1YW5A

Peptidyl-prolyl isomerase ess1 from candida albicans
Total Genus 55
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
55
sequence length
177
structure length
177
Chain Sequence
MASTSTGLPPNWTIRVSRSHNKEYFLNQSTNESSWDPPYGTDKEVLNAYIAKFKNNGYKPLVNEDGQVRVSHLLIKNNQSRKPKSWKSPDGISRTRDESIQILKKHLERILSGEVKLSELANTESDCSSHDRGGDLGFFSKGQMQPPFEEAAFNLHVGEVSNIIETNSGVHILQRTG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Isomerase
molecule keywords peptidyl prolyl cis/trans isomerase
publication title The Structure of the Candida albicans Ess1 Prolyl Isomerase Reveals a Well-Ordered Linker that Restricts Domain Mobility
pubmed doi rcsb
source organism Candida albicans
total genus 55
structure length 177
sequence length 177
ec nomenclature ec 5.2.1.8: Peptidylprolyl isomerase.
pdb deposition date 2005-02-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00397 WW WW domain
A PF00639 Rotamase PPIC-type PPIASE domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.20.70.10 Mainly Beta Single Sheet Ubiquitin Ligase Nedd4; Chain: W; Ubiquitin Ligase Nedd4; Chain: W; 1yw5A01
3.10.50.40 Alpha Beta Roll Chitinase A; domain 3 Chitinase A; domain 3 1yw5A02
1Q6UA 2L2SA 3TCZA 4G50A 1J6YA 3PRBA 4ODKA 1FKKA 3CGNA 1A7XA 4GIVA 3TDBA 2ZQVA 3KAHA 4REXA 4TYOA 2Q5AA 5DIUA 2FAPA 3TC5A 2DG4A 2YSIA 1JVWA 3M85A 2LPVA 2LGOA 4DRNA 2XP9A 4FAPA 3LE4A 1JMQA 4DRMA 4DRHA 2VCDA 1Q1CA 2RUQA 3JXVA 2MLXA 2EZ5W 4U86A 1FKDA 3UF8A 4LAVA 2RURA 4W9QA 1ROUA 4J4NA 4JYSA 2DG3A 1M5YA 2RE3A 1F40A 1PINA 1FKFA 1FKTA 2DJYA 3O5QA 3IHZA 4MSPA 4DZ3A 3WH0A 2PBCA 3L4HA 2F2DA 3CNGA 3KAGA 3O5IA 4ODQA 5HW7A 1HXVA 3B7XA 5BXJA 4N19A 4TX0A 2F4EA 4DH0A 2VN1A 1FKBA 4TW7A 4JFIA 2M2AA 1ZCNA 1TCOC 2ZQUA 4U84A 3IKGA 2YSFA 2RQSA 2MDIA 4DRPA 1FD9A 5DITA 2Y78A 5HW6A 4QT2A 1QPLA 2PV1A 1J4HA 3O5LA 1J4IA 1D7IA 4ODPA 5J6EA 3IK8A 5AHTA 3FAPA 1P5QA 3O5RA 3EY6A 3PRDA 4G2PA 4LAXA 3RFWA 5HWBA 1J4RA 2IF4A 1D6OA 4IQ2A 1N1AA 3O5GA 2KO7A 1FJDA 2DK7A 2BA1A 2MNTA 3H9RB 1EQ3A 2DWVA 2PV3A 1KT0A 1JNSA 3O5FA 1W26A 3PA7A 1F8AB 2DMVA 1NSGA 4ODMA 3UI6A 4W9PA 3KADA 2JMFA 2D9FA 2E45A 2M08A 2M8JA 4DRJA 2JZVA 3M7NA 4IPXA 1C9HA 3KAIA 2KGJA 2LKNA 5HKGA 1JNTA 2OFNA 2XP3A 1ROTA 4NNRA 3RGCA 4JFLA 4TNSA 2XP6A 1FKLA 2DK1A 1D7JA 5D75A 3MDYB 1Y0OA 2MLZA 5HW8A 2KR7A 5HTGA 1D7HA 1O6WA 4DRIA 1QZ2A 2XP7A 3KCEA 1NMVA 5I98A 4O2TA 2K8IA 5DIVA 3NTPA 5HWCA 5HUAA 3O5KA 4JFMA 2KI3A 3IKDA 2YSHA 2YSBA 4J4OA 5CQ2A 1T11A 4ODLA 4FN2A 4DZ2A 4ITZA 1FKIA 3KAFA 4C02B 3UI4A 1QPFA 1FKHA 1U79A 4QIBA 2XP4A 1BL4A 2N87A 2MF9A 3UQIA 2ZR4A 1EG3A 1ZK6A 1R9HA 3UQAA 3O5OA 2DG9A 1B6CA 4DRQA 2M3OW 2JXWA 1EYMA 2XP5A 2ZR6A 3NRKA 4BF8A 2PV2A 2M8IA 1FKGA 2ZQTA 4E5RA 2LJ4A 3CGMA 4LAWA 2RSEA 1PBKA 4ODNA 2LAJA 1NMWA 3O5JA 3VAWA 4R0XA 3O5DA 3OOBA 2YSGA 1FKJA 2KE0A 2JV4A 4QT3A 2ITKA 2MPHA 1I5HW 4DIPA 1TK7A 3I6CA 2FKEA 2PPPA 5HT1A 4DROA 1FKRA 2KFWA 2AWGA 5B8IC 4IQCA 2XPAA 4U85A 1YATA 1WR7A 3O5EA 4TW6A 4LAYA 3NI6A 1K9RA 4TW8A 3UQBA 1EG4A 2PPOA 1L1PA 2XPBA 4ODOA 2XP8A 2ZAJA 2L4JA 3LUOA 2F21A 3KACA 1FAPA 4W9OA 3KABA 3KZ7A 4JFJA 2RUDA 2ZQSA 3O5MA 4GGQA 3GPKA 2UZ5A 3JYMA 1FKSA 4DRKA 1K9QA 2M1IA 2RUCA 2ZR5A 1KT1A 3UI5A 4DT4A 2KXQA 3O5PA 1YW5A 1Q6IA 5GPGA 4JFKA 1Q6HA 2JX8A 4ODRA 2MLYA 3JYJA 3ODKA 2PPNA 1WMVA 1BKFA 4MGVA
chains in the Genus database with same CATH superfamily
1Q6UA 4ML4A 2L2SA 4Z2HA 1HJWA 3TCZA 4G50A 1J6YA 3PRBA 4ODKA 1FKKA 3CGNA 4ZS6A 2P4VA 3FSCA 3AS1A 1W1VA 1A7XA 1VF8A 4URIA 4GIVA 3TDBA 2ZQVA 3G6MA 3KAHA 4REXA 4TYOA 2Q5AA 5DIUA 5E5WA 5E65A 2FAPA 3TC5A 2DG4A 3ARUA 2YSIA 1JVWA 2ESCA 1X6LA 3M85A 2LPVA 2B5UB 2LGOA 1E6ZA 1LL7A 4DRNA 3WD4A 2XP9A 4FAPA 4Z2KA 4Z2LA 3LE4A 1JMQA 4DRMA 1IX5A 4DRHA 1HJVA 2VCDA 1Q1CA 2RUQA 1E15A 1GOIA 4DWSD 3JXVA 2MLXA 3FXYA 2EZ5W 4U86A 3CH9A 1FKDA 4WJXA 3UF8A 4KR0B 2RURA 4LAVA 1ROUA 2DSWA 4W9QA 4J4NA 4JYSA 3WD0A 2DG3A 1M5YA 2RE3A 5GQBA 1F40A 3RM8A 2DT3A 1PINA 1FKFA 1FKTA 2DJYA 3O5QA 3IHZA 4MSPA 4DZ3A 3WH0A 2PBCA 1ZBWA 3L4HA 1TFVA 2F2DA 3CNGA 3KAGA 5E62A 1NWUA 3O5IA 4ODQA 3RMEA 5HW7A 4DWSB 2OWOA 1OGGA 4L72B 1HXVA 3B7XA 5BXJA 1LG1A 4N19A 4TX0A 2F4EA 4DH0A 2DSUA 2VN1A 4PTMA 1FKBA 4TW7A 4JFIA 4A0TA 2M2AA 2QRVA 1E9LA 1W9UA 2DT2A 1ZCNA 1TCOC 5DO2A 2ZQUA 4U84A 3IKGA 1KFWA 2YSFA 1RD6A 2RQSA 2MDIA 4AY1A 4KQZA 1K9TA 4DRPA 1FD9A 3MCBB 2Y8NB 5DITA 2Y78A 5GPRA 5HW6A 3B9EA 1X6NA 1ZB5A 1EHNA 4QT2A 4DWSC 2FDMA 1QPLA 2EULA 2PV1A 1FFQA 1J4HA 2O92A 3O5LA 4Z2JA 2WLYA 2A3EA 1J4IA 2DSVA 1D7IA 3OA5A 4ODPA 5J6EA 1LJYA 3IK8A 5AHTA 2O9OA 3FAPA 3PQHA 1P5QA 3O5RA 1H0GA 3EY6A 3PRDA 4G2PA 4LAXA 3RFWA 5HWBA 1HKJA 1J4RA 2IF4A 1D6OA 3G6LA 4IQ2A 1N1AA 3EIPA 3O5GA 2KO7A 1FJDA 2DK7A 2BA1A 2MNTA 3H9RB 1EQ3A 2DWVA 1W1YA 2PV3A 1KT0A 1JNSA 3B9AA 4HBOA 3O5FA 1OWQA 2A3BA 3W4RA 1W26A 3PA7A 2YAJB 1F8AB 2DMVA 5HBFA 1NSGA 3ARRA 4ODMA 3UI6A 3FS8A 3LKXB 3ARSA 4W9PA 3ALFA 1EDQA 3WQVA 2G41A 3PRAA 3KADA 1LQ0A 2JMFA 2D9FA 2E45A 4Q22A 2M08A 1UR9A 2M8JA 4DRJA 1HKMA 2WLZA 2JZVA 3M7NA 4S3JA 3QOKA 4IPXA 1C9HA 3KAIA 3WQWA 4Z2GA 2KGJA 2LKNA 5HKGA 1JNTA 2OFNA 2XP3A 1ROTA 4NNRA 2B31A 5DEZA 3RGCA 4JFLA 4TNSA 2XP6A 1FKLA 2DT1A 2DK1A 2DT0A 1D7JA 3ARWA 5D75A 1WNOA 1E6NA 3MDYB 1Y0OA 2MLZA 1W1PA 5HW8A 2KR7A 5HTGA 1ZBVA 4HBEA 4UDMA 1D7HA 1W1TA 1O6WA 3ARYA 2ETNA 4DRIA 1QZ2A 2XP7A 4IT4A 3KCEA 1NMVA 5I98A 4O2TA 3ALGA 4MAVA 1HKIA 2K8IA 4QZVB 4R5EA 1D2KA 1ITXA 5DIVA 3NTPA 5HWCA 1NWSA 5HUAA 3O5KA 1OGBA 4JFMA 2KI3A 3ARZA 3FY1A 3IKDA 4S3KA 1NWTA 4MPKA 2YSHA 2YSBA 4MTVA 4Q7NA 4J4OA 4WKHA 5CQ2A 1NH6A 1T11A 4P8UA 1UR8A 2IUZA 4ODLA 2YBUA 4FN2A 4DZ2A 4ITZA 5U47A 1JNEA 1FKIA 3KAFA 1O6IA 3UI4A 1WB0A 4C02B 1QPFA 3MQGA 1FKHA 3WD2A 1U79A 4QIBA 3CHFA 3ARXA 2XP4A 4XAKA 1FLCA 1BL4A 3BMBA 4LGXA 2N87A 2MF9A 3UQIA 2ZR4A 3AS3A 2PN0A 3FSBA 1EG3A 1ZK6A 1R9HA 3MQHA 3WL1A 3ARPA 4DWSA 2AOSA 2DSZA 3WL0A 4ZPTR 3UQAA 1E6RA 3O5OA 2DG9A 1B6CA 4DRQA 2M3OW 2JXWA 1EYMA 2XP5A 2A3AA 2ZR6A 3NRKA 4L3NA 4P8VA 1XHGA 5E64A 4BF8A 2PV2A 2QF8A 2M8IA 4WKAA 4HARA 1JCHB 1FKGA 3GU0A 2ZQTA 3AROA 4E5RA 2LJ4A 3CGMA 4LAWA 2RSEA 4WKFA 1PBKA 4ODNA 2LAJA 3WKZA 4ZPWR 1NMWA 3O5JA 2YBTA 2PI6A 3VAWA 4R0XA 4NSBA 4P8WA 3MCBA 3O5DA 3OOBA 3RM9A 1RP5A 2YSGA 1FKJA 2KE0A 3AQUA 2JV4A 1SYTA 1NWRA 4QT3A 3CZ8A 2ITKA 2MPHA 1I5HW 1XRVA 4DIPA 2OLHA 1TK7A 1GPFA 3I6CA 2FKEA 2PPPA 1ZL1A 4A0UA 2WK2A 2G8ZA 3GTYX 4MNLA 3CHCA 4NZCA 5HT1A 5JH8A 1LG2A 4DROA 1FKRA 2KFWA 1TR8A 2AWGA 5B8IC 4IQCA 2XPAA 1ZU8A 2DPEA 2WAEA 4MNKA 3CHEA 4U85A 1YATA 1WR7A 1EIBA 3O5EA 2A3CA 3ARQA 4TW6A 4LAYA 3NI6A 1K9RA 3B9DA 4TW8A 3UQBA 1H0IA 1EG4A 1HJXA 2PPOA 2WADA 1JNDA 1SR0A 1L1PA 2XPBA 4ODOA 2XP8A 2ZAJA 1ZBKA 3LKXA 1FFRA 4Z2IA 2L4JA 1LL6A 3B8SA 3LUOA 2F21A 3KACA 4MNJA 1FAPA 1W9PA 3RM4A 4P8XA 4MNMA 3KABA 4W9OA 4GLXA 3WD3A 3KZ7A 4JFJA 2RUDA 2ZQSA 3O5MA 3AS2A 4GGQA 5E66A 3GPKA 4WK9A 2UZ5A 3ARVA 3JYMA 5DF0A 1FKSA 1HKKA 4DRKA 1ZBCA 1K9QA 2M1IA 2RUCA 2ZR5A 1KT1A 3UI5A 1LL4A 3CHDA 2WM0A 1CTNA 4DT4A 1GUVA 2KXQA 3O5PA 1YW5A 3BXWA 1WAWA 3PR9A 1W9VA 1E44A 3AS0A 4IT6A 1Q6IA 5GPGA 4JFKA 1Q6HA 3WIJA 2JX8A 3ARTA 4ODRA 2MLYA 3JYJA 4WIWA 3WD1A 1E6PA 2F23A 4ZPVR 4W5UA 3ODKA 1GRJA 2PPNA 1WMVA 1BKFA 4MGVA
chains in the Genus database with same CATH topology
1Q6UA 4ML4A 2L2SA 4Z2HA 1HJWA 3TCZA 4G50A 1J6YA 3PRBA 4ODKA 1FKKA 3CGNA 4ZS6A 3FSCA 3AS1A 1W1VA 1A7XA 1VF8A 4URIA 4GIVA 3TDBA 2ZQVA 3G6MA 3KAHA 4REXA 4TYOA 2Q5AA 5DIUA 5E5WA 5E65A 2FAPA 3TC5A 2DG4A 3ARUA 2YSIA 1JVWA 2ESCA 1X6LA 3M85A 2LPVA 2LGOA 1E6ZA 1LL7A 4DRNA 3WD4A 2XP9A 4FAPA 4Z2KA 4Z2LA 3LE4A 1JMQA 4DRMA 1IX5A 4DRHA 1HJVA 2VCDA 1Q1CA 2RUQA 1E15A 1GOIA 4DWSD 3JXVA 2MLXA 3FXYA 2EZ5W 4U86A 3CH9A 1FKDA 4WJXA 3UF8A 4KR0B 2RURA 4LAVA 1ROUA 2DSWA 4W9QA 4J4NA 4JYSA 3WD0A 2DG3A 1M5YA 2RE3A 5GQBA 1F40A 3RM8A 2DT3A 1PINA 1FKFA 1FKTA 2DJYA 3O5QA 3IHZA 4MSPA 4DZ3A 3WH0A 2PBCA 1ZBWA 3L4HA 1TFVA 2F2DA 3CNGA 3KAGA 5E62A 1NWUA 3O5IA 4ODQA 3RMEA 5HW7A 4DWSB 2OWOA 1OGGA 4L72B 1HXVA 3B7XA 5BXJA 1LG1A 4N19A 4TX0A 2F4EA 4DH0A 2DSUA 2VN1A 4PTMA 1FKBA 4TW7A 4JFIA 4A0TA 2M2AA 2QRVA 1E9LA 1W9UA 2DT2A 1ZCNA 1TCOC 5DO2A 2ZQUA 4U84A 3IKGA 1KFWA 2YSFA 1RD6A 2RQSA 2MDIA 4AY1A 4KQZA 1K9TA 4DRPA 1FD9A 3MCBB 2Y8NB 5DITA 2Y78A 5GPRA 5HW6A 3B9EA 1X6NA 1ZB5A 1EHNA 4QT2A 4DWSC 2FDMA 1QPLA 2PV1A 1FFQA 1J4HA 2O92A 3O5LA 4Z2JA 2WLYA 2A3EA 1J4IA 2DSVA 1D7IA 3OA5A 4ODPA 5J6EA 1LJYA 3IK8A 5AHTA 2O9OA 3FAPA 3PQHA 1P5QA 3O5RA 1H0GA 3EY6A 3PRDA 4G2PA 4LAXA 3RFWA 5HWBA 1HKJA 1J4RA 2IF4A 1D6OA 3G6LA 4IQ2A 1N1AA 3O5GA 2KO7A 1FJDA 2DK7A 2BA1A 2MNTA 3H9RB 1EQ3A 2DWVA 1W1YA 2PV3A 1KT0A 1JNSA 3B9AA 4HBOA 3O5FA 1OWQA 2A3BA 3W4RA 1W26A 3PA7A 2YAJB 1F8AB 2DMVA 5HBFA 1NSGA 3ARRA 4ODMA 3UI6A 3FS8A 3LKXB 3ARSA 4W9PA 3ALFA 1EDQA 3WQVA 2G41A 3PRAA 3KADA 1LQ0A 2JMFA 2D9FA 2E45A 4Q22A 2M08A 1UR9A 2M8JA 4DRJA 1HKMA 2WLZA 2JZVA 3M7NA 4S3JA 3QOKA 4IPXA 1C9HA 3KAIA 3WQWA 4Z2GA 2KGJA 2LKNA 5HKGA 1JNTA 2OFNA 2XP3A 1ROTA 4NNRA 2B31A 5DEZA 3RGCA 4JFLA 4TNSA 2XP6A 1FKLA 2DT1A 2DK1A 2DT0A 1D7JA 3ARWA 5D75A 1WNOA 1E6NA 3MDYB 1Y0OA 2MLZA 1W1PA 5HW8A 2KR7A 5HTGA 1ZBVA 4HBEA 1D7HA 1W1TA 1O6WA 3ARYA 4DRIA 1QZ2A 2XP7A 4IT4A 3KCEA 1NMVA 5I98A 4O2TA 3ALGA 4MAVA 1HKIA 2K8IA 4QZVB 4R5EA 1D2KA 1ITXA 5DIVA 3NTPA 5HWCA 1NWSA 5HUAA 3O5KA 1OGBA 4JFMA 2KI3A 3ARZA 3FY1A 3IKDA 4S3KA 1NWTA 4MPKA 2YSHA 2YSBA 4MTVA 4Q7NA 4J4OA 4WKHA 5CQ2A 1NH6A 1T11A 4P8UA 1UR8A 2IUZA 4ODLA 2YBUA 4FN2A 4DZ2A 4ITZA 5U47A 1JNEA 1FKIA 3KAFA 1O6IA 3UI4A 1WB0A 4C02B 1QPFA 3MQGA 1FKHA 3WD2A 1U79A 4QIBA 3CHFA 3ARXA 2XP4A 4XAKA 1FLCA 1BL4A 4LGXA 2N87A 2MF9A 3UQIA 2ZR4A 3AS3A 3FSBA 1EG3A 1ZK6A 1R9HA 3MQHA 3WL1A 3ARPA 4DWSA 2AOSA 2DSZA 3WL0A 4ZPTR 3UQAA 1E6RA 3O5OA 2DG9A 1B6CA 4DRQA 2M3OW 2JXWA 1EYMA 2XP5A 2A3AA 2ZR6A 3NRKA 4L3NA 4P8VA 1XHGA 5E64A 4BF8A 2PV2A 2QF8A 2M8IA 4WKAA 4HARA 1FKGA 2ZQTA 3AROA 4E5RA 2LJ4A 3CGMA 4LAWA 2RSEA 4WKFA 1PBKA 4ODNA 2LAJA 3WKZA 4ZPWR 1NMWA 3O5JA 2YBTA 2PI6A 3VAWA 4R0XA 4NSBA 4P8WA 3MCBA 3O5DA 3OOBA 3RM9A 1RP5A 2YSGA 1FKJA 2KE0A 3AQUA 2JV4A 1SYTA 1NWRA 4QT3A 3CZ8A 2ITKA 2MPHA 1I5HW 1XRVA 4DIPA 2OLHA 1TK7A 1GPFA 3I6CA 2FKEA 2PPPA 1ZL1A 4A0UA 2WK2A 2G8ZA 4MNLA 5HT1A 3CHCA 4NZCA 5JH8A 1LG2A 4DROA 1FKRA 2KFWA 1TR8A 2AWGA 5B8IC 4IQCA 2XPAA 1ZU8A 2DPEA 2WAEA 4MNKA 3CHEA 4U85A 1YATA 1WR7A 1EIBA 3O5EA 2A3CA 3ARQA 4TW6A 4LAYA 3NI6A 1K9RA 3B9DA 4TW8A 3UQBA 1H0IA 1EG4A 1HJXA 2PPOA 2WADA 1JNDA 1SR0A 1L1PA 2XPBA 4ODOA 2XP8A 2ZAJA 1ZBKA 3LKXA 1FFRA 4Z2IA 2L4JA 1LL6A 3B8SA 3LUOA 2F21A 3KACA 4MNJA 1FAPA 1W9PA 3RM4A 4P8XA 4MNMA 3KABA 4W9OA 4GLXA 3WD3A 3KZ7A 4JFJA 2RUDA 2ZQSA 3O5MA 3AS2A 4GGQA 5E66A 3GPKA 4WK9A 2UZ5A 3ARVA 3JYMA 5DF0A 1FKSA 1HKKA 4DRKA 1ZBCA 1K9QA 2M1IA 2RUCA 2ZR5A 1KT1A 3UI5A 1LL4A 3CHDA 2WM0A 1CTNA 4DT4A 1GUVA 2KXQA 3O5PA 1YW5A 3BXWA 1WAWA 3PR9A 1W9VA 3AS0A 4IT6A 1Q6IA 5GPGA 4JFKA 1Q6HA 3WIJA 2JX8A 3ARTA 4ODRA 2MLYA 3JYJA 4WIWA 3WD1A 1E6PA 4ZPVR 4W5UA 3ODKA 2PPNA 1WMVA 1BKFA 4MGVA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1Q6U A;  2L2S A;  3TCZ A;  4G50 A;  1J6Y A;  3PRB A;  4ODK A;  1FKK A;  3CGN A;  1A7X A;  4GIV A;  3TDB A;  2ZQV A;  3KAH A;  4REX A;  4TYO A;  2Q5A A;  5DIU A;  2FAP A;  3TC5 A;  2DG4 A;  2YSI A;  1JVW A;  3M85 A;  2LPV A;  2LGO A;  4DRN A;  2XP9 A;  4FAP A;  3LE4 A;  1JMQ A;  4DRM A;  4DRH A;  2VCD A;  1Q1C A;  2RUQ A;  3JXV A;  2MLX A;  2EZ5 W;  4U86 A;  1FKD A;  3UF8 A;  4LAV A;  2RUR A;  4W9Q A;  1ROU A;  4J4N A;  4JYS A;  2DG3 A;  1M5Y A;  2RE3 A;  1F40 A;  1PIN A;  1FKF A;  1FKT A;  2DJY A;  3O5Q A;  3IHZ A;  4MSP A;  4DZ3 A;  3WH0 A;  2PBC A;  3L4H A;  2F2D A;  3CNG A;  3KAG A;  3O5I A;  4ODQ A;  5HW7 A;  1HXV A;  3B7X A;  5BXJ A;  4N19 A;  4TX0 A;  2F4E A;  4DH0 A;  2VN1 A;  1FKB A;  4TW7 A;  4JFI A;  2M2A A;  1ZCN A;  1TCO C;  2ZQU A;  4U84 A;  3IKG A;  2YSF A;  2RQS A;  2MDI A;  4DRP A;  1FD9 A;  5DIT A;  2Y78 A;  5HW6 A;  4QT2 A;  1QPL A;  2PV1 A;  1J4H A;  3O5L A;  1J4I A;  1D7I A;  4ODP A;  5J6E A;  3IK8 A;  5AHT A;  3FAP A;  1P5Q A;  3O5R A;  3EY6 A;  3PRD A;  4G2P A;  4LAX A;  3RFW A;  5HWB A;  1J4R A;  2IF4 A;  1D6O A;  4IQ2 A;  1N1A A;  3O5G A;  2KO7 A;  1FJD A;  2DK7 A;  2BA1 A;  2MNT A;  3H9R B;  1EQ3 A;  2DWV A;  2PV3 A;  1KT0 A;  1JNS A;  3O5F A;  1W26 A;  3PA7 A;  1F8A B;  2DMV A;  1NSG A;  4ODM A;  3UI6 A;  4W9P A;  3KAD A;  2JMF A;  2D9F A;  2E45 A;  2M08 A;  2M8J A;  4DRJ A;  2JZV A;  3M7N A;  4IPX A;  1C9H A;  3KAI A;  2KGJ A;  2LKN A;  5HKG A;  1JNT A;  2OFN A;  2XP3 A;  1ROT A;  4NNR A;  3RGC A;  4JFL A;  4TNS A;  2XP6 A;  1FKL A;  2DK1 A;  1D7J A;  5D75 A;  3MDY B;  1Y0O A;  2MLZ A;  5HW8 A;  2KR7 A;  5HTG A;  1D7H A;  1O6W A;  4DRI A;  1QZ2 A;  2XP7 A;  3KCE A;  1NMV A;  5I98 A;  4O2T A;  2K8I A;  5DIV A;  3NTP A;  5HWC A;  5HUA A;  3O5K A;  4JFM A;  2KI3 A;  3IKD A;  2YSH A;  2YSB A;  4J4O A;  5CQ2 A;  1T11 A;  4ODL A;  4FN2 A;  4DZ2 A;  4ITZ A;  1FKI A;  3KAF A;  4C02 B;  3UI4 A;  1QPF A;  1FKH A;  1U79 A;  4QIB A;  2XP4 A;  1BL4 A;  2N87 A;  2MF9 A;  3UQI A;  2ZR4 A;  1EG3 A;  1ZK6 A;  1R9H A;  3UQA A;  3O5O A;  2DG9 A;  1B6C A;  4DRQ A;  2M3O W;  2JXW A;  1EYM A;  2XP5 A;  2ZR6 A;  3NRK A;  4BF8 A;  2PV2 A;  2M8I A;  1FKG A;  2ZQT A;  4E5R A;  2LJ4 A;  3CGM A;  4LAW A;  2RSE A;  1PBK A;  4ODN A;  2LAJ A;  1NMW A;  3O5J A;  3VAW A;  4R0X A;  3O5D A;  3OOB A;  2YSG A;  1FKJ A;  2KE0 A;  2JV4 A;  4QT3 A;  2ITK A;  2MPH A;  1I5H W;  4DIP A;  1TK7 A;  3I6C A;  2FKE A;  2PPP A;  5HT1 A;  4DRO A;  1FKR A;  2KFW A;  2AWG A;  5B8I C;  4IQC A;  2XPA A;  4U85 A;  1YAT A;  1WR7 A;  3O5E A;  4TW6 A;  4LAY A;  3NI6 A;  1K9R A;  4TW8 A;  3UQB A;  1EG4 A;  2PPO A;  1L1P A;  2XPB A;  4ODO A;  2XP8 A;  2ZAJ A;  2L4J A;  3LUO A;  2F21 A;  3KAC A;  1FAP A;  4W9O A;  3KAB A;  3KZ7 A;  4JFJ A;  2RUD A;  2ZQS A;  3O5M A;  4GGQ A;  3GPK A;  2UZ5 A;  3JYM A;  1FKS A;  4DRK A;  1K9Q A;  2M1I A;  2RUC A;  2ZR5 A;  1KT1 A;  3UI5 A;  4DT4 A;  2KXQ A;  3O5P A;  1YW5 A;  1Q6I A;  5GPG A;  4JFK A;  1Q6H A;  2JX8 A;  4ODR A;  2MLY A;  3JYJ A;  3ODK A;  2PPN A;  1WMV A;  1BKF A;  4MGV A; 
#chains in the Genus database with same CATH topology
 1Q6U A;  4ML4 A;  2L2S A;  4Z2H A;  1HJW A;  3TCZ A;  4G50 A;  1J6Y A;  3PRB A;  4ODK A;  1FKK A;  3CGN A;  4ZS6 A;  2P4V A;  3FSC A;  3AS1 A;  1W1V A;  1A7X A;  1VF8 A;  4URI A;  4GIV A;  3TDB A;  2ZQV A;  3G6M A;  3KAH A;  4REX A;  4TYO A;  2Q5A A;  5DIU A;  5E5W A;  5E65 A;  2FAP A;  3TC5 A;  2DG4 A;  3ARU A;  2YSI A;  1JVW A;  2ESC A;  1X6L A;  3M85 A;  2LPV A;  2B5U B;  2LGO A;  1E6Z A;  1LL7 A;  4DRN A;  3WD4 A;  2XP9 A;  4FAP A;  4Z2K A;  4Z2L A;  3LE4 A;  1JMQ A;  4DRM A;  1IX5 A;  4DRH A;  1HJV A;  2VCD A;  1Q1C A;  2RUQ A;  1E15 A;  1GOI A;  4DWS D;  3JXV A;  2MLX A;  3FXY A;  2EZ5 W;  4U86 A;  3CH9 A;  1FKD A;  4WJX A;  3UF8 A;  4KR0 B;  2RUR A;  4LAV A;  1ROU A;  2DSW A;  4W9Q A;  4J4N A;  4JYS A;  3WD0 A;  2DG3 A;  1M5Y A;  2RE3 A;  5GQB A;  1F40 A;  3RM8 A;  2DT3 A;  1PIN A;  1FKF A;  1FKT A;  2DJY A;  3O5Q A;  3IHZ A;  4MSP A;  4DZ3 A;  3WH0 A;  2PBC A;  1ZBW A;  3L4H A;  1TFV A;  2F2D A;  3CNG A;  3KAG A;  5E62 A;  1NWU A;  3O5I A;  4ODQ A;  3RME A;  5HW7 A;  4DWS B;  2OWO A;  1OGG A;  4L72 B;  1HXV A;  3B7X A;  5BXJ A;  1LG1 A;  4N19 A;  4TX0 A;  2F4E A;  4DH0 A;  2DSU A;  2VN1 A;  4PTM A;  1FKB A;  4TW7 A;  4JFI A;  4A0T A;  2M2A A;  2QRV A;  1E9L A;  1W9U A;  2DT2 A;  1ZCN A;  1TCO C;  5DO2 A;  2ZQU A;  4U84 A;  3IKG A;  1KFW A;  2YSF A;  1RD6 A;  2RQS A;  2MDI A;  4AY1 A;  4KQZ A;  1K9T A;  4DRP A;  1FD9 A;  3MCB B;  2Y8N B;  5DIT A;  2Y78 A;  5GPR A;  5HW6 A;  3B9E A;  1X6N A;  1ZB5 A;  1EHN A;  4QT2 A;  4DWS C;  2FDM A;  1QPL A;  2EUL A;  2PV1 A;  1FFQ A;  1J4H A;  2O92 A;  3O5L A;  4Z2J A;  2WLY A;  2A3E A;  1J4I A;  2DSV A;  1D7I A;  3OA5 A;  4ODP A;  5J6E A;  1LJY A;  3IK8 A;  5AHT A;  2O9O A;  3FAP A;  3PQH A;  1P5Q A;  3O5R A;  1H0G A;  3EY6 A;  3PRD A;  4G2P A;  4LAX A;  3RFW A;  5HWB A;  1HKJ A;  1J4R A;  2IF4 A;  1D6O A;  3G6L A;  4IQ2 A;  1N1A A;  3EIP A;  3O5G A;  2KO7 A;  1FJD A;  2DK7 A;  2BA1 A;  2MNT A;  3H9R B;  1EQ3 A;  2DWV A;  1W1Y A;  2PV3 A;  1KT0 A;  1JNS A;  3B9A A;  4HBO A;  3O5F A;  1OWQ A;  2A3B A;  3W4R A;  1W26 A;  3PA7 A;  2YAJ B;  1F8A B;  2DMV A;  5HBF A;  1NSG A;  3ARR A;  4ODM A;  3UI6 A;  3FS8 A;  3LKX B;  3ARS A;  4W9P A;  3ALF A;  1EDQ A;  3WQV A;  2G41 A;  3PRA A;  3KAD A;  1LQ0 A;  2JMF A;  2D9F A;  2E45 A;  4Q22 A;  2M08 A;  1UR9 A;  2M8J A;  4DRJ A;  1HKM A;  2WLZ A;  2JZV A;  3M7N A;  4S3J A;  3QOK A;  4IPX A;  1C9H A;  3KAI A;  3WQW A;  4Z2G A;  2KGJ A;  2LKN A;  5HKG A;  1JNT A;  2OFN A;  2XP3 A;  1ROT A;  4NNR A;  2B31 A;  5DEZ A;  3RGC A;  4JFL A;  4TNS A;  2XP6 A;  1FKL A;  2DT1 A;  2DK1 A;  2DT0 A;  1D7J A;  3ARW A;  5D75 A;  1WNO A;  1E6N A;  3MDY B;  1Y0O A;  2MLZ A;  1W1P A;  5HW8 A;  2KR7 A;  5HTG A;  1ZBV A;  4HBE A;  4UDM A;  1D7H A;  1W1T A;  1O6W A;  3ARY A;  2ETN A;  4DRI A;  1QZ2 A;  2XP7 A;  4IT4 A;  3KCE A;  1NMV A;  5I98 A;  4O2T A;  3ALG A;  4MAV A;  1HKI A;  2K8I A;  4QZV B;  4R5E A;  1D2K A;  1ITX A;  5DIV A;  3NTP A;  5HWC A;  1NWS A;  5HUA A;  3O5K A;  1OGB A;  4JFM A;  2KI3 A;  3ARZ A;  3FY1 A;  3IKD A;  4S3K A;  1NWT A;  4MPK A;  2YSH A;  2YSB A;  4MTV A;  4Q7N A;  4J4O A;  4WKH A;  5CQ2 A;  1NH6 A;  1T11 A;  4P8U A;  1UR8 A;  2IUZ A;  4ODL A;  2YBU A;  4FN2 A;  4DZ2 A;  4ITZ A;  5U47 A;  1JNE A;  1FKI A;  3KAF A;  1O6I A;  3UI4 A;  1WB0 A;  4C02 B;  1QPF A;  3MQG A;  1FKH A;  3WD2 A;  1U79 A;  4QIB A;  3CHF A;  3ARX A;  2XP4 A;  4XAK A;  1FLC A;  1BL4 A;  3BMB A;  4LGX A;  2N87 A;  2MF9 A;  3UQI A;  2ZR4 A;  3AS3 A;  2PN0 A;  3FSB A;  1EG3 A;  1ZK6 A;  1R9H A;  3MQH A;  3WL1 A;  3ARP A;  4DWS A;  2AOS A;  2DSZ A;  3WL0 A;  4ZPT R;  3UQA A;  1E6R A;  3O5O A;  2DG9 A;  1B6C A;  4DRQ A;  2M3O W;  2JXW A;  1EYM A;  2XP5 A;  2A3A A;  2ZR6 A;  3NRK A;  4L3N A;  4P8V A;  1XHG A;  5E64 A;  4BF8 A;  2PV2 A;  2QF8 A;  2M8I A;  4WKA A;  4HAR A;  1JCH B;  1FKG A;  3GU0 A;  2ZQT A;  3ARO A;  4E5R A;  2LJ4 A;  3CGM A;  4LAW A;  2RSE A;  4WKF A;  1PBK A;  4ODN A;  2LAJ A;  3WKZ A;  4ZPW R;  1NMW A;  3O5J A;  2YBT A;  2PI6 A;  3VAW A;  4R0X A;  4NSB A;  4P8W A;  3MCB A;  3O5D A;  3OOB A;  3RM9 A;  1RP5 A;  2YSG A;  1FKJ A;  2KE0 A;  3AQU A;  2JV4 A;  1SYT A;  1NWR A;  4QT3 A;  3CZ8 A;  2ITK A;  2MPH A;  1I5H W;  1XRV A;  4DIP A;  2OLH A;  1TK7 A;  1GPF A;  3I6C A;  2FKE A;  2PPP A;  1ZL1 A;  4A0U A;  2WK2 A;  2G8Z A;  3GTY X;  4MNL A;  3CHC A;  4NZC A;  5HT1 A;  5JH8 A;  1LG2 A;  4DRO A;  1FKR A;  2KFW A;  1TR8 A;  2AWG A;  5B8I C;  4IQC A;  2XPA A;  1ZU8 A;  2DPE A;  2WAE A;  4MNK A;  3CHE A;  4U85 A;  1YAT A;  1WR7 A;  1EIB A;  3O5E A;  2A3C A;  3ARQ A;  4TW6 A;  4LAY A;  3NI6 A;  1K9R A;  3B9D A;  4TW8 A;  3UQB A;  1H0I A;  1EG4 A;  1HJX A;  2PPO A;  2WAD A;  1JND A;  1SR0 A;  1L1P A;  2XPB A;  4ODO A;  2XP8 A;  2ZAJ A;  1ZBK A;  3LKX A;  1FFR A;  4Z2I A;  2L4J A;  1LL6 A;  3B8S A;  3LUO A;  2F21 A;  3KAC A;  4MNJ A;  1FAP A;  1W9P A;  3RM4 A;  4P8X A;  4MNM A;  3KAB A;  4W9O A;  4GLX A;  3WD3 A;  3KZ7 A;  4JFJ A;  2RUD A;  2ZQS A;  3O5M A;  3AS2 A;  4GGQ A;  5E66 A;  3GPK A;  4WK9 A;  2UZ5 A;  3ARV A;  3JYM A;  5DF0 A;  1FKS A;  1HKK A;  4DRK A;  1ZBC A;  1K9Q A;  2M1I A;  2RUC A;  2ZR5 A;  1KT1 A;  3UI5 A;  1LL4 A;  3CHD A;  2WM0 A;  1CTN A;  4DT4 A;  1GUV A;  2KXQ A;  3O5P A;  1YW5 A;  3BXW A;  1WAW A;  3PR9 A;  1W9V A;  1E44 A;  3AS0 A;  4IT6 A;  1Q6I A;  5GPG A;  4JFK A;  1Q6H A;  3WIJ A;  2JX8 A;  3ART A;  4ODR A;  2MLY A;  3JYJ A;  4WIW A;  3WD1 A;  1E6P A;  2F23 A;  4ZPV R;  4W5U A;  3ODK A;  1GRJ A;  2PPN A;  1WMV A;  1BKF A;  4MGV A; 
#chains in the Genus database with same CATH homology
 1Q6U A;  4ML4 A;  2L2S A;  4Z2H A;  1HJW A;  3TCZ A;  4G50 A;  1J6Y A;  3PRB A;  4ODK A;  1FKK A;  3CGN A;  4ZS6 A;  3FSC A;  3AS1 A;  1W1V A;  1A7X A;  1VF8 A;  4URI A;  4GIV A;  3TDB A;  2ZQV A;  3G6M A;  3KAH A;  4REX A;  4TYO A;  2Q5A A;  5DIU A;  5E5W A;  5E65 A;  2FAP A;  3TC5 A;  2DG4 A;  3ARU A;  2YSI A;  1JVW A;  2ESC A;  1X6L A;  3M85 A;  2LPV A;  2LGO A;  1E6Z A;  1LL7 A;  4DRN A;  3WD4 A;  2XP9 A;  4FAP A;  4Z2K A;  4Z2L A;  3LE4 A;  1JMQ A;  4DRM A;  1IX5 A;  4DRH A;  1HJV A;  2VCD A;  1Q1C A;  2RUQ A;  1E15 A;  1GOI A;  4DWS D;  3JXV A;  2MLX A;  3FXY A;  2EZ5 W;  4U86 A;  3CH9 A;  1FKD A;  4WJX A;  3UF8 A;  4KR0 B;  2RUR A;  4LAV A;  1ROU A;  2DSW A;  4W9Q A;  4J4N A;  4JYS A;  3WD0 A;  2DG3 A;  1M5Y A;  2RE3 A;  5GQB A;  1F40 A;  3RM8 A;  2DT3 A;  1PIN A;  1FKF A;  1FKT A;  2DJY A;  3O5Q A;  3IHZ A;  4MSP A;  4DZ3 A;  3WH0 A;  2PBC A;  1ZBW A;  3L4H A;  1TFV A;  2F2D A;  3CNG A;  3KAG A;  5E62 A;  1NWU A;  3O5I A;  4ODQ A;  3RME A;  5HW7 A;  4DWS B;  2OWO A;  1OGG A;  4L72 B;  1HXV A;  3B7X A;  5BXJ A;  1LG1 A;  4N19 A;  4TX0 A;  2F4E A;  4DH0 A;  2DSU A;  2VN1 A;  4PTM A;  1FKB A;  4TW7 A;  4JFI A;  4A0T A;  2M2A A;  2QRV A;  1E9L A;  1W9U A;  2DT2 A;  1ZCN A;  1TCO C;  5DO2 A;  2ZQU A;  4U84 A;  3IKG A;  1KFW A;  2YSF A;  1RD6 A;  2RQS A;  2MDI A;  4AY1 A;  4KQZ A;  1K9T A;  4DRP A;  1FD9 A;  3MCB B;  2Y8N B;  5DIT A;  2Y78 A;  5GPR A;  5HW6 A;  3B9E A;  1X6N A;  1ZB5 A;  1EHN A;  4QT2 A;  4DWS C;  2FDM A;  1QPL A;  2PV1 A;  1FFQ A;  1J4H A;  2O92 A;  3O5L A;  4Z2J A;  2WLY A;  2A3E A;  1J4I A;  2DSV A;  1D7I A;  3OA5 A;  4ODP A;  5J6E A;  1LJY A;  3IK8 A;  5AHT A;  2O9O A;  3FAP A;  3PQH A;  1P5Q A;  3O5R A;  1H0G A;  3EY6 A;  3PRD A;  4G2P A;  4LAX A;  3RFW A;  5HWB A;  1HKJ A;  1J4R A;  2IF4 A;  1D6O A;  3G6L A;  4IQ2 A;  1N1A A;  3O5G A;  2KO7 A;  1FJD A;  2DK7 A;  2BA1 A;  2MNT A;  3H9R B;  1EQ3 A;  2DWV A;  1W1Y A;  2PV3 A;  1KT0 A;  1JNS A;  3B9A A;  4HBO A;  3O5F A;  1OWQ A;  2A3B A;  3W4R A;  1W26 A;  3PA7 A;  2YAJ B;  1F8A B;  2DMV A;  5HBF A;  1NSG A;  3ARR A;  4ODM A;  3UI6 A;  3FS8 A;  3LKX B;  3ARS A;  4W9P A;  3ALF A;  1EDQ A;  3WQV A;  2G41 A;  3PRA A;  3KAD A;  1LQ0 A;  2JMF A;  2D9F A;  2E45 A;  4Q22 A;  2M08 A;  1UR9 A;  2M8J A;  4DRJ A;  1HKM A;  2WLZ A;  2JZV A;  3M7N A;  4S3J A;  3QOK A;  4IPX A;  1C9H A;  3KAI A;  3WQW A;  4Z2G A;  2KGJ A;  2LKN A;  5HKG A;  1JNT A;  2OFN A;  2XP3 A;  1ROT A;  4NNR A;  2B31 A;  5DEZ A;  3RGC A;  4JFL A;  4TNS A;  2XP6 A;  1FKL A;  2DT1 A;  2DK1 A;  2DT0 A;  1D7J A;  3ARW A;  5D75 A;  1WNO A;  1E6N A;  3MDY B;  1Y0O A;  2MLZ A;  1W1P A;  5HW8 A;  2KR7 A;  5HTG A;  1ZBV A;  4HBE A;  1D7H A;  1W1T A;  1O6W A;  3ARY A;  4DRI A;  1QZ2 A;  2XP7 A;  4IT4 A;  3KCE A;  1NMV A;  5I98 A;  4O2T A;  3ALG A;  4MAV A;  1HKI A;  2K8I A;  4QZV B;  4R5E A;  1D2K A;  1ITX A;  5DIV A;  3NTP A;  5HWC A;  1NWS A;  5HUA A;  3O5K A;  1OGB A;  4JFM A;  2KI3 A;  3ARZ A;  3FY1 A;  3IKD A;  4S3K A;  1NWT A;  4MPK A;  2YSH A;  2YSB A;  4MTV A;  4Q7N A;  4J4O A;  4WKH A;  5CQ2 A;  1NH6 A;  1T11 A;  4P8U A;  1UR8 A;  2IUZ A;  4ODL A;  2YBU A;  4FN2 A;  4DZ2 A;  4ITZ A;  5U47 A;  1JNE A;  1FKI A;  3KAF A;  1O6I A;  3UI4 A;  1WB0 A;  4C02 B;  1QPF A;  3MQG A;  1FKH A;  3WD2 A;  1U79 A;  4QIB A;  3CHF A;  3ARX A;  2XP4 A;  4XAK A;  1FLC A;  1BL4 A;  4LGX A;  2N87 A;  2MF9 A;  3UQI A;  2ZR4 A;  3AS3 A;  3FSB A;  1EG3 A;  1ZK6 A;  1R9H A;  3MQH A;  3WL1 A;  3ARP A;  4DWS A;  2AOS A;  2DSZ A;  3WL0 A;  4ZPT R;  3UQA A;  1E6R A;  3O5O A;  2DG9 A;  1B6C A;  4DRQ A;  2M3O W;  2JXW A;  1EYM A;  2XP5 A;  2A3A A;  2ZR6 A;  3NRK A;  4L3N A;  4P8V A;  1XHG A;  5E64 A;  4BF8 A;  2PV2 A;  2QF8 A;  2M8I A;  4WKA A;  4HAR A;  1FKG A;  2ZQT A;  3ARO A;  4E5R A;  2LJ4 A;  3CGM A;  4LAW A;  2RSE A;  4WKF A;  1PBK A;  4ODN A;  2LAJ A;  3WKZ A;  4ZPW R;  1NMW A;  3O5J A;  2YBT A;  2PI6 A;  3VAW A;  4R0X A;  4NSB A;  4P8W A;  3MCB A;  3O5D A;  3OOB A;  3RM9 A;  1RP5 A;  2YSG A;  1FKJ A;  2KE0 A;  3AQU A;  2JV4 A;  1SYT A;  1NWR A;  4QT3 A;  3CZ8 A;  2ITK A;  2MPH A;  1I5H W;  1XRV A;  4DIP A;  2OLH A;  1TK7 A;  1GPF A;  3I6C A;  2FKE A;  2PPP A;  1ZL1 A;  4A0U A;  2WK2 A;  2G8Z A;  4MNL A;  5HT1 A;  3CHC A;  4NZC A;  5JH8 A;  1LG2 A;  4DRO A;  1FKR A;  2KFW A;  1TR8 A;  2AWG A;  5B8I C;  4IQC A;  2XPA A;  1ZU8 A;  2DPE A;  2WAE A;  4MNK A;  3CHE A;  4U85 A;  1YAT A;  1WR7 A;  1EIB A;  3O5E A;  2A3C A;  3ARQ A;  4TW6 A;  4LAY A;  3NI6 A;  1K9R A;  3B9D A;  4TW8 A;  3UQB A;  1H0I A;  1EG4 A;  1HJX A;  2PPO A;  2WAD A;  1JND A;  1SR0 A;  1L1P A;  2XPB A;  4ODO A;  2XP8 A;  2ZAJ A;  1ZBK A;  3LKX A;  1FFR A;  4Z2I A;  2L4J A;  1LL6 A;  3B8S A;  3LUO A;  2F21 A;  3KAC A;  4MNJ A;  1FAP A;  1W9P A;  3RM4 A;  4P8X A;  4MNM A;  3KAB A;  4W9O A;  4GLX A;  3WD3 A;  3KZ7 A;  4JFJ A;  2RUD A;  2ZQS A;  3O5M A;  3AS2 A;  4GGQ A;  5E66 A;  3GPK A;  4WK9 A;  2UZ5 A;  3ARV A;  3JYM A;  5DF0 A;  1FKS A;  1HKK A;  4DRK A;  1ZBC A;  1K9Q A;  2M1I A;  2RUC A;  2ZR5 A;  1KT1 A;  3UI5 A;  1LL4 A;  3CHD A;  2WM0 A;  1CTN A;  4DT4 A;  1GUV A;  2KXQ A;  3O5P A;  1YW5 A;  3BXW A;  1WAW A;  3PR9 A;  1W9V A;  3AS0 A;  4IT6 A;  1Q6I A;  5GPG A;  4JFK A;  1Q6H A;  3WIJ A;  2JX8 A;  3ART A;  4ODR A;  2MLY A;  3JYJ A;  4WIW A;  3WD1 A;  1E6P A;  4ZPV R;  4W5U A;  3ODK A;  2PPN A;  1WMV A;  1BKF A;  4MGV A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...