1YW5A

Peptidyl-prolyl isomerase ess1 from candida albicans
Total Genus 55
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
55
sequence length
177
structure length
177
Chain Sequence
MASTSTGLPPNWTIRVSRSHNKEYFLNQSTNESSWDPPYGTDKEVLNAYIAKFKNNGYKPLVNEDGQVRVSHLLIKNNQSRKPKSWKSPDGISRTRDESIQILKKHLERILSGEVKLSELANTESDCSSHDRGGDLGFFSKGQMQPPFEEAAFNLHVGEVSNIIETNSGVHILQRTG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The Structure of the Candida albicans Ess1 Prolyl Isomerase Reveals a Well-Ordered Linker that Restricts Domain Mobility
pubmed doi rcsb
source organism Candida albicans
molecule tags Isomerase
molecule keywords peptidyl prolyl cis/trans isomerase
total genus 55
structure length 177
sequence length 177
ec nomenclature ec 5.2.1.8: Peptidylprolyl isomerase.
pdb deposition date 2005-02-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00397 WW WW domain
A PF00639 Rotamase PPIC-type PPIASE domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.20.70.10 Mainly Beta Single Sheet Ubiquitin Ligase Nedd4; Chain: W; Ubiquitin Ligase Nedd4; Chain: W; 1yw5A01
3.10.50.40 Alpha Beta Roll Chitinase A; domain 3 Chitinase A; domain 3 1yw5A02
1Q6HA 3EY6A 2M8IA 3RFWA 1J4HA 3IKDA 3O5IA 4ODQA 3CGMA 3O5JA 1C9HA 2DK1A 1W26A 1TK7A 4REXA 2Q5AA 3WH0A 2XP9A 1EG3A 1B6CA 2LAJA 2ITKA 1FKSA 1JVWA 1ZK6A 5AHTA 1N1AA 1QPLA 2RQSA 1HXVA 4GIVA 3ODKA 1FKTA 1JMQA 2LJ4A 2RSEA 1YW5A 3I6CA 4TNSA 4DIPA 2RURA 3KACA 1ZCNA 2DG4A 2M08A 1FJDA 2XP4A 1KT1A 2DG3A 2JX8A 3UQIA 2ZR4A 1PINA 1FKDA 1NMWA 4DRNA 5J6EA 1FKFA 3CGNA 1F40A 4ODOA 4O2TA 4DZ3A 2YSHA 3O5RA 4QIBA 3B7XA 3LUOA 3O5FA 3UI5A 1TCOC 1FKRA 3KABA 3KCEA 1FKHA 1JNTA 5HT1A 1J4RA 3O5LA 2KO7A 2PPOA 4TW7A 1BKFA 3O5GA 1FKIA 1K9QA 1QZ2A 3NI6A 1U79A 2F2DA 2YSBA 2M3OW 5DITA 2XPAA 4DRMA 3FAPA 3O5KA 1Q1CA 3PRDA 2BA1A 2KE0A 2L2SA 4QT2A 1D7HA 4G2PA 1FAPA 3UI6A 1NMVA 3NRKA 1WR7A 1J4IA 2RUDA 4DRJA 2JXWA 2M2AA 1D7JA 2FKEA 2JZVA 1ROUA 2PPPA 4TW8A 2Y78A 4W9QA 4W9OA 2ZR6A 3UQBA 2M8JA 3KAFA 2D9FA 2F4EA 2N87A 4TW6A 4JYSA 3TCZA 3H9RB 4LAXA 1FKKA 2ZQUA 2F21A 3CNGA 4ODNA 2FAPA 2XP8A 1A7XA 2DG9A 4ODMA 3TDBA 5HKGA 1J6YA 2YSFA 2MPHA 2ZAJA 4ODPA 5HTGA 3M7NA 1L1PA 3O5OA 3O5PA 2DJYA 3NTPA 1NSGA 3O5MA 5DIVA 2MDIA 5HW6A 2XP5A 4ODLA 4IQ2A 2XP7A 4G50A 4U84A 3JYJA 2KXQA 2KI3A 4FAPA 2RUCA 4QT3A 4DRKA 2AWGA 5HW8A 2VN1A 1I5HW 1BL4A 4JFMA 5D75A 2KR7A 5HWBA 4ODRA 2EZ5W 2YSGA 2ZQSA 2XP3A 4U86A 1Q6IA 3O5EA 4J4NA 4JFKA 4R0XA 2OFNA 1ROTA 3JXVA 1FKBA 4GGQA 4JFIA 1JNSA 3L4HA 1K9RA 2PPNA 3TC5A 1R9HA 1T11A 2MLZA 2PV3A 5DIUA 2XPBA 2ZQVA 2DWVA 4ODKA 1FKLA 1Y0OA 3UQAA 4U85A 1EG4A 4JFLA 4DRPA 4IPXA 5HW7A 1FD9A 2JV4A 1M5YA 1QPFA 4IQCA 1FKJA 1KT0A 3GPKA 2K8IA 4LAYA 2DK7A 1D7IA 3KZ7A 1WMVA 4DRHA 1EQ3A 3KAHA 1O6WA 4C02B 3KAIA 4FN2A 3RGCA 3IKGA 1EYMA 2IF4A 4J4OA 4E5RA 3UF8A 3IHZA 4DH0A 3UI4A 2MNTA 3LE4A 3PRBA 2LGOA 5GPGA 1D6OA 3O5DA 2PV2A 5HUAA 3KAGA 2PBCA 4MSPA 5B8IC 4DRIA 1PBKA 2LPVA 1FKGA 4NNRA 2RE3A 2ZQTA 2ZR5A 2MLXA 2E45A 2LKNA 2DMVA 4JFJA 5HWCA 3MDYB 3O5QA 1YATA 4N19A 2KFWA 2XP6A 2VCDA 4MGVA 4BF8A 4TX0A 4DT4A 4ITZA 2M1IA 2RUQA 3VAWA 2MF9A 3PA7A 4TYOA 1F8AB 3KADA 3M85A 4W9PA 4DZ2A 5BXJA 2PV1A 2JMFA 4LAVA 3IK8A 5CQ2A 3OOBA 4DROA 4LAWA 2YSIA 1Q6UA 1P5QA 2KGJA 2UZ5A 5I98A 2L4JA 4DRQA 2MLYA 3JYMA
chains in the Genus database with same CATH superfamily
2M8IA 4ODQA 3CGMA 3O5JA 4REXA 2Q5AA 2XP9A 3WH0A 4GLXA 2LAJA 2RQSA 5AHTA 5JH8A 5HW7A 2RSEA 1JMQA 3I6CA 2WLYA 2IUZA 1ZCNA 2DG3A 3ARQA 3UQIA 1FKFA 2B5UB 3B7XA 2WM0A 3KABA 1FKHA 4MNLA 3O5GA 4PTMA 1FKIA 3NI6A 2F2DA 2YSBA 1IX5A 1NWTA 3FAPA 4QT2A 3PRDA 5DEZA 4S3JA 4AY1A 4G2PA 1J4IA 3RM9A 2M2AA 1OGGA 3UQBA 2M8JA 4URIA 3B9AA 3WIJA 3H9RB 2WAEA 1J6YA 1LQ0A 4ODPA 5HTGA 4WK9A 3M7NA 3O5OA 3WKZA 4UDMA 3CHFA 4IQ2A 1X6NA 2KXQA 1E6PA 4FAPA 4Z2JA 4L3NA 2AWGA 2VN1A 3WL1A 1BL4A 2EULA 4JFMA 5D75A 2KR7A 4ODRA 1Q6IA 4J4NA 1RD6A 3JXVA 4GGQA 4JFIA 4ZS6A 4Z2LA 1K9RA 2PPNA 4Q7NA 5DIUA 5E66A 4ODKA 1FKLA 3UQAA 2DSZA 1XRVA 1FD9A 2JV4A 1QPFA 1NWRA 1O6WA 3FSCA 3WD4A 3KAIA 2IF4A 4LGXA 4E5RA 1LL7A 3UF8A 3IHZA 3PR9A 3PRBA 1W1PA 3O5DA 1D2KA 2PV2A 4MNKA 1TFVA 4MNMA 1EDQA 4DRIA 3ARUA 3BXWA 1HKJA 2RE3A 4XAKA 2ZR5A 3AS3A 3CHDA 4JFJA 2XP6A 2VCDA 1CTNA 4MGVA 1FFRA 2M1IA 1UR8A 4TYOA 3M85A 5BXJA 2JMFA 3RM8A 4DROA 3MCBA 2KGJA 1UR9A 5I98A 4IT4A 1JNSA 4DRQA 3MQGA 1Q6HA 3EY6A 1GOIA 4A0TA 1HJXA 3RFWA 1J4HA 3O5IA 5E64A 2DK1A 2FAPA 3FY1A 1QPLA 1N1AA 3GTYX 3ODKA 3G6MA 1YW5A 4DIPA 1NH6A 3PQHA 2XP4A 1LG1A 1FKDA 1NMWA 1ZB5A 5J6EA 3CGNA 2YSHA 3GU0A 2F23A 1LG2A 3KCEA 2Y8NB 1J4RA 1K9QA 1W1YA 4A0UA 1QZ2A 1WAWA 3WD2A 4Z2HA 2M3OW 2XPAA 3ARXA 2KE0A 1RP5A 1D7HA 4W5UA 1E6RA 3UI6A 4DRJA 4W9QA 1HKKA 2O92A 1ROUA 4TW8A 3KAFA 2F4EA 1FKKA 2DG9A 2A3EA 5HKGA 2YSFA 2MPHA 3O5PA 1E44A 3NTPA 3O5MA 4L72B 4MNJA 2XP5A 3B9EA 1ZBVA 4G50A 4HBOA 2KI3A 1XHGA 1ZL1A 2YSGA 2XP3A 1NWUA 4R0XA 2DT3A 1ROTA 2OFNA 4ML4A 4WKHA 1ZU8A 2A3CA 4HARA 3TC5A 1R9HA 2PV3A 1VF8A 1Y0OA 4P8UA 4QZVB 4DRPA 4ZPWR 2DSWA 4WIWA 2P4VA 2DT1A 1D7IA 1W9UA 1W9PA 1EQ3A 3KAHA 4C02B 4ZPTR 3IKGA 4DH0A 3ARWA 3UI4A 2MNTA 2LGOA 1D6OA 2DT0A 2PBCA 4S3KA 1FKGA 4R5EA 2ZQTA 4HBEA 2E45A 1LL4A 3O5QA 2KFWA 2YBUA 3OA5A 5GPRA 1X6LA 2RUQA 3LKXB 4P8VA 5CQ2A 1FFQA 1KFWA 2YSIA 2FDMA 2UZ5A 5E5WA 3PA7A 4MPKA 2DSUA 5HBFA 1FKRA 1EG3A 2ITKA 1FKSA 2ESCA 4GIVA 1FKTA 2LJ4A 4TNSA 1FJDA 2RURA 2B31A 2DG4A 2M08A 1JCHB 1EIBA 2JX8A 1HKIA 1F40A 1PINA 4ODOA 4O2TA 4P8XA 4DZ3A 2G8ZA 3MQHA 5HT1A 3O5LA 4TW7A 1JNDA 1O6IA 4DWSB 1LJYA 5U47A 1Q1CA 2BA1A 2L2SA 1W1VA 1E9LA 1FAPA 3ARTA 3NRKA 1WR7A 2RUDA 1W1TA 3ARYA 2JXWA 3PRAA 1D7JA 2FKEA 2JZVA 3AROA 4Z2IA 2Y78A 2ZR6A 2WADA 4LAXA 1E6ZA 3CNGA 2F21A 3B9DA 1SR0A 2XP8A 4ODMA 1H0IA 2ZAJA 4NSBA 1L1PA 2DJYA 1NSGA 1W9VA 2MDIA 5DIVA 1NWSA 2WK2A 4ODLA 3FSBA 2XP7A 2A3AA 2DPEA 2RUCA 4QT3A 4DRKA 1GRJA 2WLZA 1I5HW 3WD0A 1H0GA 2EZ5W 2ZQSA 2AOSA 4WKFA 3O5EA 1HJWA 4JFKA 3MCBB 1FKBA 3L4HA 1T11A 2XPBA 3ARVA 1ZBWA 3AQUA 1M5YA 4IQCA 4ZPVR 1FKJA 3KZ7A 4DRHA 2A3BA 3WD3A 2PI6A 4J4OA 2YAJB 3EIPA 1ITXA 4Z2GA 5HUAA 1LL6A 3ARPA 1EHNA 1PBKA 3QOKA 4DWSC 3RM4A 4NNRA 2LKNA 3WL0A 2OLHA 2DMVA 5HWCA 3MDYB 4N19A 1E6NA 4BF8A 4TX0A 4DT4A 2OWOA 2G41A 3VAWA 1WNOA 4W9PA 4DZ2A 4LAVA 3IK8A 4LAWA 5B8IC 3JYMA 1ZBCA 3IKDA 2DT2A 1C9HA 1W26A 3AS1A 1TK7A 1B6CA 1HXVA 1JVWA 1ZK6A 3AS2A 4IT6A 3KACA 1KT1A 2ZR4A 2ETNA 4DRNA 2O9OA 2QF8A 3O5RA 4QIBA 3BMBA 3LUOA 3O5FA 3UI5A 1TCOC 1JNTA 2KO7A 2PPOA 1BKFA 3G6LA 1TR8A 1OWQA 1U79A 1HJVA 4Z2KA 5DITA 1WB0A 4DRMA 3O5KA 3ARRA 1FLCA 3CZ8A 4MAVA 4DWSD 1NMVA 3B8SA 4NZCA 2PPPA 4W9OA 5DO2A 4WJXA 1OGBA 4P8WA 2D9FA 2N87A 4TW6A 4JYSA 3TCZA 2ZQUA 4ODNA 3RMEA 3CH9A 1A7XA 3TDBA 5HW6A 1ZBKA 5E65A 4U84A 3JYJA 5HW8A 3ARZA 3W4RA 5E62A 5HWBA 3RGCA 4U86A 5DF0A 2QRVA 3CHCA 2MLZA 3AS0A 2PN0A 2ZQVA 2DWVA 4U85A 1EG4A 4JFLA 4IPXA 1GUVA 1KT0A 2DSVA 3GPKA 2K8IA 4LAYA 2DK7A 3WQWA 1WMVA 3FXYA 4KQZA 3ARSA 4FN2A 1EYMA 3CHEA 3LE4A 1GPFA 5GPGA 3KAGA 3LKXA 4MSPA 3WQVA 2LPVA 1K9TA 1HKMA 2YBTA 3FS8A 2MLXA 1JNEA 5GQBA 1E15A 1YATA 4DWSA 4KR0B 3WD1A 4MTVA 1SYTA 4ITZA 4Q22A 2MF9A 1F8AB 3KADA 3ALGA 2PV1A 4WKAA 3OOBA 3ALFA 1Q6UA 1P5QA 2L4JA 2MLYA
chains in the Genus database with same CATH topology
2M8IA 4ODQA 3CGMA 3O5JA 4REXA 2Q5AA 2XP9A 3WH0A 4GLXA 2LAJA 2RQSA 5AHTA 5JH8A 5HW7A 2RSEA 1JMQA 3I6CA 2WLYA 2IUZA 1ZCNA 2DG3A 3ARQA 3UQIA 1FKFA 3B7XA 2WM0A 3KABA 1FKHA 4MNLA 3O5GA 4PTMA 1FKIA 3NI6A 2F2DA 2YSBA 1IX5A 1NWTA 3FAPA 4QT2A 3PRDA 5DEZA 4S3JA 4AY1A 4G2PA 1J4IA 3RM9A 2M2AA 1OGGA 3UQBA 2M8JA 4URIA 3B9AA 3WIJA 3H9RB 2WAEA 1J6YA 1LQ0A 4ODPA 5HTGA 4WK9A 3M7NA 3O5OA 3WKZA 3CHFA 4IQ2A 1X6NA 2KXQA 1E6PA 4FAPA 4Z2JA 4L3NA 2AWGA 2VN1A 3WL1A 1BL4A 5D75A 4JFMA 2KR7A 4ODRA 1Q6IA 4J4NA 1RD6A 3JXVA 4GGQA 4JFIA 4ZS6A 4Z2LA 1K9RA 2PPNA 4Q7NA 5DIUA 5E66A 4ODKA 1FKLA 3UQAA 2DSZA 1XRVA 1FD9A 2JV4A 1QPFA 1NWRA 1O6WA 3FSCA 3WD4A 3KAIA 2IF4A 4LGXA 4E5RA 1LL7A 3UF8A 3IHZA 3PR9A 3PRBA 1W1PA 3O5DA 1D2KA 2PV2A 4MNKA 1TFVA 4MNMA 1EDQA 4DRIA 3ARUA 3BXWA 1HKJA 2RE3A 4XAKA 2ZR5A 3AS3A 3CHDA 4JFJA 2XP6A 2VCDA 1CTNA 4MGVA 1FFRA 2M1IA 1UR8A 4TYOA 3M85A 5BXJA 2JMFA 3RM8A 4DROA 3MCBA 2KGJA 1UR9A 5I98A 4IT4A 1JNSA 4DRQA 3MQGA 1Q6HA 3EY6A 1GOIA 4A0TA 1HJXA 3RFWA 1J4HA 3O5IA 5E64A 2DK1A 2FAPA 3FY1A 1QPLA 1N1AA 3ODKA 3G6MA 1YW5A 4DIPA 1NH6A 3PQHA 2XP4A 1LG1A 1FKDA 1NMWA 1ZB5A 5J6EA 3CGNA 2YSHA 1LG2A 3KCEA 2Y8NB 1J4RA 1K9QA 1W1YA 4A0UA 1QZ2A 1WAWA 3WD2A 4Z2HA 2M3OW 2XPAA 3ARXA 2KE0A 1RP5A 1D7HA 4W5UA 1E6RA 3UI6A 4DRJA 4W9QA 1HKKA 2O92A 1ROUA 4TW8A 3KAFA 2F4EA 1FKKA 2DG9A 2A3EA 5HKGA 2YSFA 2MPHA 3O5PA 3O5MA 3NTPA 4L72B 4MNJA 2XP5A 3B9EA 1ZBVA 4G50A 4HBOA 2KI3A 1XHGA 1ZL1A 2YSGA 2XP3A 1NWUA 4R0XA 2DT3A 1ROTA 2OFNA 4ML4A 4WKHA 1ZU8A 2A3CA 4HARA 3TC5A 1R9HA 2PV3A 1VF8A 1Y0OA 4P8UA 4QZVB 4DRPA 4ZPWR 2DSWA 4WIWA 2DT1A 1D7IA 1W9UA 1W9PA 1EQ3A 3KAHA 4C02B 4ZPTR 3IKGA 4DH0A 3ARWA 3UI4A 2MNTA 2LGOA 1D6OA 2DT0A 2PBCA 4S3KA 1FKGA 4R5EA 2ZQTA 4HBEA 2E45A 1LL4A 3O5QA 2KFWA 2YBUA 3OA5A 5GPRA 1X6LA 2RUQA 3LKXB 4P8VA 5CQ2A 1FFQA 1KFWA 2YSIA 2FDMA 2UZ5A 5E5WA 3PA7A 4MPKA 2DSUA 5HBFA 1FKRA 1EG3A 2ITKA 1FKSA 2ESCA 4GIVA 1FKTA 2LJ4A 4TNSA 1FJDA 2RURA 2B31A 2DG4A 2M08A 1EIBA 2JX8A 1HKIA 1F40A 1PINA 4ODOA 4O2TA 4P8XA 4DZ3A 2G8ZA 3MQHA 5HT1A 3O5LA 4TW7A 1JNDA 1O6IA 4DWSB 1LJYA 5U47A 1Q1CA 2BA1A 2L2SA 1W1VA 1E9LA 1FAPA 3ARTA 3NRKA 1WR7A 2RUDA 1W1TA 3ARYA 2JXWA 3PRAA 1D7JA 2FKEA 2JZVA 3AROA 4Z2IA 2Y78A 2ZR6A 2WADA 4LAXA 1E6ZA 3CNGA 2F21A 3B9DA 1SR0A 2XP8A 4ODMA 1H0IA 2ZAJA 4NSBA 1L1PA 2DJYA 1NSGA 1W9VA 2MDIA 5DIVA 1NWSA 2WK2A 4ODLA 3FSBA 2XP7A 2A3AA 2DPEA 2RUCA 4QT3A 4DRKA 2WLZA 1I5HW 3WD0A 1H0GA 2EZ5W 2ZQSA 2AOSA 4WKFA 3O5EA 1HJWA 4JFKA 3MCBB 1FKBA 3L4HA 1T11A 2XPBA 3ARVA 1ZBWA 3AQUA 1M5YA 4IQCA 4ZPVR 1FKJA 3KZ7A 4DRHA 2A3BA 3WD3A 2PI6A 4J4OA 2YAJB 1ITXA 4Z2GA 5HUAA 1LL6A 3ARPA 1EHNA 1PBKA 3QOKA 4DWSC 3RM4A 4NNRA 2LKNA 3WL0A 2OLHA 2DMVA 5HWCA 3MDYB 4N19A 1E6NA 4BF8A 4TX0A 4DT4A 2OWOA 2G41A 3VAWA 1WNOA 4W9PA 4DZ2A 4LAVA 3IK8A 4LAWA 5B8IC 3JYMA 1ZBCA 3IKDA 2DT2A 1C9HA 1W26A 3AS1A 1TK7A 1B6CA 1HXVA 1JVWA 1ZK6A 3AS2A 4IT6A 3KACA 1KT1A 2ZR4A 4DRNA 2O9OA 2QF8A 3O5RA 4QIBA 3LUOA 3O5FA 3UI5A 1TCOC 1JNTA 2KO7A 2PPOA 1BKFA 3G6LA 1TR8A 1OWQA 1U79A 1HJVA 4Z2KA 5DITA 1WB0A 4DRMA 3O5KA 3ARRA 1FLCA 3CZ8A 4MAVA 4DWSD 1NMVA 3B8SA 4NZCA 2PPPA 4W9OA 5DO2A 4WJXA 1OGBA 4P8WA 2D9FA 2N87A 4TW6A 4JYSA 3TCZA 2ZQUA 4ODNA 3RMEA 3CH9A 1A7XA 3TDBA 5HW6A 1ZBKA 5E65A 4U84A 3JYJA 5HW8A 3ARZA 3W4RA 5E62A 5HWBA 3RGCA 4U86A 5DF0A 2QRVA 3CHCA 2MLZA 3AS0A 2ZQVA 2DWVA 4U85A 1EG4A 4JFLA 4IPXA 1GUVA 1KT0A 2DSVA 3GPKA 2K8IA 4LAYA 2DK7A 3WQWA 1WMVA 3FXYA 4KQZA 3ARSA 4FN2A 1EYMA 3CHEA 3LE4A 1GPFA 5GPGA 3KAGA 3LKXA 4MSPA 3WQVA 2LPVA 1K9TA 1HKMA 2YBTA 3FS8A 2MLXA 1JNEA 5GQBA 1E15A 1YATA 4DWSA 4KR0B 3WD1A 4MTVA 1SYTA 4ITZA 4Q22A 2MF9A 1F8AB 3KADA 3ALGA 2PV1A 4WKAA 3OOBA 3ALFA 1Q6UA 1P5QA 2L4JA 2MLYA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1Q6H A;  3EY6 A;  2M8I A;  3RFW A;  1J4H A;  3IKD A;  3O5I A;  4ODQ A;  3CGM A;  3O5J A;  1C9H A;  2DK1 A;  1W26 A;  1TK7 A;  4REX A;  2Q5A A;  3WH0 A;  2XP9 A;  1EG3 A;  1B6C A;  2LAJ A;  2ITK A;  1FKS A;  1JVW A;  1ZK6 A;  5AHT A;  1N1A A;  1QPL A;  2RQS A;  1HXV A;  4GIV A;  3ODK A;  1FKT A;  1JMQ A;  2LJ4 A;  2RSE A;  1YW5 A;  3I6C A;  4TNS A;  4DIP A;  2RUR A;  3KAC A;  1ZCN A;  2DG4 A;  2M08 A;  1FJD A;  2XP4 A;  1KT1 A;  2DG3 A;  2JX8 A;  3UQI A;  2ZR4 A;  1PIN A;  1FKD A;  1NMW A;  4DRN A;  5J6E A;  1FKF A;  3CGN A;  1F40 A;  4ODO A;  4O2T A;  4DZ3 A;  2YSH A;  3O5R A;  4QIB A;  3B7X A;  3LUO A;  3O5F A;  3UI5 A;  1TCO C;  1FKR A;  3KAB A;  3KCE A;  1FKH A;  1JNT A;  5HT1 A;  1J4R A;  3O5L A;  2KO7 A;  2PPO A;  4TW7 A;  1BKF A;  3O5G A;  1FKI A;  1K9Q A;  1QZ2 A;  3NI6 A;  1U79 A;  2F2D A;  2YSB A;  2M3O W;  5DIT A;  2XPA A;  4DRM A;  3FAP A;  3O5K A;  1Q1C A;  3PRD A;  2BA1 A;  2KE0 A;  2L2S A;  4QT2 A;  1D7H A;  4G2P A;  1FAP A;  3UI6 A;  1NMV A;  3NRK A;  1WR7 A;  1J4I A;  2RUD A;  4DRJ A;  2JXW A;  2M2A A;  1D7J A;  2FKE A;  2JZV A;  1ROU A;  2PPP A;  4TW8 A;  2Y78 A;  4W9Q A;  4W9O A;  2ZR6 A;  3UQB A;  2M8J A;  3KAF A;  2D9F A;  2F4E A;  2N87 A;  4TW6 A;  4JYS A;  3TCZ A;  3H9R B;  4LAX A;  1FKK A;  2ZQU A;  2F21 A;  3CNG A;  4ODN A;  2FAP A;  2XP8 A;  1A7X A;  2DG9 A;  4ODM A;  3TDB A;  5HKG A;  1J6Y A;  2YSF A;  2MPH A;  2ZAJ A;  4ODP A;  5HTG A;  3M7N A;  1L1P A;  3O5O A;  3O5P A;  2DJY A;  3NTP A;  1NSG A;  3O5M A;  5DIV A;  2MDI A;  5HW6 A;  2XP5 A;  4ODL A;  4IQ2 A;  2XP7 A;  4G50 A;  4U84 A;  3JYJ A;  2KXQ A;  2KI3 A;  4FAP A;  2RUC A;  4QT3 A;  4DRK A;  2AWG A;  5HW8 A;  2VN1 A;  1I5H W;  1BL4 A;  4JFM A;  5D75 A;  2KR7 A;  5HWB A;  4ODR A;  2EZ5 W;  2YSG A;  2ZQS A;  2XP3 A;  4U86 A;  1Q6I A;  3O5E A;  4J4N A;  4JFK A;  4R0X A;  2OFN A;  1ROT A;  3JXV A;  1FKB A;  4GGQ A;  4JFI A;  1JNS A;  3L4H A;  1K9R A;  2PPN A;  3TC5 A;  1R9H A;  1T11 A;  2MLZ A;  2PV3 A;  5DIU A;  2XPB A;  2ZQV A;  2DWV A;  4ODK A;  1FKL A;  1Y0O A;  3UQA A;  4U85 A;  1EG4 A;  4JFL A;  4DRP A;  4IPX A;  5HW7 A;  1FD9 A;  2JV4 A;  1M5Y A;  1QPF A;  4IQC A;  1FKJ A;  1KT0 A;  3GPK A;  2K8I A;  4LAY A;  2DK7 A;  1D7I A;  3KZ7 A;  1WMV A;  4DRH A;  1EQ3 A;  3KAH A;  1O6W A;  4C02 B;  3KAI A;  4FN2 A;  3RGC A;  3IKG A;  1EYM A;  2IF4 A;  4J4O A;  4E5R A;  3UF8 A;  3IHZ A;  4DH0 A;  3UI4 A;  2MNT A;  3LE4 A;  3PRB A;  2LGO A;  5GPG A;  1D6O A;  3O5D A;  2PV2 A;  5HUA A;  3KAG A;  2PBC A;  4MSP A;  5B8I C;  4DRI A;  1PBK A;  2LPV A;  1FKG A;  4NNR A;  2RE3 A;  2ZQT A;  2ZR5 A;  2MLX A;  2E45 A;  2LKN A;  2DMV A;  4JFJ A;  5HWC A;  3MDY B;  3O5Q A;  1YAT A;  4N19 A;  2KFW A;  2XP6 A;  2VCD A;  4MGV A;  4BF8 A;  4TX0 A;  4DT4 A;  4ITZ A;  2M1I A;  2RUQ A;  3VAW A;  2MF9 A;  3PA7 A;  4TYO A;  1F8A B;  3KAD A;  3M85 A;  4W9P A;  4DZ2 A;  5BXJ A;  2PV1 A;  2JMF A;  4LAV A;  3IK8 A;  5CQ2 A;  3OOB A;  4DRO A;  4LAW A;  2YSI A;  1Q6U A;  1P5Q A;  2KGJ A;  2UZ5 A;  5I98 A;  2L4J A;  4DRQ A;  2MLY A;  3JYM A; 
#chains in the Genus database with same CATH topology
 2M8I A;  4ODQ A;  3CGM A;  3O5J A;  4REX A;  2Q5A A;  2XP9 A;  3WH0 A;  4GLX A;  2LAJ A;  2RQS A;  5AHT A;  5JH8 A;  5HW7 A;  2RSE A;  1JMQ A;  3I6C A;  2WLY A;  2IUZ A;  1ZCN A;  2DG3 A;  3ARQ A;  3UQI A;  1FKF A;  2B5U B;  3B7X A;  2WM0 A;  3KAB A;  1FKH A;  4MNL A;  3O5G A;  4PTM A;  1FKI A;  3NI6 A;  2F2D A;  2YSB A;  1IX5 A;  1NWT A;  3FAP A;  4QT2 A;  3PRD A;  5DEZ A;  4S3J A;  4AY1 A;  4G2P A;  1J4I A;  3RM9 A;  2M2A A;  1OGG A;  3UQB A;  2M8J A;  4URI A;  3B9A A;  3WIJ A;  3H9R B;  2WAE A;  1J6Y A;  1LQ0 A;  4ODP A;  5HTG A;  4WK9 A;  3M7N A;  3O5O A;  3WKZ A;  4UDM A;  3CHF A;  4IQ2 A;  1X6N A;  2KXQ A;  1E6P A;  4FAP A;  4Z2J A;  4L3N A;  2AWG A;  2VN1 A;  3WL1 A;  1BL4 A;  2EUL A;  4JFM A;  5D75 A;  2KR7 A;  4ODR A;  1Q6I A;  4J4N A;  1RD6 A;  3JXV A;  4GGQ A;  4JFI A;  4ZS6 A;  4Z2L A;  1K9R A;  2PPN A;  4Q7N A;  5DIU A;  5E66 A;  4ODK A;  1FKL A;  3UQA A;  2DSZ A;  1XRV A;  1FD9 A;  2JV4 A;  1QPF A;  1NWR A;  1O6W A;  3FSC A;  3WD4 A;  3KAI A;  2IF4 A;  4LGX A;  4E5R A;  1LL7 A;  3UF8 A;  3IHZ A;  3PR9 A;  3PRB A;  1W1P A;  3O5D A;  1D2K A;  2PV2 A;  4MNK A;  1TFV A;  4MNM A;  1EDQ A;  4DRI A;  3ARU A;  3BXW A;  1HKJ A;  2RE3 A;  4XAK A;  2ZR5 A;  3AS3 A;  3CHD A;  4JFJ A;  2XP6 A;  2VCD A;  1CTN A;  4MGV A;  1FFR A;  2M1I A;  1UR8 A;  4TYO A;  3M85 A;  5BXJ A;  2JMF A;  3RM8 A;  4DRO A;  3MCB A;  2KGJ A;  1UR9 A;  5I98 A;  4IT4 A;  1JNS A;  4DRQ A;  3MQG A;  1Q6H A;  3EY6 A;  1GOI A;  4A0T A;  1HJX A;  3RFW A;  1J4H A;  3O5I A;  5E64 A;  2DK1 A;  2FAP A;  3FY1 A;  1QPL A;  1N1A A;  3GTY X;  3ODK A;  3G6M A;  1YW5 A;  4DIP A;  1NH6 A;  3PQH A;  2XP4 A;  1LG1 A;  1FKD A;  1NMW A;  1ZB5 A;  5J6E A;  3CGN A;  2YSH A;  3GU0 A;  2F23 A;  1LG2 A;  3KCE A;  2Y8N B;  1J4R A;  1K9Q A;  1W1Y A;  4A0U A;  1QZ2 A;  1WAW A;  3WD2 A;  4Z2H A;  2M3O W;  2XPA A;  3ARX A;  2KE0 A;  1RP5 A;  1D7H A;  4W5U A;  1E6R A;  3UI6 A;  4DRJ A;  4W9Q A;  1HKK A;  2O92 A;  1ROU A;  4TW8 A;  3KAF A;  2F4E A;  1FKK A;  2DG9 A;  2A3E A;  5HKG A;  2YSF A;  2MPH A;  3O5P A;  1E44 A;  3NTP A;  3O5M A;  4L72 B;  4MNJ A;  2XP5 A;  3B9E A;  1ZBV A;  4G50 A;  4HBO A;  2KI3 A;  1XHG A;  1ZL1 A;  2YSG A;  2XP3 A;  1NWU A;  4R0X A;  2DT3 A;  1ROT A;  2OFN A;  4ML4 A;  4WKH A;  1ZU8 A;  2A3C A;  4HAR A;  3TC5 A;  1R9H A;  2PV3 A;  1VF8 A;  1Y0O A;  4P8U A;  4QZV B;  4DRP A;  4ZPW R;  2DSW A;  4WIW A;  2P4V A;  2DT1 A;  1D7I A;  1W9U A;  1W9P A;  1EQ3 A;  3KAH A;  4C02 B;  4ZPT R;  3IKG A;  4DH0 A;  3ARW A;  3UI4 A;  2MNT A;  2LGO A;  1D6O A;  2DT0 A;  2PBC A;  4S3K A;  1FKG A;  4R5E A;  2ZQT A;  4HBE A;  2E45 A;  1LL4 A;  3O5Q A;  2KFW A;  2YBU A;  3OA5 A;  5GPR A;  1X6L A;  2RUQ A;  3LKX B;  4P8V A;  5CQ2 A;  1FFQ A;  1KFW A;  2YSI A;  2FDM A;  2UZ5 A;  5E5W A;  3PA7 A;  4MPK A;  2DSU A;  5HBF A;  1FKR A;  1EG3 A;  2ITK A;  1FKS A;  2ESC A;  4GIV A;  1FKT A;  2LJ4 A;  4TNS A;  1FJD A;  2RUR A;  2B31 A;  2DG4 A;  2M08 A;  1JCH B;  1EIB A;  2JX8 A;  1HKI A;  1F40 A;  1PIN A;  4ODO A;  4O2T A;  4P8X A;  4DZ3 A;  2G8Z A;  3MQH A;  5HT1 A;  3O5L A;  4TW7 A;  1JND A;  1O6I A;  4DWS B;  1LJY A;  5U47 A;  1Q1C A;  2BA1 A;  2L2S A;  1W1V A;  1E9L A;  1FAP A;  3ART A;  3NRK A;  1WR7 A;  2RUD A;  1W1T A;  3ARY A;  2JXW A;  3PRA A;  1D7J A;  2FKE A;  2JZV A;  3ARO A;  4Z2I A;  2Y78 A;  2ZR6 A;  2WAD A;  4LAX A;  1E6Z A;  3CNG A;  2F21 A;  3B9D A;  1SR0 A;  2XP8 A;  4ODM A;  1H0I A;  2ZAJ A;  4NSB A;  1L1P A;  2DJY A;  1NSG A;  1W9V A;  2MDI A;  5DIV A;  1NWS A;  2WK2 A;  4ODL A;  3FSB A;  2XP7 A;  2A3A A;  2DPE A;  2RUC A;  4QT3 A;  4DRK A;  1GRJ A;  2WLZ A;  1I5H W;  3WD0 A;  1H0G A;  2EZ5 W;  2ZQS A;  2AOS A;  4WKF A;  3O5E A;  1HJW A;  4JFK A;  3MCB B;  1FKB A;  3L4H A;  1T11 A;  2XPB A;  3ARV A;  1ZBW A;  3AQU A;  1M5Y A;  4IQC A;  4ZPV R;  1FKJ A;  3KZ7 A;  4DRH A;  2A3B A;  3WD3 A;  2PI6 A;  4J4O A;  2YAJ B;  3EIP A;  1ITX A;  4Z2G A;  5HUA A;  1LL6 A;  3ARP A;  1EHN A;  1PBK A;  3QOK A;  4DWS C;  3RM4 A;  4NNR A;  2LKN A;  3WL0 A;  2OLH A;  2DMV A;  5HWC A;  3MDY B;  4N19 A;  1E6N A;  4BF8 A;  4TX0 A;  4DT4 A;  2OWO A;  2G41 A;  3VAW A;  1WNO A;  4W9P A;  4DZ2 A;  4LAV A;  3IK8 A;  4LAW A;  5B8I C;  3JYM A;  1ZBC A;  3IKD A;  2DT2 A;  1C9H A;  1W26 A;  3AS1 A;  1TK7 A;  1B6C A;  1HXV A;  1JVW A;  1ZK6 A;  3AS2 A;  4IT6 A;  3KAC A;  1KT1 A;  2ZR4 A;  2ETN A;  4DRN A;  2O9O A;  2QF8 A;  3O5R A;  4QIB A;  3BMB A;  3LUO A;  3O5F A;  3UI5 A;  1TCO C;  1JNT A;  2KO7 A;  2PPO A;  1BKF A;  3G6L A;  1TR8 A;  1OWQ A;  1U79 A;  1HJV A;  4Z2K A;  5DIT A;  1WB0 A;  4DRM A;  3O5K A;  3ARR A;  1FLC A;  3CZ8 A;  4MAV A;  4DWS D;  1NMV A;  3B8S A;  4NZC A;  2PPP A;  4W9O A;  5DO2 A;  4WJX A;  1OGB A;  4P8W A;  2D9F A;  2N87 A;  4TW6 A;  4JYS A;  3TCZ A;  2ZQU A;  4ODN A;  3RME A;  3CH9 A;  1A7X A;  3TDB A;  5HW6 A;  1ZBK A;  5E65 A;  4U84 A;  3JYJ A;  5HW8 A;  3ARZ A;  3W4R A;  5E62 A;  5HWB A;  3RGC A;  4U86 A;  5DF0 A;  2QRV A;  3CHC A;  2MLZ A;  3AS0 A;  2PN0 A;  2ZQV A;  2DWV A;  4U85 A;  1EG4 A;  4JFL A;  4IPX A;  1GUV A;  1KT0 A;  2DSV A;  3GPK A;  2K8I A;  4LAY A;  2DK7 A;  3WQW A;  1WMV A;  3FXY A;  4KQZ A;  3ARS A;  4FN2 A;  1EYM A;  3CHE A;  3LE4 A;  1GPF A;  5GPG A;  3KAG A;  3LKX A;  4MSP A;  3WQV A;  2LPV A;  1K9T A;  1HKM A;  2YBT A;  3FS8 A;  2MLX A;  1JNE A;  5GQB A;  1E15 A;  1YAT A;  4DWS A;  4KR0 B;  3WD1 A;  4MTV A;  1SYT A;  4ITZ A;  4Q22 A;  2MF9 A;  1F8A B;  3KAD A;  3ALG A;  2PV1 A;  4WKA A;  3OOB A;  3ALF A;  1Q6U A;  1P5Q A;  2L4J A;  2MLY A; 
#chains in the Genus database with same CATH homology
 2M8I A;  4ODQ A;  3CGM A;  3O5J A;  4REX A;  2Q5A A;  2XP9 A;  3WH0 A;  4GLX A;  2LAJ A;  2RQS A;  5AHT A;  5JH8 A;  5HW7 A;  2RSE A;  1JMQ A;  3I6C A;  2WLY A;  2IUZ A;  1ZCN A;  2DG3 A;  3ARQ A;  3UQI A;  1FKF A;  3B7X A;  2WM0 A;  3KAB A;  1FKH A;  4MNL A;  3O5G A;  4PTM A;  1FKI A;  3NI6 A;  2F2D A;  2YSB A;  1IX5 A;  1NWT A;  3FAP A;  4QT2 A;  3PRD A;  5DEZ A;  4S3J A;  4AY1 A;  4G2P A;  1J4I A;  3RM9 A;  2M2A A;  1OGG A;  3UQB A;  2M8J A;  4URI A;  3B9A A;  3WIJ A;  3H9R B;  2WAE A;  1J6Y A;  1LQ0 A;  4ODP A;  5HTG A;  4WK9 A;  3M7N A;  3O5O A;  3WKZ A;  3CHF A;  4IQ2 A;  1X6N A;  2KXQ A;  1E6P A;  4FAP A;  4Z2J A;  4L3N A;  2AWG A;  2VN1 A;  3WL1 A;  1BL4 A;  5D75 A;  4JFM A;  2KR7 A;  4ODR A;  1Q6I A;  4J4N A;  1RD6 A;  3JXV A;  4GGQ A;  4JFI A;  4ZS6 A;  4Z2L A;  1K9R A;  2PPN A;  4Q7N A;  5DIU A;  5E66 A;  4ODK A;  1FKL A;  3UQA A;  2DSZ A;  1XRV A;  1FD9 A;  2JV4 A;  1QPF A;  1NWR A;  1O6W A;  3FSC A;  3WD4 A;  3KAI A;  2IF4 A;  4LGX A;  4E5R A;  1LL7 A;  3UF8 A;  3IHZ A;  3PR9 A;  3PRB A;  1W1P A;  3O5D A;  1D2K A;  2PV2 A;  4MNK A;  1TFV A;  4MNM A;  1EDQ A;  4DRI A;  3ARU A;  3BXW A;  1HKJ A;  2RE3 A;  4XAK A;  2ZR5 A;  3AS3 A;  3CHD A;  4JFJ A;  2XP6 A;  2VCD A;  1CTN A;  4MGV A;  1FFR A;  2M1I A;  1UR8 A;  4TYO A;  3M85 A;  5BXJ A;  2JMF A;  3RM8 A;  4DRO A;  3MCB A;  2KGJ A;  1UR9 A;  5I98 A;  4IT4 A;  1JNS A;  4DRQ A;  3MQG A;  1Q6H A;  3EY6 A;  1GOI A;  4A0T A;  1HJX A;  3RFW A;  1J4H A;  3O5I A;  5E64 A;  2DK1 A;  2FAP A;  3FY1 A;  1QPL A;  1N1A A;  3ODK A;  3G6M A;  1YW5 A;  4DIP A;  1NH6 A;  3PQH A;  2XP4 A;  1LG1 A;  1FKD A;  1NMW A;  1ZB5 A;  5J6E A;  3CGN A;  2YSH A;  1LG2 A;  3KCE A;  2Y8N B;  1J4R A;  1K9Q A;  1W1Y A;  4A0U A;  1QZ2 A;  1WAW A;  3WD2 A;  4Z2H A;  2M3O W;  2XPA A;  3ARX A;  2KE0 A;  1RP5 A;  1D7H A;  4W5U A;  1E6R A;  3UI6 A;  4DRJ A;  4W9Q A;  1HKK A;  2O92 A;  1ROU A;  4TW8 A;  3KAF A;  2F4E A;  1FKK A;  2DG9 A;  2A3E A;  5HKG A;  2YSF A;  2MPH A;  3O5P A;  3O5M A;  3NTP A;  4L72 B;  4MNJ A;  2XP5 A;  3B9E A;  1ZBV A;  4G50 A;  4HBO A;  2KI3 A;  1XHG A;  1ZL1 A;  2YSG A;  2XP3 A;  1NWU A;  4R0X A;  2DT3 A;  1ROT A;  2OFN A;  4ML4 A;  4WKH A;  1ZU8 A;  2A3C A;  4HAR A;  3TC5 A;  1R9H A;  2PV3 A;  1VF8 A;  1Y0O A;  4P8U A;  4QZV B;  4DRP A;  4ZPW R;  2DSW A;  4WIW A;  2DT1 A;  1D7I A;  1W9U A;  1W9P A;  1EQ3 A;  3KAH A;  4C02 B;  4ZPT R;  3IKG A;  4DH0 A;  3ARW A;  3UI4 A;  2MNT A;  2LGO A;  1D6O A;  2DT0 A;  2PBC A;  4S3K A;  1FKG A;  4R5E A;  2ZQT A;  4HBE A;  2E45 A;  1LL4 A;  3O5Q A;  2KFW A;  2YBU A;  3OA5 A;  5GPR A;  1X6L A;  2RUQ A;  3LKX B;  4P8V A;  5CQ2 A;  1FFQ A;  1KFW A;  2YSI A;  2FDM A;  2UZ5 A;  5E5W A;  3PA7 A;  4MPK A;  2DSU A;  5HBF A;  1FKR A;  1EG3 A;  2ITK A;  1FKS A;  2ESC A;  4GIV A;  1FKT A;  2LJ4 A;  4TNS A;  1FJD A;  2RUR A;  2B31 A;  2DG4 A;  2M08 A;  1EIB A;  2JX8 A;  1HKI A;  1F40 A;  1PIN A;  4ODO A;  4O2T A;  4P8X A;  4DZ3 A;  2G8Z A;  3MQH A;  5HT1 A;  3O5L A;  4TW7 A;  1JND A;  1O6I A;  4DWS B;  1LJY A;  5U47 A;  1Q1C A;  2BA1 A;  2L2S A;  1W1V A;  1E9L A;  1FAP A;  3ART A;  3NRK A;  1WR7 A;  2RUD A;  1W1T A;  3ARY A;  2JXW A;  3PRA A;  1D7J A;  2FKE A;  2JZV A;  3ARO A;  4Z2I A;  2Y78 A;  2ZR6 A;  2WAD A;  4LAX A;  1E6Z A;  3CNG A;  2F21 A;  3B9D A;  1SR0 A;  2XP8 A;  4ODM A;  1H0I A;  2ZAJ A;  4NSB A;  1L1P A;  2DJY A;  1NSG A;  1W9V A;  2MDI A;  5DIV A;  1NWS A;  2WK2 A;  4ODL A;  3FSB A;  2XP7 A;  2A3A A;  2DPE A;  2RUC A;  4QT3 A;  4DRK A;  2WLZ A;  1I5H W;  3WD0 A;  1H0G A;  2EZ5 W;  2ZQS A;  2AOS A;  4WKF A;  3O5E A;  1HJW A;  4JFK A;  3MCB B;  1FKB A;  3L4H A;  1T11 A;  2XPB A;  3ARV A;  1ZBW A;  3AQU A;  1M5Y A;  4IQC A;  4ZPV R;  1FKJ A;  3KZ7 A;  4DRH A;  2A3B A;  3WD3 A;  2PI6 A;  4J4O A;  2YAJ B;  1ITX A;  4Z2G A;  5HUA A;  1LL6 A;  3ARP A;  1EHN A;  1PBK A;  3QOK A;  4DWS C;  3RM4 A;  4NNR A;  2LKN A;  3WL0 A;  2OLH A;  2DMV A;  5HWC A;  3MDY B;  4N19 A;  1E6N A;  4BF8 A;  4TX0 A;  4DT4 A;  2OWO A;  2G41 A;  3VAW A;  1WNO A;  4W9P A;  4DZ2 A;  4LAV A;  3IK8 A;  4LAW A;  5B8I C;  3JYM A;  1ZBC A;  3IKD A;  2DT2 A;  1C9H A;  1W26 A;  3AS1 A;  1TK7 A;  1B6C A;  1HXV A;  1JVW A;  1ZK6 A;  3AS2 A;  4IT6 A;  3KAC A;  1KT1 A;  2ZR4 A;  4DRN A;  2O9O A;  2QF8 A;  3O5R A;  4QIB A;  3LUO A;  3O5F A;  3UI5 A;  1TCO C;  1JNT A;  2KO7 A;  2PPO A;  1BKF A;  3G6L A;  1TR8 A;  1OWQ A;  1U79 A;  1HJV A;  4Z2K A;  5DIT A;  1WB0 A;  4DRM A;  3O5K A;  3ARR A;  1FLC A;  3CZ8 A;  4MAV A;  4DWS D;  1NMV A;  3B8S A;  4NZC A;  2PPP A;  4W9O A;  5DO2 A;  4WJX A;  1OGB A;  4P8W A;  2D9F A;  2N87 A;  4TW6 A;  4JYS A;  3TCZ A;  2ZQU A;  4ODN A;  3RME A;  3CH9 A;  1A7X A;  3TDB A;  5HW6 A;  1ZBK A;  5E65 A;  4U84 A;  3JYJ A;  5HW8 A;  3ARZ A;  3W4R A;  5E62 A;  5HWB A;  3RGC A;  4U86 A;  5DF0 A;  2QRV A;  3CHC A;  2MLZ A;  3AS0 A;  2ZQV A;  2DWV A;  4U85 A;  1EG4 A;  4JFL A;  4IPX A;  1GUV A;  1KT0 A;  2DSV A;  3GPK A;  2K8I A;  4LAY A;  2DK7 A;  3WQW A;  1WMV A;  3FXY A;  4KQZ A;  3ARS A;  4FN2 A;  1EYM A;  3CHE A;  3LE4 A;  1GPF A;  5GPG A;  3KAG A;  3LKX A;  4MSP A;  3WQV A;  2LPV A;  1K9T A;  1HKM A;  2YBT A;  3FS8 A;  2MLX A;  1JNE A;  5GQB A;  1E15 A;  1YAT A;  4DWS A;  4KR0 B;  3WD1 A;  4MTV A;  1SYT A;  4ITZ A;  4Q22 A;  2MF9 A;  1F8A B;  3KAD A;  3ALG A;  2PV1 A;  4WKA A;  3OOB A;  3ALF A;  1Q6U A;  1P5Q A;  2L4J A;  2MLY A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...