1YW5A

Peptidyl-prolyl isomerase ess1 from candida albicans
Total Genus 55
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
55
sequence length
177
structure length
177
Chain Sequence
MASTSTGLPPNWTIRVSRSHNKEYFLNQSTNESSWDPPYGTDKEVLNAYIAKFKNNGYKPLVNEDGQVRVSHLLIKNNQSRKPKSWKSPDGISRTRDESIQILKKHLERILSGEVKLSELANTESDCSSHDRGGDLGFFSKGQMQPPFEEAAFNLHVGEVSNIIETNSGVHILQRTG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The Structure of the Candida albicans Ess1 Prolyl Isomerase Reveals a Well-Ordered Linker that Restricts Domain Mobility
pubmed doi rcsb
source organism Candida albicans
molecule tags Isomerase
molecule keywords peptidyl prolyl cis/trans isomerase
total genus 55
structure length 177
sequence length 177
ec nomenclature ec 5.2.1.8: Peptidylprolyl isomerase.
pdb deposition date 2005-02-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00397 WW WW domain
A PF00639 Rotamase PPIC-type PPIASE domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.20.70.10 Mainly Beta Single Sheet Ubiquitin Ligase Nedd4; Chain: W; Ubiquitin Ligase Nedd4; Chain: W; 1yw5A01
3.10.50.40 Alpha Beta Roll Chitinase A; domain 3 Chitinase A; domain 3 1yw5A02
2DG9A 1YW5A 3ODKA 1FKTA 2AWGA 2DG3A 2RQSA 2JX8A 2VCDA 3LUOA 3KCEA 4LAWA 4MSPA 2LKNA 2M2AA 4TW7A 5HWBA 1FKFA 2M1IA 2L4JA 3RFWA 3RGCA 3MDYB 1TK7A 1EYMA 3O5OA 3M7NA 3FAPA 3PRDA 1PBKA 4JFLA 5HTGA 1HXVA 3TDBA 4J4OA 2MF9A 2FKEA 1BL4A 2PBCA 2MDIA 3O5MA 3VAWA 2XPAA 3IKGA 4G50A 2FAPA 3UI6A 1NMVA 4W9QA 3CGNA 3JYMA 2PV3A 4DT4A 1F8AB 2F2DA 4FN2A 3JXVA 4DRJA 2PPPA 5DITA 4DRHA 3IHZA 2YSIA 1FD9A 1QZ2A 2XP9A 3KAFA 5CQ2A 1KT0A 1Q6UA 1YATA 3TC5A 2DG4A 2L2SA 3I6CA 1D7HA 1C9HA 2RSEA 3O5DA 4LAVA 5HUAA 4IQCA 1KT1A 1O6WA 4ODPA 4TW8A 3KADA 1FKSA 1R9HA 2MNTA 2XP3A 1D7JA 2KFWA 1Q6IA 2KI3A 2IF4A 3KAIA 2MLXA 4MGVA 2M8JA 4ODQA 2ZR6A 3IK8A 4W9PA 2ZQUA 4LAXA 4FAPA 2KE0A 1FKHA 4ODKA 1L1PA 4ODMA 2KO7A 3L4HA 3B7XA 1ZCNA 3LE4A 3UF8A 1BKFA 2PPOA 5D75A 1WMVA 4DRMA 4DZ3A 2ITKA 2YSBA 1N1AA 2N87A 4JYSA 5GPGA 4TYOA 3KACA 1Y0OA 1FKLA 1K9QA 1ROTA 1B6CA 2RE3A 3IKDA 3OOBA 2PV1A 3O5KA 3O5FA 5DIVA 2LJ4A 4JFMA 4R0XA 3KABA 3UQIA 1JMQA 2Q5AA 4DROA 1FKJA 4QT2A 2E45A 1J4HA 4U84A 3TCZA 3O5RA 2ZQSA 1FKBA 2MPHA 5HW8A 2M08A 5AHTA 1EG3A 5HW7A 1J6YA 1EQ3A 3PA7A 2DMVA 3NI6A 1QPLA 3UQAA 1D7IA 2ZQTA 3GPKA 2ZQVA 2YSFA 2RUCA 2JXWA 2YSHA 3O5QA 2MLZA 3KAHA 4JFJA 4TX0A 3H9RB 2DWVA 3CNGA 4DRKA 4G2PA 5J6EA 1PINA 2DJYA 2F21A 3KAGA 2OFNA 2XP6A 5I98A 4DRIA 3KZ7A 1U79A 2LAJA 3NRKA 3JYJA 3PRBA 2ZR4A 2M8IA 4TW6A 2KGJA 1FAPA 2XP5A 2XP4A 4QIBA 4GGQA 4O2TA 2XPBA 4ODOA 1JVWA 4J4NA 2UZ5A 3O5EA 1W26A 2JMFA 2D9FA 3O5JA 3O5PA 2XP8A 4DIPA 4DZ2A 4DRQA 1FKIA 1TCOC 1I5HW 1ROUA 5HW6A 4ODNA 4REXA 4W9OA 1JNSA 5HKGA 2RUDA 4JFKA 2KXQA 1FKDA 2KR7A 3CGMA 2ZAJA 4ODRA 5BXJA 1JNTA 4U85A 3WH0A 3UQBA 2DK7A 1J4RA 1D6OA 2Y78A 1P5QA 2RUQA 4DRPA 1FJDA 1ZK6A 4TNSA 2M3OW 2LGOA 4LAYA 3UI5A 2LPVA 3UI4A 3O5GA 1FKKA 3O5IA 3M85A 2RURA 1FKRA 1WR7A 2K8IA 4IQ2A 1FKGA 1M5YA 2YSGA 2BA1A 4E5RA 1Q6HA 2ZR5A 2F4EA 2VN1A 4N19A 5B8IC 4BF8A 5HT1A 4QT3A 1A7XA 3EY6A 2EZ5W 4C02B 4ITZA 5DIUA 1QPFA 4GIVA 4IPXA 1NMWA 4ODLA 4JFIA 4NNRA 4DRNA 2DK1A 1Q1CA 5HWCA 1EG4A 1F40A 2XP7A 3NTPA 4U86A 1NSGA 2PV2A 1J4IA 2JV4A 1T11A 2MLYA 2JZVA 1K9RA 2PPNA 3O5LA 4DH0A
chains in the Genus database with same CATH superfamily
2EULA 1FKTA 3RGCA 4TW7A 5E62A 1LQ0A 3RMEA 1FKFA 3RFWA 1W1TA 1D2KA 3O5OA 1EYMA 2P4VA 3PRDA 4ZPWR 5HTGA 1RD6A 3O5MA 3VAWA 2XPAA 1EHNA 2FAPA 5E65A 2F2DA 4FN2A 5GQBA 2PPPA 5DITA 1LL7A 4Q22A 1W1PA 1QZ2A 3KAFA 2RSEA 2F23A 4KQZA 4ODPA 3MCBB 2DT3A 1Q6IA 2MLXA 4MGVA 4ODQA 2M8JA 3IK8A 2MLYA 4LAXA 3WD2A 1TFVA 4WKFA 1GPFA 1L1PA 2KO7A 1HJXA 1EDQA 1SR0A 1OWQA 5D75A 4DZ3A 3AQUA 5GPGA 5DF0A 1K9TA 1E15A 1FKLA 1K9QA 3O5KA 3OOBA 3ARSA 4MTVA 2B5UB 5JH8A 4DROA 4QT2A 2WM0A 4U84A 3TCZA 1ITXA 2DT2A 2MPHA 2QRVA 3NI6A 1D7IA 2WLZA 2ZQVA 2RUCA 2JXWA 3OA5A 2MLZA 3LKXA 3FXYA 2DSVA 3GTYX 1FFRA 2A3EA 2DJYA 2F21A 3KAGA 3AS2A 3KZ7A 3NRKA 3JYJA 2XP5A 2XP4A 1FFQA 1O6IA 2DSUA 1W1YA 3O5JA 1TCOC 1I5HW 5DO2A 4ODNA 4REXA 4W9OA 1KFWA 1JNSA 2Y8NB 2ZAJA 1JNTA 2DK7A 1D6OA 2IUZA 4TNSA 2LGOA 4WJXA 4ML4A 3O5GA 1FKKA 1SYTA 2RURA 1FKRA 1M5YA 2BA1A 4N19A 1WAWA 5HT1A 1HJVA 1LG2A 3EY6A 3FS8A 4ITZA 4ODLA 3ALFA 1Q1CA 2DT0A 4LGXA 1EG4A 3FSBA 2XP7A 2DG3A 4LAWA 2AWGA 3WD1A 3KCEA 5HWBA 2M1IA 3MDYB 4JFLA 3LKXB 3TDBA 4J4OA 4A0UA 1BL4A 2PBCA 1XHGA 2WLYA 4P8WA 3IKGA 4G50A 4Z2HA 1NMVA 3CGNA 1E6ZA 3JYMA 1X6LA 1F8AB 3IHZA 2WADA 2YSIA 4WIWA 2XP9A 4L3NA 1CTNA 1D7HA 5HUAA 4UDMA 1O6WA 4AY1A 2DSWA 1NWRA 4URIA 1IX5A 3KADA 1OGGA 3KAIA 1JCHB 4ODMA 3ARQA 3LE4A 3UF8A 3BXWA 4Z2IA 1WMVA 1W1VA 2YSBA 2N87A 1LG1A 4HBEA 1B6CA 2PV1A 4P8VA 4R0XA 3UQIA 2A3CA 2Q5AA 1E6PA 2ZQSA 1FKBA 5HW8A 4Q7NA 1W9VA 4W5UA 1EQ3A 3PA7A 2DMVA 3UQAA 3GPKA 4WK9A 4ZS6A 4Z2JA 4S3JA 4DRKA 4JFJA 3H9RB 2DWVA 3CNGA 4DWSC 5J6EA 4R5EA 3WD0A 3PRBA 3AROA 1NWUA 4O2TA 5HBFA 4MNMA 1ZBWA 1RP5A 2XP8A 3CH9A 4DZ2A 4DRQA 1UR9A 4JFKA 2KXQA 1FKDA 2KR7A 1HKMA 5BXJA 1FLCA 3WH0A 3UQBA 1J4RA 1H0GA 1ZK6A 2YBTA 4IT6A 1E9LA 3O5IA 1LJYA 4IQ2A 4WKHA 3CHEA 1FKGA 2VN1A 5B8IC 3AS3A 4BF8A 4QT3A 1A7XA 4GLXA 2DPEA 3ARYA 4C02B 4HARA 2DK1A 4U86A 1NSGA 5HKGA 1T11A 2KFWA 2DG9A 1YW5A 3ODKA 2VCDA 3LUOA 2YBUA 1GOIA 2LKNA 2M2AA 2L4JA 4Z2GA 3M7NA 1ZBKA 3ARXA 2MF9A 2FKEA 2MDIA 2WAEA 1TR8A 2PN0A 3WL1A 4DRHA 2OLHA 1JNEA 2L2SA 3TC5A 3I6CA 1C9HA 4LAVA 2FDMA 4IQCA 1KT1A 4NZCA 5E5WA 1FKSA 1R9HA 3O5LA 2XP3A 1D7JA 3UI6A 5HW7A 2KI3A 2IF4A 3WD4A 2G8ZA 2ZR6A 4W9PA 2ZQUA 3CHFA 4FAPA 3B8SA 1FKHA 4ODKA 3L4HA 3BMBA 2ITKA 1N1AA 3G6LA 2AOSA 3ALGA 3KACA 1Y0OA 3O5FA 2RE3A 4KR0B 2PI6A 2LJ4A 4JFMA 1NWSA 1ZU8A 4MNLA 1HKJA 3O5RA 1XRVA 2M08A 3PRAA 4S3KA 1J6YA 3CHDA 5E66A 1HKIA 1LL6A 3AS1A 2YSFA 2YSHA 3O5QA 4HBOA 3KAHA 4TX0A 3WQVA 4WKAA 1GRJA 4G2PA 4NSBA 1PINA 3WQWA 2OFNA 5I98A 3EIPA 3WIJA 2LAJA 2DT1A 2DSZA 4TW6A 4GGQA 4ODOA 2XPBA 1JVWA 4J4NA 1E44A 1W9UA 2D9FA 4DIPA 3O5PA 1FKIA 1ROUA 3ARTA 2WK2A 1EIBA 4ODRA 3FY1A 4U85A 2YAJB 1HJWA 4DRPA 1P5QA 3ARWA 4A0TA 2B31A 3M85A 1WR7A 2K8IA 3WKZA 1Q6HA 1E6RA 1NWTA 1ZBCA 2A3BA 3ARZA 2G41A 4IPXA 1HXVA 1NMWA 4P8XA 4JFIA 4DRNA 1F40A 2PV2A 4DRIA 2JZVA 4QZVB 3PQHA 3UI4A 4DH0A 4MNKA 2RQSA 2JX8A 4MSPA 1UR8A 5E64A 3QOKA 1VF8A 1TK7A 3FAPA 1PBKA 1ZBVA 3W4RA 4DWSB 1OGBA 4Z2LA 4W9QA 2PV3A 4DT4A 3B9EA 3JXVA 4DRJA 3FSCA 4DWSD 1NH6A 3MQHA 1FD9A 5CQ2A 1KT0A 1Q6UA 1YATA 2DG4A 3O5DA 4IT4A 3GU0A 3ARRA 4TW8A 2MNTA 4ZPTR 4MAVA 2QF8A 4PTMA 2KE0A 4L72B 3B7XA 1ZCNA 3B9DA 1HKKA 1BKFA 2PPOA 4DRMA 2O92A 1E6NA 4JYSA 4XAKA 4TYOA 2ETNA 1ROTA 3MCBA 3IKDA 5DIVA 3RM4A 3RM8A 3KABA 1JMQA 1FKJA 2E45A 1J4HA 2A3AA 5AHTA 1EG3A 3ARVA 3AS0A 1ZB5A 4P8UA 4MPKA 1QPLA 1GUVA 2ZQTA 3PR9A 3RM9A 1LL4A 1H0IA 2ESCA 2XP6A 1U79A 2ZR4A 2M8IA 1JNDA 2KGJA 1FAPA 4QIBA 3ARPA 3ARUA 3O5EA 1W26A 2JMFA 3CHCA 5HW6A 1WNOA 2RUDA 3WD3A 3CGMA 5GPRA 2O9OA 1FJDA 2Y78A 5U47A 2RUQA 4MNJA 4DWSA 2M3OW 4LAYA 1W9PA 3UI5A 2LPVA 2OWOA 2YSGA 4E5RA 1ZL1A 3CZ8A 4ZPVR 2ZR5A 2F4EA 1WB0A 3G6MA 2EZ5W 5DEZA 5DIUA 1QPFA 4GIVA 4NNRA 5HWCA 1X6NA 3B9AA 3MQGA 3NTPA 1J4IA 2JV4A 2PPNA 2UZ5A 3WL0A 1K9RA 4Z2KA
chains in the Genus database with same CATH topology
1FKTA 3RGCA 4TW7A 5E62A 1LQ0A 3RMEA 1FKFA 3RFWA 1W1TA 1D2KA 3O5OA 1EYMA 3PRDA 4ZPWR 5HTGA 1RD6A 3O5MA 3VAWA 2XPAA 1EHNA 2FAPA 5E65A 2F2DA 4FN2A 5GQBA 2PPPA 5DITA 1LL7A 4Q22A 1W1PA 1QZ2A 3KAFA 2RSEA 4KQZA 4ODPA 3MCBB 2DT3A 1Q6IA 2MLXA 4MGVA 4ODQA 2M8JA 3IK8A 2MLYA 4LAXA 3WD2A 1TFVA 4WKFA 1GPFA 1L1PA 2KO7A 1HJXA 1EDQA 1SR0A 1OWQA 5D75A 4DZ3A 3AQUA 5GPGA 5DF0A 1K9TA 1E15A 1FKLA 1K9QA 3O5KA 3OOBA 3ARSA 4MTVA 5JH8A 4DROA 4QT2A 2WM0A 4U84A 3TCZA 1ITXA 2DT2A 2MPHA 2QRVA 3NI6A 1D7IA 2WLZA 2ZQVA 2RUCA 2JXWA 3OA5A 2MLZA 3LKXA 3FXYA 2DSVA 1FFRA 2A3EA 2DJYA 2F21A 3KAGA 3AS2A 3KZ7A 3NRKA 3JYJA 2XP5A 2XP4A 1FFQA 1O6IA 2DSUA 1W1YA 3O5JA 1TCOC 1I5HW 5DO2A 4ODNA 4REXA 4W9OA 1KFWA 1JNSA 2Y8NB 2ZAJA 1JNTA 2DK7A 1D6OA 2IUZA 4TNSA 2LGOA 4WJXA 4ML4A 3O5GA 1FKKA 1SYTA 2RURA 1FKRA 1M5YA 2BA1A 4N19A 1WAWA 5HT1A 1HJVA 1LG2A 3EY6A 3FS8A 4ITZA 4ODLA 3ALFA 1Q1CA 2DT0A 4LGXA 1EG4A 3FSBA 2XP7A 2DG3A 4LAWA 2AWGA 3WD1A 3KCEA 5HWBA 2M1IA 3MDYB 4JFLA 3LKXB 3TDBA 4J4OA 4A0UA 1BL4A 2PBCA 1XHGA 2WLYA 4P8WA 3IKGA 4G50A 4Z2HA 1NMVA 3CGNA 1E6ZA 3JYMA 1X6LA 1F8AB 3IHZA 2WADA 2YSIA 4WIWA 2XP9A 4L3NA 1CTNA 1D7HA 5HUAA 1O6WA 4AY1A 2DSWA 1NWRA 4URIA 1IX5A 3KADA 1OGGA 3KAIA 4ODMA 3ARQA 3LE4A 3UF8A 3BXWA 4Z2IA 1WMVA 1W1VA 2YSBA 2N87A 1LG1A 4HBEA 1B6CA 2PV1A 4P8VA 4R0XA 3UQIA 2A3CA 2Q5AA 1E6PA 2ZQSA 1FKBA 5HW8A 4Q7NA 1W9VA 4W5UA 1EQ3A 3PA7A 2DMVA 3UQAA 3GPKA 4WK9A 4ZS6A 4Z2JA 4S3JA 4DRKA 4JFJA 3H9RB 2DWVA 3CNGA 4DWSC 5J6EA 4R5EA 3WD0A 3PRBA 3AROA 1NWUA 4O2TA 5HBFA 4MNMA 1ZBWA 1RP5A 2XP8A 3CH9A 4DZ2A 4DRQA 1UR9A 4JFKA 2KXQA 1FKDA 2KR7A 1HKMA 5BXJA 1FLCA 3WH0A 3UQBA 1J4RA 1H0GA 1ZK6A 2YBTA 4IT6A 1E9LA 3O5IA 1LJYA 4IQ2A 4WKHA 3CHEA 1FKGA 2VN1A 5B8IC 3AS3A 4BF8A 4QT3A 1A7XA 4GLXA 2DPEA 3ARYA 4C02B 4HARA 2DK1A 4U86A 1NSGA 5HKGA 1T11A 2KFWA 2DG9A 1YW5A 3ODKA 2VCDA 3LUOA 2YBUA 1GOIA 2LKNA 2M2AA 2L4JA 4Z2GA 3M7NA 1ZBKA 3ARXA 2MF9A 2FKEA 2MDIA 2WAEA 1TR8A 3WL1A 4DRHA 2OLHA 1JNEA 2L2SA 3TC5A 3I6CA 1C9HA 4LAVA 2FDMA 4IQCA 1KT1A 4NZCA 5E5WA 1FKSA 1R9HA 3O5LA 2XP3A 1D7JA 3UI6A 5HW7A 2KI3A 2IF4A 3WD4A 2G8ZA 2ZR6A 4W9PA 2ZQUA 3CHFA 4FAPA 3B8SA 1FKHA 4ODKA 3L4HA 2ITKA 1N1AA 3G6LA 2AOSA 3ALGA 3KACA 1Y0OA 3O5FA 2RE3A 4KR0B 2PI6A 2LJ4A 4JFMA 1NWSA 1ZU8A 4MNLA 1HKJA 3O5RA 1XRVA 2M08A 3PRAA 4S3KA 1J6YA 3CHDA 5E66A 1HKIA 1LL6A 3AS1A 2YSFA 2YSHA 3O5QA 4HBOA 3KAHA 4TX0A 3WQVA 4WKAA 4G2PA 4NSBA 1PINA 3WQWA 2OFNA 5I98A 3WIJA 2LAJA 2DT1A 2DSZA 4TW6A 4GGQA 4ODOA 2XPBA 1JVWA 4J4NA 1W9UA 2D9FA 4DIPA 3O5PA 1FKIA 1ROUA 3ARTA 2WK2A 1EIBA 4ODRA 3FY1A 4U85A 2YAJB 1HJWA 4DRPA 1P5QA 3ARWA 4A0TA 2B31A 3M85A 1WR7A 2K8IA 3WKZA 1Q6HA 1E6RA 1NWTA 1ZBCA 2A3BA 3ARZA 2G41A 4IPXA 1HXVA 1NMWA 4P8XA 4JFIA 4DRNA 1F40A 2PV2A 4DRIA 2JZVA 4QZVB 3PQHA 3UI4A 4DH0A 4MNKA 2RQSA 2JX8A 4MSPA 1UR8A 5E64A 3QOKA 1VF8A 1TK7A 3FAPA 1PBKA 1ZBVA 3W4RA 4DWSB 1OGBA 4Z2LA 4W9QA 2PV3A 4DT4A 3B9EA 3JXVA 4DRJA 3FSCA 4DWSD 1NH6A 3MQHA 1FD9A 5CQ2A 1KT0A 1Q6UA 1YATA 2DG4A 3O5DA 4IT4A 3ARRA 4TW8A 2MNTA 4ZPTR 4MAVA 2QF8A 4PTMA 2KE0A 4L72B 3B7XA 1ZCNA 3B9DA 1HKKA 1BKFA 2PPOA 4DRMA 2O92A 1E6NA 4JYSA 4XAKA 4TYOA 1ROTA 3MCBA 3IKDA 5DIVA 3RM4A 3RM8A 3KABA 1JMQA 1FKJA 2E45A 1J4HA 2A3AA 5AHTA 1EG3A 3ARVA 3AS0A 1ZB5A 4P8UA 4MPKA 1QPLA 1GUVA 2ZQTA 3PR9A 3RM9A 1LL4A 1H0IA 2ESCA 2XP6A 1U79A 2ZR4A 2M8IA 1JNDA 2KGJA 1FAPA 4QIBA 3ARPA 3ARUA 3O5EA 1W26A 2JMFA 3CHCA 5HW6A 1WNOA 2RUDA 3WD3A 3CGMA 5GPRA 2O9OA 1FJDA 2Y78A 5U47A 2RUQA 4MNJA 4DWSA 2M3OW 4LAYA 1W9PA 3UI5A 2LPVA 2OWOA 2YSGA 4E5RA 1ZL1A 3CZ8A 4ZPVR 2ZR5A 2F4EA 1WB0A 3G6MA 2EZ5W 5DEZA 5DIUA 1QPFA 4GIVA 4NNRA 5HWCA 1X6NA 3B9AA 3MQGA 3NTPA 1J4IA 2JV4A 2PPNA 2UZ5A 3WL0A 1K9RA 4Z2KA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2DG9 A;  1YW5 A;  3ODK A;  1FKT A;  2AWG A;  2DG3 A;  2RQS A;  2JX8 A;  2VCD A;  3LUO A;  3KCE A;  4LAW A;  4MSP A;  2LKN A;  2M2A A;  4TW7 A;  5HWB A;  1FKF A;  2M1I A;  2L4J A;  3RFW A;  3RGC A;  3MDY B;  1TK7 A;  1EYM A;  3O5O A;  3M7N A;  3FAP A;  3PRD A;  1PBK A;  4JFL A;  5HTG A;  1HXV A;  3TDB A;  4J4O A;  2MF9 A;  2FKE A;  1BL4 A;  2PBC A;  2MDI A;  3O5M A;  3VAW A;  2XPA A;  3IKG A;  4G50 A;  2FAP A;  3UI6 A;  1NMV A;  4W9Q A;  3CGN A;  3JYM A;  2PV3 A;  4DT4 A;  1F8A B;  2F2D A;  4FN2 A;  3JXV A;  4DRJ A;  2PPP A;  5DIT A;  4DRH A;  3IHZ A;  2YSI A;  1FD9 A;  1QZ2 A;  2XP9 A;  3KAF A;  5CQ2 A;  1KT0 A;  1Q6U A;  1YAT A;  3TC5 A;  2DG4 A;  2L2S A;  3I6C A;  1D7H A;  1C9H A;  2RSE A;  3O5D A;  4LAV A;  5HUA A;  4IQC A;  1KT1 A;  1O6W A;  4ODP A;  4TW8 A;  3KAD A;  1FKS A;  1R9H A;  2MNT A;  2XP3 A;  1D7J A;  2KFW A;  1Q6I A;  2KI3 A;  2IF4 A;  3KAI A;  2MLX A;  4MGV A;  2M8J A;  4ODQ A;  2ZR6 A;  3IK8 A;  4W9P A;  2ZQU A;  4LAX A;  4FAP A;  2KE0 A;  1FKH A;  4ODK A;  1L1P A;  4ODM A;  2KO7 A;  3L4H A;  3B7X A;  1ZCN A;  3LE4 A;  3UF8 A;  1BKF A;  2PPO A;  5D75 A;  1WMV A;  4DRM A;  4DZ3 A;  2ITK A;  2YSB A;  1N1A A;  2N87 A;  4JYS A;  5GPG A;  4TYO A;  3KAC A;  1Y0O A;  1FKL A;  1K9Q A;  1ROT A;  1B6C A;  2RE3 A;  3IKD A;  3OOB A;  2PV1 A;  3O5K A;  3O5F A;  5DIV A;  2LJ4 A;  4JFM A;  4R0X A;  3KAB A;  3UQI A;  1JMQ A;  2Q5A A;  4DRO A;  1FKJ A;  4QT2 A;  2E45 A;  1J4H A;  4U84 A;  3TCZ A;  3O5R A;  2ZQS A;  1FKB A;  2MPH A;  5HW8 A;  2M08 A;  5AHT A;  1EG3 A;  5HW7 A;  1J6Y A;  1EQ3 A;  3PA7 A;  2DMV A;  3NI6 A;  1QPL A;  3UQA A;  1D7I A;  2ZQT A;  3GPK A;  2ZQV A;  2YSF A;  2RUC A;  2JXW A;  2YSH A;  3O5Q A;  2MLZ A;  3KAH A;  4JFJ A;  4TX0 A;  3H9R B;  2DWV A;  3CNG A;  4DRK A;  4G2P A;  5J6E A;  1PIN A;  2DJY A;  2F21 A;  3KAG A;  2OFN A;  2XP6 A;  5I98 A;  4DRI A;  3KZ7 A;  1U79 A;  2LAJ A;  3NRK A;  3JYJ A;  3PRB A;  2ZR4 A;  2M8I A;  4TW6 A;  2KGJ A;  1FAP A;  2XP5 A;  2XP4 A;  4QIB A;  4GGQ A;  4O2T A;  2XPB A;  4ODO A;  1JVW A;  4J4N A;  2UZ5 A;  3O5E A;  1W26 A;  2JMF A;  2D9F A;  3O5J A;  3O5P A;  2XP8 A;  4DIP A;  4DZ2 A;  4DRQ A;  1FKI A;  1TCO C;  1I5H W;  1ROU A;  5HW6 A;  4ODN A;  4REX A;  4W9O A;  1JNS A;  5HKG A;  2RUD A;  4JFK A;  2KXQ A;  1FKD A;  2KR7 A;  3CGM A;  2ZAJ A;  4ODR A;  5BXJ A;  1JNT A;  4U85 A;  3WH0 A;  3UQB A;  2DK7 A;  1J4R A;  1D6O A;  2Y78 A;  1P5Q A;  2RUQ A;  4DRP A;  1FJD A;  1ZK6 A;  4TNS A;  2M3O W;  2LGO A;  4LAY A;  3UI5 A;  2LPV A;  3UI4 A;  3O5G A;  1FKK A;  3O5I A;  3M85 A;  2RUR A;  1FKR A;  1WR7 A;  2K8I A;  4IQ2 A;  1FKG A;  1M5Y A;  2YSG A;  2BA1 A;  4E5R A;  1Q6H A;  2ZR5 A;  2F4E A;  2VN1 A;  4N19 A;  5B8I C;  4BF8 A;  5HT1 A;  4QT3 A;  1A7X A;  3EY6 A;  2EZ5 W;  4C02 B;  4ITZ A;  5DIU A;  1QPF A;  4GIV A;  4IPX A;  1NMW A;  4ODL A;  4JFI A;  4NNR A;  4DRN A;  2DK1 A;  1Q1C A;  5HWC A;  1EG4 A;  1F40 A;  2XP7 A;  3NTP A;  4U86 A;  1NSG A;  2PV2 A;  1J4I A;  2JV4 A;  1T11 A;  2MLY A;  2JZV A;  1K9R A;  2PPN A;  3O5L A;  4DH0 A; 
#chains in the Genus database with same CATH topology
 2EUL A;  1FKT A;  3RGC A;  4TW7 A;  5E62 A;  1LQ0 A;  3RME A;  1FKF A;  3RFW A;  1W1T A;  1D2K A;  3O5O A;  1EYM A;  2P4V A;  3PRD A;  4ZPW R;  5HTG A;  1RD6 A;  3O5M A;  3VAW A;  2XPA A;  1EHN A;  2FAP A;  5E65 A;  2F2D A;  4FN2 A;  5GQB A;  2PPP A;  5DIT A;  1LL7 A;  4Q22 A;  1W1P A;  1QZ2 A;  3KAF A;  2RSE A;  2F23 A;  4KQZ A;  4ODP A;  3MCB B;  2DT3 A;  1Q6I A;  2MLX A;  4MGV A;  4ODQ A;  2M8J A;  3IK8 A;  2MLY A;  4LAX A;  3WD2 A;  1TFV A;  4WKF A;  1GPF A;  1L1P A;  2KO7 A;  1HJX A;  1EDQ A;  1SR0 A;  1OWQ A;  5D75 A;  4DZ3 A;  3AQU A;  5GPG A;  5DF0 A;  1K9T A;  1E15 A;  1FKL A;  1K9Q A;  3O5K A;  3OOB A;  3ARS A;  4MTV A;  2B5U B;  5JH8 A;  4DRO A;  4QT2 A;  2WM0 A;  4U84 A;  3TCZ A;  1ITX A;  2DT2 A;  2MPH A;  2QRV A;  3NI6 A;  1D7I A;  2WLZ A;  2ZQV A;  2RUC A;  2JXW A;  3OA5 A;  2MLZ A;  3LKX A;  3FXY A;  2DSV A;  3GTY X;  1FFR A;  2A3E A;  2DJY A;  2F21 A;  3KAG A;  3AS2 A;  3KZ7 A;  3NRK A;  3JYJ A;  2XP5 A;  2XP4 A;  1FFQ A;  1O6I A;  2DSU A;  1W1Y A;  3O5J A;  1TCO C;  1I5H W;  5DO2 A;  4ODN A;  4REX A;  4W9O A;  1KFW A;  1JNS A;  2Y8N B;  2ZAJ A;  1JNT A;  2DK7 A;  1D6O A;  2IUZ A;  4TNS A;  2LGO A;  4WJX A;  4ML4 A;  3O5G A;  1FKK A;  1SYT A;  2RUR A;  1FKR A;  1M5Y A;  2BA1 A;  4N19 A;  1WAW A;  5HT1 A;  1HJV A;  1LG2 A;  3EY6 A;  3FS8 A;  4ITZ A;  4ODL A;  3ALF A;  1Q1C A;  2DT0 A;  4LGX A;  1EG4 A;  3FSB A;  2XP7 A;  2DG3 A;  4LAW A;  2AWG A;  3WD1 A;  3KCE A;  5HWB A;  2M1I A;  3MDY B;  4JFL A;  3LKX B;  3TDB A;  4J4O A;  4A0U A;  1BL4 A;  2PBC A;  1XHG A;  2WLY A;  4P8W A;  3IKG A;  4G50 A;  4Z2H A;  1NMV A;  3CGN A;  1E6Z A;  3JYM A;  1X6L A;  1F8A B;  3IHZ A;  2WAD A;  2YSI A;  4WIW A;  2XP9 A;  4L3N A;  1CTN A;  1D7H A;  5HUA A;  4UDM A;  1O6W A;  4AY1 A;  2DSW A;  1NWR A;  4URI A;  1IX5 A;  3KAD A;  1OGG A;  3KAI A;  1JCH B;  4ODM A;  3ARQ A;  3LE4 A;  3UF8 A;  3BXW A;  4Z2I A;  1WMV A;  1W1V A;  2YSB A;  2N87 A;  1LG1 A;  4HBE A;  1B6C A;  2PV1 A;  4P8V A;  4R0X A;  3UQI A;  2A3C A;  2Q5A A;  1E6P A;  2ZQS A;  1FKB A;  5HW8 A;  4Q7N A;  1W9V A;  4W5U A;  1EQ3 A;  3PA7 A;  2DMV A;  3UQA A;  3GPK A;  4WK9 A;  4ZS6 A;  4Z2J A;  4S3J A;  4DRK A;  4JFJ A;  3H9R B;  2DWV A;  3CNG A;  4DWS C;  5J6E A;  4R5E A;  3WD0 A;  3PRB A;  3ARO A;  1NWU A;  4O2T A;  5HBF A;  4MNM A;  1ZBW A;  1RP5 A;  2XP8 A;  3CH9 A;  4DZ2 A;  4DRQ A;  1UR9 A;  4JFK A;  2KXQ A;  1FKD A;  2KR7 A;  1HKM A;  5BXJ A;  1FLC A;  3WH0 A;  3UQB A;  1J4R A;  1H0G A;  1ZK6 A;  2YBT A;  4IT6 A;  1E9L A;  3O5I A;  1LJY A;  4IQ2 A;  4WKH A;  3CHE A;  1FKG A;  2VN1 A;  5B8I C;  3AS3 A;  4BF8 A;  4QT3 A;  1A7X A;  4GLX A;  2DPE A;  3ARY A;  4C02 B;  4HAR A;  2DK1 A;  4U86 A;  1NSG A;  5HKG A;  1T11 A;  2KFW A;  2DG9 A;  1YW5 A;  3ODK A;  2VCD A;  3LUO A;  2YBU A;  1GOI A;  2LKN A;  2M2A A;  2L4J A;  4Z2G A;  3M7N A;  1ZBK A;  3ARX A;  2MF9 A;  2FKE A;  2MDI A;  2WAE A;  1TR8 A;  2PN0 A;  3WL1 A;  4DRH A;  2OLH A;  1JNE A;  2L2S A;  3TC5 A;  3I6C A;  1C9H A;  4LAV A;  2FDM A;  4IQC A;  1KT1 A;  4NZC A;  5E5W A;  1FKS A;  1R9H A;  3O5L A;  2XP3 A;  1D7J A;  3UI6 A;  5HW7 A;  2KI3 A;  2IF4 A;  3WD4 A;  2G8Z A;  2ZR6 A;  4W9P A;  2ZQU A;  3CHF A;  4FAP A;  3B8S A;  1FKH A;  4ODK A;  3L4H A;  3BMB A;  2ITK A;  1N1A A;  3G6L A;  2AOS A;  3ALG A;  3KAC A;  1Y0O A;  3O5F A;  2RE3 A;  4KR0 B;  2PI6 A;  2LJ4 A;  4JFM A;  1NWS A;  1ZU8 A;  4MNL A;  1HKJ A;  3O5R A;  1XRV A;  2M08 A;  3PRA A;  4S3K A;  1J6Y A;  3CHD A;  5E66 A;  1HKI A;  1LL6 A;  3AS1 A;  2YSF A;  2YSH A;  3O5Q A;  4HBO A;  3KAH A;  4TX0 A;  3WQV A;  4WKA A;  1GRJ A;  4G2P A;  4NSB A;  1PIN A;  3WQW A;  2OFN A;  5I98 A;  3EIP A;  3WIJ A;  2LAJ A;  2DT1 A;  2DSZ A;  4TW6 A;  4GGQ A;  4ODO A;  2XPB A;  1JVW A;  4J4N A;  1E44 A;  1W9U A;  2D9F A;  4DIP A;  3O5P A;  1FKI A;  1ROU A;  3ART A;  2WK2 A;  1EIB A;  4ODR A;  3FY1 A;  4U85 A;  2YAJ B;  1HJW A;  4DRP A;  1P5Q A;  3ARW A;  4A0T A;  2B31 A;  3M85 A;  1WR7 A;  2K8I A;  3WKZ A;  1Q6H A;  1E6R A;  1NWT A;  1ZBC A;  2A3B A;  3ARZ A;  2G41 A;  4IPX A;  1HXV A;  1NMW A;  4P8X A;  4JFI A;  4DRN A;  1F40 A;  2PV2 A;  4DRI A;  2JZV A;  4QZV B;  3PQH A;  3UI4 A;  4DH0 A;  4MNK A;  2RQS A;  2JX8 A;  4MSP A;  1UR8 A;  5E64 A;  3QOK A;  1VF8 A;  1TK7 A;  3FAP A;  1PBK A;  1ZBV A;  3W4R A;  4DWS B;  1OGB A;  4Z2L A;  4W9Q A;  2PV3 A;  4DT4 A;  3B9E A;  3JXV A;  4DRJ A;  3FSC A;  4DWS D;  1NH6 A;  3MQH A;  1FD9 A;  5CQ2 A;  1KT0 A;  1Q6U A;  1YAT A;  2DG4 A;  3O5D A;  4IT4 A;  3GU0 A;  3ARR A;  4TW8 A;  2MNT A;  4ZPT R;  4MAV A;  2QF8 A;  4PTM A;  2KE0 A;  4L72 B;  3B7X A;  1ZCN A;  3B9D A;  1HKK A;  1BKF A;  2PPO A;  4DRM A;  2O92 A;  1E6N A;  4JYS A;  4XAK A;  4TYO A;  2ETN A;  1ROT A;  3MCB A;  3IKD A;  5DIV A;  3RM4 A;  3RM8 A;  3KAB A;  1JMQ A;  1FKJ A;  2E45 A;  1J4H A;  2A3A A;  5AHT A;  1EG3 A;  3ARV A;  3AS0 A;  1ZB5 A;  4P8U A;  4MPK A;  1QPL A;  1GUV A;  2ZQT A;  3PR9 A;  3RM9 A;  1LL4 A;  1H0I A;  2ESC A;  2XP6 A;  1U79 A;  2ZR4 A;  2M8I A;  1JND A;  2KGJ A;  1FAP A;  4QIB A;  3ARP A;  3ARU A;  3O5E A;  1W26 A;  2JMF A;  3CHC A;  5HW6 A;  1WNO A;  2RUD A;  3WD3 A;  3CGM A;  5GPR A;  2O9O A;  1FJD A;  2Y78 A;  5U47 A;  2RUQ A;  4MNJ A;  4DWS A;  2M3O W;  4LAY A;  1W9P A;  3UI5 A;  2LPV A;  2OWO A;  2YSG A;  4E5R A;  1ZL1 A;  3CZ8 A;  4ZPV R;  2ZR5 A;  2F4E A;  1WB0 A;  3G6M A;  2EZ5 W;  5DEZ A;  5DIU A;  1QPF A;  4GIV A;  4NNR A;  5HWC A;  1X6N A;  3B9A A;  3MQG A;  3NTP A;  1J4I A;  2JV4 A;  2PPN A;  2UZ5 A;  3WL0 A;  1K9R A;  4Z2K A; 
#chains in the Genus database with same CATH homology
 1FKT A;  3RGC A;  4TW7 A;  5E62 A;  1LQ0 A;  3RME A;  1FKF A;  3RFW A;  1W1T A;  1D2K A;  3O5O A;  1EYM A;  3PRD A;  4ZPW R;  5HTG A;  1RD6 A;  3O5M A;  3VAW A;  2XPA A;  1EHN A;  2FAP A;  5E65 A;  2F2D A;  4FN2 A;  5GQB A;  2PPP A;  5DIT A;  1LL7 A;  4Q22 A;  1W1P A;  1QZ2 A;  3KAF A;  2RSE A;  4KQZ A;  4ODP A;  3MCB B;  2DT3 A;  1Q6I A;  2MLX A;  4MGV A;  4ODQ A;  2M8J A;  3IK8 A;  2MLY A;  4LAX A;  3WD2 A;  1TFV A;  4WKF A;  1GPF A;  1L1P A;  2KO7 A;  1HJX A;  1EDQ A;  1SR0 A;  1OWQ A;  5D75 A;  4DZ3 A;  3AQU A;  5GPG A;  5DF0 A;  1K9T A;  1E15 A;  1FKL A;  1K9Q A;  3O5K A;  3OOB A;  3ARS A;  4MTV A;  5JH8 A;  4DRO A;  4QT2 A;  2WM0 A;  4U84 A;  3TCZ A;  1ITX A;  2DT2 A;  2MPH A;  2QRV A;  3NI6 A;  1D7I A;  2WLZ A;  2ZQV A;  2RUC A;  2JXW A;  3OA5 A;  2MLZ A;  3LKX A;  3FXY A;  2DSV A;  1FFR A;  2A3E A;  2DJY A;  2F21 A;  3KAG A;  3AS2 A;  3KZ7 A;  3NRK A;  3JYJ A;  2XP5 A;  2XP4 A;  1FFQ A;  1O6I A;  2DSU A;  1W1Y A;  3O5J A;  1TCO C;  1I5H W;  5DO2 A;  4ODN A;  4REX A;  4W9O A;  1KFW A;  1JNS A;  2Y8N B;  2ZAJ A;  1JNT A;  2DK7 A;  1D6O A;  2IUZ A;  4TNS A;  2LGO A;  4WJX A;  4ML4 A;  3O5G A;  1FKK A;  1SYT A;  2RUR A;  1FKR A;  1M5Y A;  2BA1 A;  4N19 A;  1WAW A;  5HT1 A;  1HJV A;  1LG2 A;  3EY6 A;  3FS8 A;  4ITZ A;  4ODL A;  3ALF A;  1Q1C A;  2DT0 A;  4LGX A;  1EG4 A;  3FSB A;  2XP7 A;  2DG3 A;  4LAW A;  2AWG A;  3WD1 A;  3KCE A;  5HWB A;  2M1I A;  3MDY B;  4JFL A;  3LKX B;  3TDB A;  4J4O A;  4A0U A;  1BL4 A;  2PBC A;  1XHG A;  2WLY A;  4P8W A;  3IKG A;  4G50 A;  4Z2H A;  1NMV A;  3CGN A;  1E6Z A;  3JYM A;  1X6L A;  1F8A B;  3IHZ A;  2WAD A;  2YSI A;  4WIW A;  2XP9 A;  4L3N A;  1CTN A;  1D7H A;  5HUA A;  1O6W A;  4AY1 A;  2DSW A;  1NWR A;  4URI A;  1IX5 A;  3KAD A;  1OGG A;  3KAI A;  4ODM A;  3ARQ A;  3LE4 A;  3UF8 A;  3BXW A;  4Z2I A;  1WMV A;  1W1V A;  2YSB A;  2N87 A;  1LG1 A;  4HBE A;  1B6C A;  2PV1 A;  4P8V A;  4R0X A;  3UQI A;  2A3C A;  2Q5A A;  1E6P A;  2ZQS A;  1FKB A;  5HW8 A;  4Q7N A;  1W9V A;  4W5U A;  1EQ3 A;  3PA7 A;  2DMV A;  3UQA A;  3GPK A;  4WK9 A;  4ZS6 A;  4Z2J A;  4S3J A;  4DRK A;  4JFJ A;  3H9R B;  2DWV A;  3CNG A;  4DWS C;  5J6E A;  4R5E A;  3WD0 A;  3PRB A;  3ARO A;  1NWU A;  4O2T A;  5HBF A;  4MNM A;  1ZBW A;  1RP5 A;  2XP8 A;  3CH9 A;  4DZ2 A;  4DRQ A;  1UR9 A;  4JFK A;  2KXQ A;  1FKD A;  2KR7 A;  1HKM A;  5BXJ A;  1FLC A;  3WH0 A;  3UQB A;  1J4R A;  1H0G A;  1ZK6 A;  2YBT A;  4IT6 A;  1E9L A;  3O5I A;  1LJY A;  4IQ2 A;  4WKH A;  3CHE A;  1FKG A;  2VN1 A;  5B8I C;  3AS3 A;  4BF8 A;  4QT3 A;  1A7X A;  4GLX A;  2DPE A;  3ARY A;  4C02 B;  4HAR A;  2DK1 A;  4U86 A;  1NSG A;  5HKG A;  1T11 A;  2KFW A;  2DG9 A;  1YW5 A;  3ODK A;  2VCD A;  3LUO A;  2YBU A;  1GOI A;  2LKN A;  2M2A A;  2L4J A;  4Z2G A;  3M7N A;  1ZBK A;  3ARX A;  2MF9 A;  2FKE A;  2MDI A;  2WAE A;  1TR8 A;  3WL1 A;  4DRH A;  2OLH A;  1JNE A;  2L2S A;  3TC5 A;  3I6C A;  1C9H A;  4LAV A;  2FDM A;  4IQC A;  1KT1 A;  4NZC A;  5E5W A;  1FKS A;  1R9H A;  3O5L A;  2XP3 A;  1D7J A;  3UI6 A;  5HW7 A;  2KI3 A;  2IF4 A;  3WD4 A;  2G8Z A;  2ZR6 A;  4W9P A;  2ZQU A;  3CHF A;  4FAP A;  3B8S A;  1FKH A;  4ODK A;  3L4H A;  2ITK A;  1N1A A;  3G6L A;  2AOS A;  3ALG A;  3KAC A;  1Y0O A;  3O5F A;  2RE3 A;  4KR0 B;  2PI6 A;  2LJ4 A;  4JFM A;  1NWS A;  1ZU8 A;  4MNL A;  1HKJ A;  3O5R A;  1XRV A;  2M08 A;  3PRA A;  4S3K A;  1J6Y A;  3CHD A;  5E66 A;  1HKI A;  1LL6 A;  3AS1 A;  2YSF A;  2YSH A;  3O5Q A;  4HBO A;  3KAH A;  4TX0 A;  3WQV A;  4WKA A;  4G2P A;  4NSB A;  1PIN A;  3WQW A;  2OFN A;  5I98 A;  3WIJ A;  2LAJ A;  2DT1 A;  2DSZ A;  4TW6 A;  4GGQ A;  4ODO A;  2XPB A;  1JVW A;  4J4N A;  1W9U A;  2D9F A;  4DIP A;  3O5P A;  1FKI A;  1ROU A;  3ART A;  2WK2 A;  1EIB A;  4ODR A;  3FY1 A;  4U85 A;  2YAJ B;  1HJW A;  4DRP A;  1P5Q A;  3ARW A;  4A0T A;  2B31 A;  3M85 A;  1WR7 A;  2K8I A;  3WKZ A;  1Q6H A;  1E6R A;  1NWT A;  1ZBC A;  2A3B A;  3ARZ A;  2G41 A;  4IPX A;  1HXV A;  1NMW A;  4P8X A;  4JFI A;  4DRN A;  1F40 A;  2PV2 A;  4DRI A;  2JZV A;  4QZV B;  3PQH A;  3UI4 A;  4DH0 A;  4MNK A;  2RQS A;  2JX8 A;  4MSP A;  1UR8 A;  5E64 A;  3QOK A;  1VF8 A;  1TK7 A;  3FAP A;  1PBK A;  1ZBV A;  3W4R A;  4DWS B;  1OGB A;  4Z2L A;  4W9Q A;  2PV3 A;  4DT4 A;  3B9E A;  3JXV A;  4DRJ A;  3FSC A;  4DWS D;  1NH6 A;  3MQH A;  1FD9 A;  5CQ2 A;  1KT0 A;  1Q6U A;  1YAT A;  2DG4 A;  3O5D A;  4IT4 A;  3ARR A;  4TW8 A;  2MNT A;  4ZPT R;  4MAV A;  2QF8 A;  4PTM A;  2KE0 A;  4L72 B;  3B7X A;  1ZCN A;  3B9D A;  1HKK A;  1BKF A;  2PPO A;  4DRM A;  2O92 A;  1E6N A;  4JYS A;  4XAK A;  4TYO A;  1ROT A;  3MCB A;  3IKD A;  5DIV A;  3RM4 A;  3RM8 A;  3KAB A;  1JMQ A;  1FKJ A;  2E45 A;  1J4H A;  2A3A A;  5AHT A;  1EG3 A;  3ARV A;  3AS0 A;  1ZB5 A;  4P8U A;  4MPK A;  1QPL A;  1GUV A;  2ZQT A;  3PR9 A;  3RM9 A;  1LL4 A;  1H0I A;  2ESC A;  2XP6 A;  1U79 A;  2ZR4 A;  2M8I A;  1JND A;  2KGJ A;  1FAP A;  4QIB A;  3ARP A;  3ARU A;  3O5E A;  1W26 A;  2JMF A;  3CHC A;  5HW6 A;  1WNO A;  2RUD A;  3WD3 A;  3CGM A;  5GPR A;  2O9O A;  1FJD A;  2Y78 A;  5U47 A;  2RUQ A;  4MNJ A;  4DWS A;  2M3O W;  4LAY A;  1W9P A;  3UI5 A;  2LPV A;  2OWO A;  2YSG A;  4E5R A;  1ZL1 A;  3CZ8 A;  4ZPV R;  2ZR5 A;  2F4E A;  1WB0 A;  3G6M A;  2EZ5 W;  5DEZ A;  5DIU A;  1QPF A;  4GIV A;  4NNR A;  5HWC A;  1X6N A;  3B9A A;  3MQG A;  3NTP A;  1J4I A;  2JV4 A;  2PPN A;  2UZ5 A;  3WL0 A;  1K9R A;  4Z2K A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...