4HBEA 3MCBA 1PINA 1FD9A 1Q1CA 3LUOA 4ML4A 5J6EA 2FDMA 3CH9A 2JZVA 4U84A 3KZ7A 2ZQUA 1OGBA 2A3CA 2M2AA 3B9DA 2ZR5A 2XP6A 2DK1A 2QRVA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1F8A B;  4W9P A;  2Y78 A;  2M8J A;  1C9H A;  1FKS A;  1FAP A;  4G2P A;  3IKG A;  2RQS A;  2M8I A;  2M08 A;  1EYM A;  1F40 A;  2ITK A;  1YAT A;  2KE0 A;  2YSH A;  3NTP A;  3B7X A;  4TW8 A;  3KAI A;  4W9Q A;  1TCO C;  4ITZ A;  3LE4 A;  3H9R B;  2E45 A;  1FKT A;  3CGM A;  2JX8 A;  4DRI A;  3O5E A;  1NMV A;  5HKG A;  1N1A A;  3I6C A;  1J4I A;  1NSG A;  1KT0 A;  2PPP A;  2MF9 A;  1P5Q A;  3UQA A;  2LPV A;  3O5J A;  1D7H A;  5I98 A;  3UQI A;  2KI3 A;  4MSP A;  4BF8 A;  4JFI A;  4DRJ A;  4IQ2 A;  4ODR A;  4ODN A;  1KT1 A;  3JYM A;  4DRO A;  4JFM A;  4R0X A;  4TW7 A;  2YSF A;  1R9H A;  3NRK A;  5HT1 A;  4G50 A;  2XPA A;  4E5R A;  3MDY B;  1Q6U A;  2BA1 A;  3CNG A;  4DRM A;  2VCD A;  2MNT A;  4TX0 A;  1J6Y A;  2KR7 A;  3EY6 A;  1EG3 A;  2FAP A;  1D6O A;  2XP9 A;  4JFK A;  5AHT A;  1Y0O A;  2N87 A;  2DG3 A;  4ODK A;  2RUR A;  4TW6 A;  2XP7 A;  1D7I A;  2MLY A;  1Q6I A;  4NNR A;  1EG4 A;  3KAB A;  2XP8 A;  4FN2 A;  1ZCN A;  4DH0 A;  3OOB A;  2F21 A;  2M1I A;  3RFW A;  5HW8 A;  1QPL A;  5HWB A;  2JXW A;  3M85 A;  3TCZ A;  5DIT A;  1ROT A;  3FAP A;  4U86 A;  2D9F A;  2RUD A;  2XP4 A;  3M7N A;  4U85 A;  2KFW A;  2PV1 A;  3KAH A;  4W9O A;  1JNS A;  1FKJ A;  4DZ2 A;  2PPN A;  3O5D A;  4DIP A;  1JMQ A;  5CQ2 A;  1FKI A;  5DIV A;  1WMV A;  3KAF A;  2JMF A;  3ODK A;  4FAP A;  2L4J A;  2AWG A;  1D7J A;  2ZQV A;  4ODL A;  4DRP A;  3IKD A;  2DWV A;  3TDB A;  1WR7 A;  1FKR A;  4TNS A;  3IHZ A;  1EQ3 A;  1FKF A;  3RGC A;  2LAJ A;  1K9Q A;  4JFL A;  4LAW A;  4DZ3 A;  1O6W A;  1HXV A;  1A7X A;  1FKH A;  5HW7 A;  2F2D A;  3O5K A;  1ROU A;  4J4O A;  2DMV A;  2K8I A;  1J4H A;  1BKF A;  3O5I A;  1FKK A;  2EZ5 W;  1TK7 A;  2RUQ A;  1JVW A;  4ODM A;  3JXV A;  1FKB A;  5DIU A;  3O5G A;  4QT3 A;  3JYJ A;  4IPX A;  1Q6H A;  1L1P A;  2RSE A;  2MPH A;  2ZAJ A;  3GPK A;  3KAD A;  5HWC A;  3O5L A;  1M5Y A;  3VAW A;  4J4N A;  2MLX A;  4DT4 A;  2YSB A;  2ZQT A;  4GIV A;  3TC5 A;  2LKN A;  3UI6 A;  1NMW A;  3O5M A;  2ZR4 A;  1W26 A;  2PBC A;  4MGV A;  2RUC A;  3KAG A;  3O5P A;  5D75 A;  1FKG A;  2Q5A A;  2UZ5 A;  1T11 A;  2LJ4 A;  2DJY A;  1ZK6 A;  3O5F A;  4O2T A;  2PPO A;  4QT2 A;  4DRH A;  4ODP A;  3CGN A;  3IK8 A;  2DG4 A;  2JV4 A;  2MDI A;  3O5R A;  2KGJ A;  2VN1 A;  2KXQ A;  4ODO A;  5B8I C;  5BXJ A;  1FJD A;  2F4E A;  5HW6 A;  3PA7 A;  2DK7 A;  3UI4 A;  3L4H A;  2XPB A;  1YW5 A;  2OFN A;  5GPG A;  1K9R A;  1QPF A;  1QZ2 A;  4LAX A;  2ZR6 A;  4N19 A;  3O5O A;  2XP5 A;  5HTG A;  4ODQ A;  1I5H W;  1JNT A;  3KAC A;  4TYO A;  4DRN A;  4QIB A;  2IF4 A;  3O5Q A;  4DRQ A;  3KCE A;  1B6C A;  3UQB A;  4C02 B;  4DRK A;  2PV3 A;  2FKE A;  2MLZ A;  2LGO A;  2YSI A;  3UF8 A;  3PRD A;  1FKD A;  4GGQ A;  2XP3 A;  2ZQS A;  1U79 A;  3PRB A;  1BL4 A;  3WH0 A;  4JYS A;  4JFJ A;  1PBK A;  2L2S A;  1FKL A;  2DG9 A;  1J4R A;  4REX A;  4LAY A;  2YSG A;  3UI5 A;  2KO7 A;  4IQC A;  4LAV A;  2PV2 A;  2RE3 A;  5HUA A;  3NI6 A;  2M3O W;  3LUO A;  1PIN A;  1FD9 A;  1Q1C A;  5J6E A;  2JZV A;  4U84 A;  3KZ7 A;  2ZQU A;  2M2A A;  2ZR5 A;  2XP6 A;  2DK1 A; 
#chains in the Genus database with same CATH topology
 5E66 A;  3LKX B;  4UDM A;  1ZU8 A;  3MQH A;  1F8A B;  4W9P A;  2Y78 A;  1NH6 A;  2M8J A;  2OWO A;  1C9H A;  4LGX A;  3RM8 A;  1FKS A;  3AS3 A;  1FAP A;  1WNO A;  4G2P A;  1W9P A;  3CHD A;  3IKG A;  2RQS A;  4URI A;  2O92 A;  1UR9 A;  2M8I A;  3ARY A;  1W9V A;  4PTM A;  2M08 A;  1SYT A;  1EYM A;  1F40 A;  2ITK A;  1EIB A;  1YAT A;  3PR9 A;  2KE0 A;  2YSH A;  3NTP A;  2A3E A;  1W9U A;  1X6L A;  3B7X A;  4TW8 A;  3KAI A;  4ZPV R;  2EUL A;  4W9Q A;  1TCO C;  4ITZ A;  3LE4 A;  3H9R B;  2E45 A;  1TFV A;  1FKT A;  3CGM A;  2JX8 A;  4QZV B;  4DRI A;  3O5E A;  1NMV A;  1LJY A;  5HBF A;  5HKG A;  3ARZ A;  1N1A A;  3I6C A;  1J4I A;  1NSG A;  3FY1 A;  3MCB B;  2IUZ A;  4Q22 A;  1KT0 A;  2PPP A;  2MF9 A;  1P5Q A;  3UQA A;  1NWR A;  2LPV A;  3EIP A;  3O5J A;  1D7H A;  1VF8 A;  5I98 A;  3UQI A;  1LG1 A;  4HAR A;  2KI3 A;  4MSP A;  4BF8 A;  4JFI A;  4Z2K A;  3RM9 A;  1E44 A;  4KR0 B;  4DRJ A;  4IQ2 A;  4ODR A;  1CTN A;  5DF0 A;  4ODN A;  1KT1 A;  3JYM A;  1GUV A;  4DRO A;  4JFM A;  2DT1 A;  1GOI A;  1HJX A;  1E6R A;  4R0X A;  4TW7 A;  3WKZ A;  2YSF A;  1R9H A;  3NRK A;  5HT1 A;  3PRA A;  4G50 A;  1HJV A;  2XPA A;  4E5R A;  3MDY B;  5DO2 A;  1Q6U A;  2BA1 A;  3CNG A;  1LL7 A;  5JH8 A;  4DRM A;  3BMB A;  1K9T A;  2VCD A;  4WKH A;  2MNT A;  4TX0 A;  2ETN A;  1J6Y A;  2KR7 A;  1EG3 A;  3EY6 A;  2FAP A;  1D6O A;  1D2K A;  2XP9 A;  4JFK A;  2DSZ A;  2WAE A;  1ITX A;  3PQH A;  5AHT A;  1Y0O A;  2N87 A;  2DG3 A;  1IX5 A;  4WKA A;  1E6N A;  2O9O A;  2P4V A;  4ODK A;  2RUR A;  1H0G A;  1GPF A;  4L3N A;  2YBU A;  4DWS C;  4TW6 A;  2XP7 A;  1D7I A;  2MLY A;  4DWS B;  1Q6I A;  4NNR A;  1EG4 A;  3AS0 A;  4P8W A;  3KAB A;  2XP8 A;  3GTY X;  1NWU A;  4FN2 A;  1ZCN A;  5GPR A;  4DH0 A;  4MNM A;  3ARW A;  3OOB A;  1H0I A;  2DT2 A;  4P8V A;  2F21 A;  5GQB A;  2M1I A;  3GU0 A;  3RFW A;  1XRV A;  1QPL A;  5HW8 A;  5HWB A;  1JCH B;  2JXW A;  3M85 A;  2WM0 A;  3TCZ A;  5DIT A;  3QOK A;  1HKK A;  4ZPW R;  1ROT A;  3FAP A;  4U86 A;  2D9F A;  2RUD A;  4S3J A;  2XP4 A;  4WK9 A;  4R5E A;  1JNE A;  3RME A;  1KFW A;  3M7N A;  4U85 A;  5E62 A;  1HKJ A;  2KFW A;  4GLX A;  1HKM A;  2PV1 A;  3KAH A;  4W9O A;  1JNS A;  1EHN A;  1FKJ A;  4DZ2 A;  1UR8 A;  2PPN A;  3O5D A;  1ZBV A;  3WQW A;  4DIP A;  1JMQ A;  5CQ2 A;  1FKI A;  1W1P A;  5DEZ A;  5DIV A;  1LL6 A;  3W4R A;  3ARR A;  1WMV A;  3KAF A;  1OWQ A;  2JMF A;  3AS2 A;  5E64 A;  3MQG A;  3ODK A;  2QF8 A;  4HBO A;  4FAP A;  2L4J A;  2AWG A;  1TR8 A;  1D7J A;  2ZQV A;  4ODL A;  4DRP A;  1ZL1 A;  2F23 A;  2PN0 A;  3IKD A;  2DWV A;  3TDB A;  1WR7 A;  1FKR A;  2G41 A;  4TNS A;  4W5U A;  4WIW A;  1NWT A;  3IHZ A;  1EQ3 A;  1FKF A;  3ALG A;  2DSV A;  3RGC A;  2LAJ A;  1K9Q A;  4JFL A;  4LAW A;  3ARV A;  4DZ3 A;  1O6W A;  1HXV A;  5U47 A;  1A7X A;  1FKH A;  2DT3 A;  1ZB5 A;  5HW7 A;  2F2D A;  3LKX A;  1E9L A;  3O5K A;  4Z2J A;  1GRJ A;  4MNL A;  1ROU A;  4J4O A;  2DMV A;  2K8I A;  1J4H A;  1BKF A;  3O5I A;  4IT6 A;  1FKK A;  2EZ5 W;  1TK7 A;  2WK2 A;  2RUQ A;  1JVW A;  3CZ8 A;  4ODM A;  3JXV A;  1FKB A;  1E6P A;  3ARS A;  1HJW A;  5DIU A;  2B31 A;  3WD3 A;  3O5G A;  1FFR A;  1FFQ A;  4QT3 A;  3ARO A;  1ZBW A;  3JYJ A;  4IPX A;  4MNK A;  1Q6H A;  3WD0 A;  1L1P A;  2RSE A;  2MPH A;  3ART A;  3OA5 A;  2ZAJ A;  1WAW A;  3GPK A;  1W1Y A;  3KAD A;  5HWC A;  2Y8N B;  3O5L A;  1M5Y A;  3CHC A;  3VAW A;  4P8U A;  4J4N A;  4MTV A;  4Z2I A;  2MLX A;  4DT4 A;  2YSB A;  4Z2G A;  3CHF A;  2ZQT A;  3BXW A;  4GIV A;  4NZC A;  3TC5 A;  2LKN A;  1EDQ A;  3UI6 A;  1NMW A;  1FLC A;  2ESC A;  3O5M A;  2ZR4 A;  3ARX A;  1W26 A;  2PBC A;  4MGV A;  2RUC A;  3FSC A;  3KAG A;  3O5P A;  5D75 A;  4WKF A;  1FKG A;  4S3K A;  2Q5A A;  2UZ5 A;  1T11 A;  2LJ4 A;  2B5U B;  3WD1 A;  1ZBC A;  1JND A;  2DJY A;  3WD2 A;  1ZK6 A;  3O5F A;  4O2T A;  2PPO A;  4QT2 A;  1WB0 A;  4AY1 A;  4Z2H A;  4ZPT R;  4DRH A;  3G6L A;  4ODP A;  3CGN A;  2A3B A;  1ZBK A;  4XAK A;  5E65 A;  3IK8 A;  2DG4 A;  2JV4 A;  2MDI A;  1W1T A;  3O5R A;  2KGJ A;  2VN1 A;  2KXQ A;  4ODO A;  3RM4 A;  5B8I C;  5BXJ A;  1FJD A;  3FS8 A;  3B8S A;  4KQZ A;  4L72 B;  2F4E A;  5HW6 A;  1RP5 A;  3PA7 A;  2DK7 A;  1E15 A;  2A3A A;  3UI4 A;  4MNJ A;  3L4H A;  2XPB A;  3WL0 A;  1YW5 A;  2OFN A;  2YAJ B;  5GPG A;  3AS1 A;  3G6M A;  4A0T A;  1O6I A;  4P8X A;  1NWS A;  4MAV A;  3ARU A;  1K9R A;  3ARQ A;  1QPF A;  1QZ2 A;  4LAX A;  2YBT A;  2ZR6 A;  4N19 A;  1LL4 A;  2PI6 A;  2WLY A;  1X6N A;  3O5O A;  1LQ0 A;  4DWS A;  2XP5 A;  4NSB A;  4ODQ A;  3WQV A;  1I5H W;  5HTG A;  1JNT A;  5E5W A;  3KAC A;  3AQU A;  2WLZ A;  4TYO A;  1SR0 A;  4QIB A;  4WJX A;  4DRN A;  4Q7N A;  2IF4 A;  3B9E A;  3WIJ A;  2OLH A;  3B9A A;  4MPK A;  2DSU A;  1OGG A;  4A0U A;  3O5Q A;  3FSB A;  4DRQ A;  4DWS D;  3KCE A;  1B6C A;  3UQB A;  4C02 B;  4DRK A;  2PV3 A;  2FKE A;  2MLZ A;  2LGO A;  2YSI A;  3UF8 A;  2G8Z A;  3PRD A;  2AOS A;  1FKD A;  4GGQ A;  2XP3 A;  2ZQS A;  1U79 A;  3PRB A;  2DPE A;  1BL4 A;  3FXY A;  3WH0 A;  4JYS A;  1XHG A;  4JFJ A;  1PBK A;  2L2S A;  2WAD A;  1FKL A;  2DG9 A;  1J4R A;  3ALF A;  3WD4 A;  2DT0 A;  4IT4 A;  4REX A;  4LAY A;  2YSG A;  3CHE A;  4ZS6 A;  3UI5 A;  1HKI A;  1LG2 A;  2KO7 A;  4IQC A;  4LAV A;  3WL1 A;  1W1V A;  2PV2 A;  2RE3 A;  4Z2L A;  5HUA A;  1E6Z A;  3NI6 A;  1RD6 A;  2M3O W;  3ARP A;  2DSW A;  4HBE A;  3MCB A;  1PIN A;  1FD9 A;  1Q1C A;  3LUO A;  4ML4 A;  5J6E A;  2FDM A;  3CH9 A;  2JZV A;  4U84 A;  3KZ7 A;  2ZQU A;  1OGB A;  2A3C A;  2M2A A;  3B9D A;  2ZR5 A;  2XP6 A;  2DK1 A;  2QRV A; 
#chains in the Genus database with same CATH homology
 5E66 A;  3LKX B;  1ZU8 A;  3MQH A;  1F8A B;  4W9P A;  2Y78 A;  1NH6 A;  2M8J A;  2OWO A;  1C9H A;  4LGX A;  3RM8 A;  1FKS A;  3AS3 A;  1FAP A;  1WNO A;  4G2P A;  1W9P A;  3CHD A;  3IKG A;  2RQS A;  4URI A;  2O92 A;  1UR9 A;  2M8I A;  3ARY A;  1W9V A;  4PTM A;  2M08 A;  1SYT A;  1EYM A;  1F40 A;  2ITK A;  1EIB A;  1YAT A;  3PR9 A;  2KE0 A;  2YSH A;  3NTP A;  2A3E A;  1W9U A;  1X6L A;  3B7X A;  4TW8 A;  3KAI A;  4ZPV R;  4W9Q A;  1TCO C;  4ITZ A;  3LE4 A;  3H9R B;  2E45 A;  1TFV A;  1FKT A;  3CGM A;  2JX8 A;  4QZV B;  4DRI A;  3O5E A;  1NMV A;  1LJY A;  5HBF A;  5HKG A;  3ARZ A;  1N1A A;  3I6C A;  1J4I A;  1NSG A;  3FY1 A;  3MCB B;  2IUZ A;  4Q22 A;  1KT0 A;  2PPP A;  2MF9 A;  1P5Q A;  3UQA A;  1NWR A;  2LPV A;  3O5J A;  1D7H A;  1VF8 A;  5I98 A;  3UQI A;  1LG1 A;  4HAR A;  2KI3 A;  4MSP A;  4BF8 A;  4JFI A;  4Z2K A;  3RM9 A;  4KR0 B;  4DRJ A;  4IQ2 A;  4ODR A;  1CTN A;  5DF0 A;  4ODN A;  1KT1 A;  3JYM A;  1GUV A;  4DRO A;  4JFM A;  2DT1 A;  1GOI A;  1HJX A;  1E6R A;  4R0X A;  4TW7 A;  3WKZ A;  2YSF A;  1R9H A;  3NRK A;  5HT1 A;  3PRA A;  4G50 A;  1HJV A;  2XPA A;  4E5R A;  3MDY B;  5DO2 A;  1Q6U A;  2BA1 A;  3CNG A;  1LL7 A;  5JH8 A;  4DRM A;  1K9T A;  2VCD A;  4WKH A;  2MNT A;  4TX0 A;  1J6Y A;  2KR7 A;  1EG3 A;  3EY6 A;  2FAP A;  1D6O A;  1D2K A;  2XP9 A;  4JFK A;  2DSZ A;  2WAE A;  1ITX A;  3PQH A;  5AHT A;  1Y0O A;  2N87 A;  2DG3 A;  1IX5 A;  4WKA A;  1E6N A;  2O9O A;  4ODK A;  2RUR A;  1H0G A;  1GPF A;  4L3N A;  2YBU A;  4DWS C;  4TW6 A;  2XP7 A;  1D7I A;  2MLY A;  4DWS B;  1Q6I A;  4NNR A;  1EG4 A;  3AS0 A;  4P8W A;  3KAB A;  2XP8 A;  1NWU A;  4FN2 A;  1ZCN A;  5GPR A;  4DH0 A;  4MNM A;  3ARW A;  3OOB A;  1H0I A;  2DT2 A;  4P8V A;  2F21 A;  5GQB A;  2M1I A;  3RFW A;  1XRV A;  1QPL A;  5HW8 A;  5HWB A;  2WM0 A;  2JXW A;  3M85 A;  3TCZ A;  5DIT A;  3QOK A;  1HKK A;  4ZPW R;  1ROT A;  3FAP A;  4U86 A;  2D9F A;  2RUD A;  4S3J A;  2XP4 A;  4WK9 A;  4R5E A;  1JNE A;  3RME A;  1KFW A;  3M7N A;  4U85 A;  5E62 A;  1HKJ A;  2KFW A;  4GLX A;  1HKM A;  2PV1 A;  3KAH A;  4W9O A;  1JNS A;  1EHN A;  1FKJ A;  4DZ2 A;  1UR8 A;  2PPN A;  3O5D A;  1ZBV A;  3WQW A;  4DIP A;  1JMQ A;  5CQ2 A;  1FKI A;  1W1P A;  5DEZ A;  5DIV A;  1LL6 A;  3W4R A;  3ARR A;  1WMV A;  3KAF A;  1OWQ A;  2JMF A;  3AS2 A;  5E64 A;  3MQG A;  3ODK A;  2QF8 A;  4HBO A;  4FAP A;  2L4J A;  2AWG A;  1TR8 A;  1D7J A;  2ZQV A;  4ODL A;  4DRP A;  1ZL1 A;  3IKD A;  2DWV A;  3TDB A;  1WR7 A;  1FKR A;  2G41 A;  4TNS A;  4W5U A;  4WIW A;  1NWT A;  3IHZ A;  1EQ3 A;  1FKF A;  3ALG A;  2DSV A;  3RGC A;  2LAJ A;  1K9Q A;  4JFL A;  4LAW A;  3ARV A;  4DZ3 A;  1O6W A;  1HXV A;  5U47 A;  1A7X A;  1FKH A;  2DT3 A;  1ZB5 A;  5HW7 A;  2F2D A;  3LKX A;  1E9L A;  3O5K A;  4Z2J A;  4MNL A;  1ROU A;  4J4O A;  2DMV A;  2K8I A;  1J4H A;  1BKF A;  3O5I A;  4IT6 A;  1FKK A;  2EZ5 W;  1TK7 A;  2WK2 A;  2RUQ A;  1JVW A;  3CZ8 A;  4ODM A;  3JXV A;  1FKB A;  1E6P A;  3ARS A;  1HJW A;  5DIU A;  2B31 A;  3WD3 A;  3O5G A;  1FFR A;  1FFQ A;  4QT3 A;  3ARO A;  1ZBW A;  3JYJ A;  4IPX A;  4MNK A;  1Q6H A;  3WD0 A;  1L1P A;  2RSE A;  2MPH A;  3ART A;  3OA5 A;  2ZAJ A;  1WAW A;  3GPK A;  1W1Y A;  3KAD A;  5HWC A;  2Y8N B;  3O5L A;  1M5Y A;  3CHC A;  3VAW A;  4P8U A;  4J4N A;  4MTV A;  4Z2I A;  2MLX A;  4DT4 A;  2YSB A;  4Z2G A;  3CHF A;  2ZQT A;  3BXW A;  4GIV A;  4NZC A;  3TC5 A;  2LKN A;  1EDQ A;  3UI6 A;  1NMW A;  1FLC A;  2ESC A;  3O5M A;  2ZR4 A;  3ARX A;  1W26 A;  2PBC A;  4MGV A;  2RUC A;  3FSC A;  3KAG A;  3O5P A;  5D75 A;  4WKF A;  1FKG A;  4S3K A;  2Q5A A;  2UZ5 A;  1T11 A;  2LJ4 A;  3WD1 A;  1ZBC A;  1JND A;  2DJY A;  3WD2 A;  1ZK6 A;  3O5F A;  4O2T A;  2PPO A;  4QT2 A;  1WB0 A;  4AY1 A;  4Z2H A;  4ZPT R;  4DRH A;  3G6L A;  4ODP A;  3CGN A;  2A3B A;  1ZBK A;  4XAK A;  5E65 A;  3IK8 A;  2DG4 A;  2JV4 A;  2MDI A;  1W1T A;  3O5R A;  2KGJ A;  2VN1 A;  2KXQ A;  4ODO A;  3RM4 A;  5B8I C;  5BXJ A;  1FJD A;  3FS8 A;  3B8S A;  4KQZ A;  4L72 B;  2F4E A;  5HW6 A;  1RP5 A;  3PA7 A;  2DK7 A;  1E15 A;  2A3A A;  3UI4 A;  4MNJ A;  3L4H A;  2XPB A;  3WL0 A;  1YW5 A;  2OFN A;  2YAJ B;  5GPG A;  3AS1 A;  3G6M A;  4A0T A;  1O6I A;  4P8X A;  1NWS A;  4MAV A;  3ARU A;  1K9R A;  3ARQ A;  1QPF A;  1QZ2 A;  4LAX A;  2YBT A;  2ZR6 A;  4N19 A;  1LL4 A;  2PI6 A;  2WLY A;  1X6N A;  3O5O A;  1LQ0 A;  4DWS A;  2XP5 A;  4NSB A;  4ODQ A;  3WQV A;  1I5H W;  5HTG A;  1JNT A;  5E5W A;  3KAC A;  3AQU A;  2WLZ A;  4TYO A;  1SR0 A;  4QIB A;  4WJX A;  4DRN A;  4Q7N A;  2IF4 A;  3B9E A;  3WIJ A;  2OLH A;  3B9A A;  4MPK A;  2DSU A;  1OGG A;  4A0U A;  3O5Q A;  3FSB A;  4DRQ A;  4DWS D;  3KCE A;  1B6C A;  3UQB A;  4C02 B;  4DRK A;  2PV3 A;  2FKE A;  2MLZ A;  2LGO A;  2YSI A;  3UF8 A;  2G8Z A;  3PRD A;  2AOS A;  1FKD A;  4GGQ A;  2XP3 A;  2ZQS A;  1U79 A;  3PRB A;  2DPE A;  1BL4 A;  3FXY A;  3WH0 A;  4JYS A;  1XHG A;  4JFJ A;  1PBK A;  2L2S A;  2WAD A;  1FKL A;  2DG9 A;  1J4R A;  3ALF A;  3WD4 A;  2DT0 A;  4IT4 A;  4REX A;  4LAY A;  2YSG A;  3CHE A;  4ZS6 A;  3UI5 A;  1HKI A;  1LG2 A;  2KO7 A;  4IQC A;  4LAV A;  3WL1 A;  1W1V A;  2PV2 A;  2RE3 A;  4Z2L A;  5HUA A;  1E6Z A;  3NI6 A;  1RD6 A;  2M3O W;  3ARP A;  2DSW A;  4HBE A;  3MCB A;  1PIN A;  1FD9 A;  1Q1C A;  3LUO A;  4ML4 A;  5J6E A;  2FDM A;  3CH9 A;  2JZV A;  4U84 A;  3KZ7 A;  2ZQU A;  1OGB A;  2A3C A;  2M2A A;  3B9D A;  2ZR5 A;  2XP6 A;  2DK1 A;  2QRV A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...