4U84A

Human pin1 with s-hydroxyl-cysteine 113
Total Genus 45
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
45
sequence length
157
structure length
144
Chain Sequence
LPPGWEKAMSRSSGRVYYFNHITNASQWERPSEPARVRCSHLLVKHSQSRRPSSWRQEKITRTKEEALELINGYIQKIKSGEEDFESLASQFSDSSAKARGDLGAFSRGQMQKPFEDASFALRTGEMSGPVFTDSGIHIILRTE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Peptidyl-prolyl cis-trans isomerase NIMA-interacting 1
publication title Pin1 cysteine-113 oxidation inhibits its catalytic activity and cellular function in Alzheimer's disease.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Isomerase
total genus 45
structure length 144
sequence length 157
ec nomenclature ec 5.2.1.8: Peptidylprolyl isomerase.
pdb deposition date 2014-08-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00397 WW WW domain
A PF00639 Rotamase PPIC-type PPIASE domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.20.70.10 Mainly Beta Single Sheet Ubiquitin Ligase Nedd4; Chain: W; Ubiquitin Ligase Nedd4; Chain: W; 4u84A01
3.10.50.40 Alpha Beta Roll Chitinase A; domain 3 Chitinase A; domain 3 4u84A02
4J4OA 1O6WA 2JV4A 3TCZA 1J6YA 1L1PA 2N87A 2KR7A 3IHZA 2D9FA 2K8IA 1NMWA 4ODMA 2PV3A 4G50A 4DH0A 1QPFA 3UQAA 2PBCA 2UZ5A 4GGQA 1D7JA 3TC5A 2XP4A 3O5GA 4TYOA 2KXQA 4DRQA 2LKNA 2M2AA 2DG4A 3KAFA 4ODNA 4DIPA 2MLXA 1D6OA 3O5MA 2M8JA 1BKFA 1EG3A 4TW6A 3O5IA 3JYJA 4U84A 2DK1A 2AWGA 2ZQVA 2XP7A 2XPBA 1JVWA 2XP3A 2KI3A 5CQ2A 3KCEA 2L2SA 3FAPA 2YSIA 1BL4A 3O5PA 1NSGA 3O5FA 3M7NA 2JMFA 2KO7A 3IK8A 2MNTA 4O2TA 1PINA 4TW8A 2ZR5A 4C02B 4ODPA 3O5EA 4TNSA 4W9OA 2JZVA 3RGCA 4W9QA 1Y0OA 1U79A 1FKLA 1QPLA 2F2DA 3KACA 2E45A 3KAGA 1J4RA 4JYSA 3O5QA 2RUDA 5HW7A 1J4HA 2MPHA 4DRNA 2ZQSA 2M8IA 4QT3A 4IQ2A 3JXVA 3KAIA 3LUOA 1TCOC 2Y78A 3PRDA 1FAPA 2IF4A 4DRHA 5D75A 4FAPA 4DZ3A 1Q1CA 2LJ4A 1JMQA 2MDIA 2RQSA 1FKSA 3LE4A 2XP6A 2LPVA 2M3OW 5BXJA 4ODRA 4DROA 3OOBA 4DRKA 3UI5A 1T11A 1R9HA 4J4NA 1ZCNA 2KFWA 4GIVA 4QIBA 3UI6A 4REXA 4DT4A 1EQ3A 3IKDA 5HW8A 3KAHA 2RE3A 1Q6HA 2MLZA 2F21A 2MF9A 3I6CA 4JFKA 1WR7A 2LGOA 4JFIA 1FKIA 2ITKA 4ODOA 3RFWA 3L4HA 4FN2A 2DJYA 4TW7A 1FKRA 4DZ2A 2PV1A 3O5KA 4TX0A 1KT0A 1FKTA 3CGNA 3O5DA 4LAYA 3B7XA 4JFJA 5DITA 2YSFA 5HWBA 3NTPA 5DIVA 3WH0A 2KGJA 4ODKA 1TK7A 3KABA 2XP8A 4LAWA 3O5LA 4U86A 2F4EA 1Q6IA 1YW5A 5I98A 1FKKA 4MGVA 1D7IA 4ITZA 2RURA 3UQBA 1A7XA 4LAVA 2FKEA 3IKGA 1B6CA 3CGMA 2M1IA 3O5JA 1Q6UA 3NRKA 4DRPA 3NI6A 2DWVA 1F8AB 3UF8A 4BF8A 1K9RA 3EY6A 2YSBA 1W26A 1ZK6A 1FD9A 2Q5AA 2VCDA 1ROUA 1JNTA 3GPKA 4ODLA 1P5QA 1J4IA 3O5OA 5DIUA 1FKDA 1QZ2A 4U85A 3VAWA 2RUQA 2L4JA 1C9HA 3JYMA 4G2PA 1N1AA 4IQCA 1M5YA 2DG3A 1FKFA 2PPNA 2KE0A 2BA1A 5HWCA 2ZR6A 3KZ7A 2JXWA 4DRMA 5HW6A 1F40A 4W9PA 2DK7A 1WMVA 2LAJA 1NMVA 3KADA 2PPOA 3O5RA 2YSHA 2XP5A 2ZQTA 5HUAA 1YATA 4JFLA 1I5HW 2ZQUA 2PPPA 1FKGA 4DRIA 4N19A 5B8IC 5AHTA 4DRJA 3PRBA 4NNRA 4QT2A 2ZAJA 1FJDA 2RSEA 4R0XA 2DG9A 1EYMA 2XP9A 4JFMA 3CNGA 3ODKA 5HKGA 3UQIA 2PV2A 1JNSA 1D7HA 5HTGA 2EZ5W 3MDYB 2OFNA 2JX8A 2FAPA 5GPGA 2DMVA 2XPAA 1FKJA 3M85A 1FKHA 2VN1A 1K9QA 3H9RB 2MLYA 3PA7A 5HT1A 4LAXA 1FKBA 1EG4A 1PBKA 2ZR4A 1ROTA 2M08A 4E5RA 4MSPA 2YSGA 3TDBA 4ODQA 2RUCA 1HXVA 1KT1A 5J6EA 4IPXA 3UI4A
chains in the Genus database with same CATH superfamily
1UR8A 4J4OA 3LKXB 1O6WA 2JV4A 2WAEA 3TCZA 1J6YA 1E6NA 1L1PA 2N87A 2KR7A 3IHZA 3AS2A 4LGXA 2D9FA 2K8IA 1NMWA 4KQZA 4P8XA 4ODMA 2PV3A 1WAWA 4G50A 4DH0A 1QPFA 3UQAA 2PBCA 2UZ5A 4GGQA 1D2KA 4W5UA 1D7JA 3ALFA 3ARZA 3TC5A 2YBUA 2XP4A 3O5GA 4TYOA 2KXQA 4DRQA 2LKNA 3BMBA 2M2AA 5HBFA 2DG4A 4DWSB 3KAFA 1ZBCA 4ODNA 4DIPA 3WD4A 2MLXA 1JNDA 3ARPA 4WKAA 1JCHB 1D6OA 3O5MA 2M8JA 1BKFA 2DPEA 1EG3A 4TW6A 3O5IA 1NH6A 3JYJA 3RM8A 4U84A 2DK1A 2AWGA 2ZQVA 2XP7A 2XPBA 1JVWA 2XP3A 2YAJB 2F23A 3PQHA 2KI3A 5CQ2A 3KCEA 2L2SA 3FAPA 1W1PA 3GTYX 2YSIA 3WL0A 1ITXA 1BL4A 3ARYA 3O5PA 1NSGA 1W1VA 3O5FA 3M7NA 2PI6A 2JMFA 2WADA 2KO7A 2QRVA 3B8SA 3IK8A 4KR0B 4DWSC 1XRVA 2MNTA 4O2TA 3W4RA 1PINA 4TW8A 1GOIA 2ZR5A 4C02B 2OLHA 4ODPA 3O5EA 1SYTA 4TNSA 3MCBA 1FFRA 1X6LA 2JZVA 4W9OA 1W9PA 3RGCA 4W9QA 1Y0OA 1U79A 4IT6A 1FKLA 2G8ZA 1QPLA 1SR0A 4XAKA 5E5WA 2F2DA 1O6IA 2E45A 3KACA 2A3EA 3B9EA 3KAGA 1EIBA 3BXWA 1NWRA 1J4RA 1HJXA 4JYSA 3O5QA 1HJVA 2RUDA 4IT4A 5HW7A 4MNKA 1J4HA 1LG2A 2MPHA 4Z2HA 4DRNA 2ZQSA 2M8IA 1OWQA 1XHGA 2WM0A 1X6NA 4QT3A 4IQ2A 3ARUA 3JXVA 4L3NA 2IUZA 3KAIA 3LUOA 1TCOC 2A3BA 2Y78A 3WD3A 1W1YA 3B9AA 3PRDA 1E44A 1FAPA 2IF4A 4DRHA 5D75A 4FAPA 4DZ3A 1Q1CA 4MAVA 2LJ4A 2QF8A 1JMQA 5E65A 2MDIA 3AQUA 1HKJA 2RQSA 1FKSA 4A0UA 4DWSD 2A3AA 3WQWA 2FDMA 4Z2JA 3LE4A 2XP6A 3CH9A 2DSUA 2LPVA 3MCBB 1OGGA 3EIPA 4Z2KA 4ZPWR 4WKFA 2M3OW 5BXJA 4ODRA 4DROA 3OOBA 4DRKA 3UI5A 4NZCA 1T11A 3RM9A 1R9HA 4J4NA 1ZCNA 2DT1A 2KFWA 4GIVA 4A0TA 5GQBA 1NWSA 4QIBA 3UI6A 1IX5A 1LL4A 3CHCA 4S3KA 4REXA 4DT4A 2A3CA 1EQ3A 4Q22A 4R5EA 3IKDA 5HW8A 3KAHA 2RE3A 2WLYA 1ZBVA 1ZU8A 4HBEA 4MNMA 1Q6HA 3ARTA 2MLZA 2P4VA 2EULA 2F21A 2MF9A 3I6CA 3ALGA 4JFKA 1GPFA 3WIJA 1WR7A 2LGOA 3AS1A 4JFIA 1WNOA 3WQVA 1FKIA 2ITKA 2WK2A 2ESCA 4ODOA 3RFWA 1LL7A 1WB0A 3L4HA 4FN2A 2DJYA 4TW7A 1FKRA 4S3JA 1RP5A 5U47A 2PV1A 1E6ZA 4DZ2A 5JH8A 3RM4A 3CHFA 4QZVB 3O5KA 4TX0A 1KT0A 1FKTA 3CGNA 3ARXA 3O5DA 4LAYA 4ZPTR 3B7XA 4JFJA 5DITA 2YSFA 5HWBA 1LQ0A 3NTPA 3WD2A 1W9UA 5DO2A 5DIVA 3FXYA 5DEZA 1ZBKA 3WH0A 2KGJA 4ODKA 1TK7A 3KABA 2XP8A 4LAWA 3O5LA 2Y8NB 3G6MA 4U86A 2DT2A 2F4EA 1Q6IA 1TR8A 3ARRA 1YW5A 4WKHA 5I98A 1FKKA 4MGVA 3MQHA 1CTNA 3FY1A 4AY1A 1D7IA 1LJYA 2B5UB 4ITZA 3GU0A 1NWTA 2RURA 3UQBA 1A7XA 4LAVA 3RMEA 2DSWA 1KFWA 2FKEA 3IKGA 1B6CA 3CGMA 1UR9A 2M1IA 1GRJA 1Q6UA 2PN0A 3ARQA 3O5JA 1W1TA 3G6LA 3NRKA 3MQGA 4WJXA 4DRPA 3NI6A 2DWVA 3CHEA 5DF0A 1F8AB 1TFVA 3UF8A 4WIWA 4BF8A 1K9RA 3EY6A 2YSBA 1W26A 1ZK6A 1HKKA 1FD9A 2Q5AA 2VCDA 1ROUA 1JNTA 4Z2GA 3GPKA 1EHNA 4ODLA 1H0IA 1P5QA 1J4IA 3ARSA 4UDMA 3O5OA 5DIUA 2G41A 2AOSA 4NSBA 1FKDA 4WK9A 1QZ2A 2B31A 4U85A 2DSZA 2ETNA 3VAWA 5GPRA 2RUQA 2L4JA 1C9HA 3JYMA 4G2PA 4ZS6A 1N1AA 1EDQA 1H0GA 4IQCA 2DT3A 1M5YA 3FSBA 4Z2IA 2DG3A 3ARVA 1FKFA 2PPNA 2KE0A 2BA1A 1NWUA 4URIA 5HWCA 3B9DA 2ZR6A 3KZ7A 2DT0A 3ARWA 3OA5A 1ZL1A 2YBTA 3WD1A 2JXWA 4DRMA 2O92A 5HW6A 4Z2LA 1F40A 2OWOA 1JNEA 4W9PA 2DK7A 5E62A 1WMVA 2LAJA 1NMVA 3KADA 2PPOA 3O5RA 4L72B 2YSHA 2XP5A 2ZQTA 5HUAA 1HJWA 1VF8A 3QOKA 1YATA 1E6PA 2O9OA 4JFLA 4PTMA 3WD0A 1I5HW 2ZQUA 2PPPA 1FLCA 1FKGA 1LL6A 3PR9A 4DRIA 4N19A 3FSCA 5B8IC 4ZPVR 1LG1A 5AHTA 1ZBWA 4DRJA 3PRBA 4NNRA 4QT2A 1OGBA 2ZAJA 3AS0A 1FJDA 2RSEA 4P8UA 4R0XA 2DG9A 1EYMA 2XP9A 1GUVA 1RD6A 4JFMA 3CNGA 3ODKA 5HKGA 1E15A 3LKXA 4MTVA 4MNLA 3WL1A 1FFQA 3UQIA 2PV2A 4HARA 1JNSA 1D7HA 1HKMA 4ML4A 3WKZA 4GLXA 4MPKA 5HTGA 2EZ5W 3MDYB 2OFNA 3CHDA 2JX8A 1E9LA 4HBOA 2FAPA 4P8VA 5GPGA 4MNJA 2DMVA 1E6RA 5E64A 2XPAA 3AROA 1FKJA 2DSVA 3M85A 1FKHA 2VN1A 4Q7NA 1K9QA 3H9RB 2MLYA 3FS8A 3PA7A 1K9TA 4LAXA 1FKBA 5HT1A 1EG4A 2WLZA 1PBKA 2ZR4A 1ROTA 1W9VA 2M08A 4E5RA 4MSPA 2YSGA 4DWSA 5E66A 3TDBA 4ODQA 3CZ8A 2RUCA 1HKIA 1ZB5A 3PRAA 1HXVA 4P8WA 1KT1A 5J6EA 4IPXA 3UI4A 3AS3A
chains in the Genus database with same CATH topology
1UR8A 4J4OA 3LKXB 1O6WA 2JV4A 2WAEA 3TCZA 1J6YA 1E6NA 1L1PA 2N87A 2KR7A 3IHZA 3AS2A 4LGXA 2D9FA 2K8IA 1NMWA 4KQZA 4P8XA 4ODMA 2PV3A 1WAWA 4G50A 4DH0A 1QPFA 3UQAA 2PBCA 2UZ5A 4GGQA 1D2KA 4W5UA 1D7JA 3ALFA 3ARZA 3TC5A 2YBUA 2XP4A 3O5GA 4TYOA 2KXQA 4DRQA 2LKNA 2M2AA 5HBFA 2DG4A 4DWSB 3KAFA 1ZBCA 4ODNA 4DIPA 3WD4A 2MLXA 1JNDA 3ARPA 4WKAA 1D6OA 3O5MA 2M8JA 1BKFA 2DPEA 1EG3A 4TW6A 3O5IA 1NH6A 3JYJA 3RM8A 4U84A 2DK1A 2AWGA 2ZQVA 2XP7A 2XPBA 1JVWA 2XP3A 2YAJB 3PQHA 2KI3A 5CQ2A 3KCEA 2L2SA 3FAPA 1W1PA 2YSIA 3WL0A 1ITXA 1BL4A 3ARYA 3O5PA 1NSGA 1W1VA 3O5FA 3M7NA 2PI6A 2JMFA 2WADA 2KO7A 2QRVA 3B8SA 3IK8A 4KR0B 4DWSC 1XRVA 2MNTA 4O2TA 3W4RA 1PINA 4TW8A 1GOIA 2ZR5A 4C02B 2OLHA 4ODPA 3O5EA 1SYTA 4TNSA 3MCBA 1FFRA 1X6LA 2JZVA 4W9OA 1W9PA 3RGCA 4W9QA 1Y0OA 1U79A 4IT6A 1FKLA 2G8ZA 1QPLA 1SR0A 4XAKA 5E5WA 2F2DA 1O6IA 2E45A 3KACA 2A3EA 3B9EA 3KAGA 1EIBA 3BXWA 1NWRA 1J4RA 1HJXA 4JYSA 3O5QA 1HJVA 2RUDA 4IT4A 5HW7A 4MNKA 1J4HA 1LG2A 2MPHA 4Z2HA 4DRNA 2ZQSA 2M8IA 1OWQA 1XHGA 2WM0A 1X6NA 4QT3A 4IQ2A 3ARUA 3JXVA 4L3NA 2IUZA 3KAIA 3LUOA 1TCOC 2A3BA 2Y78A 3WD3A 1W1YA 3B9AA 3PRDA 1FAPA 2IF4A 4DRHA 5D75A 4FAPA 4DZ3A 1Q1CA 4MAVA 2LJ4A 2QF8A 1JMQA 5E65A 2MDIA 3AQUA 1HKJA 2RQSA 1FKSA 4A0UA 4DWSD 2A3AA 3WQWA 2FDMA 4Z2JA 3LE4A 2XP6A 3CH9A 2DSUA 2LPVA 3MCBB 1OGGA 4Z2KA 4ZPWR 4WKFA 2M3OW 5BXJA 4ODRA 4DROA 3OOBA 4DRKA 3UI5A 4NZCA 1T11A 3RM9A 1R9HA 4J4NA 1ZCNA 2DT1A 2KFWA 4GIVA 4A0TA 5GQBA 1NWSA 4QIBA 3UI6A 1IX5A 1LL4A 3CHCA 4S3KA 4REXA 4DT4A 2A3CA 1EQ3A 4Q22A 4R5EA 3IKDA 5HW8A 3KAHA 2RE3A 2WLYA 1ZBVA 1ZU8A 4HBEA 4MNMA 1Q6HA 3ARTA 2MLZA 2F21A 2MF9A 3I6CA 3ALGA 4JFKA 1GPFA 3WIJA 1WR7A 2LGOA 3AS1A 4JFIA 1WNOA 3WQVA 1FKIA 2ITKA 2WK2A 2ESCA 4ODOA 3RFWA 1LL7A 1WB0A 3L4HA 4FN2A 2DJYA 4TW7A 1FKRA 4S3JA 1RP5A 5U47A 2PV1A 1E6ZA 4DZ2A 5JH8A 3RM4A 3CHFA 4QZVB 3O5KA 4TX0A 1KT0A 1FKTA 3CGNA 3ARXA 3O5DA 4LAYA 4ZPTR 3B7XA 4JFJA 5DITA 2YSFA 5HWBA 1LQ0A 3NTPA 3WD2A 1W9UA 5DO2A 5DIVA 3FXYA 5DEZA 1ZBKA 3WH0A 2KGJA 4ODKA 1TK7A 3KABA 2XP8A 4LAWA 3O5LA 2Y8NB 3G6MA 4U86A 2DT2A 2F4EA 1Q6IA 1TR8A 3ARRA 1YW5A 4WKHA 5I98A 1FKKA 4MGVA 3MQHA 1CTNA 3FY1A 4AY1A 1D7IA 1LJYA 4ITZA 1NWTA 2RURA 3UQBA 1A7XA 4LAVA 3RMEA 2DSWA 1KFWA 2FKEA 3IKGA 1B6CA 3CGMA 1UR9A 2M1IA 3O5JA 1Q6UA 3ARQA 1W1TA 3G6LA 3NRKA 3MQGA 4WJXA 4DRPA 3NI6A 2DWVA 3CHEA 5DF0A 1F8AB 1TFVA 3UF8A 4WIWA 4BF8A 1K9RA 3EY6A 2YSBA 1W26A 1ZK6A 1HKKA 1FD9A 2Q5AA 2VCDA 1ROUA 1JNTA 4Z2GA 3GPKA 1EHNA 4ODLA 1H0IA 1P5QA 1J4IA 3ARSA 3O5OA 5DIUA 2G41A 2AOSA 4NSBA 1FKDA 4WK9A 1QZ2A 2B31A 4U85A 2DSZA 3VAWA 5GPRA 2RUQA 2L4JA 1C9HA 3JYMA 4G2PA 4ZS6A 1N1AA 1EDQA 1H0GA 4IQCA 2DT3A 1M5YA 3FSBA 4Z2IA 2DG3A 3ARVA 1FKFA 2PPNA 2KE0A 2BA1A 1NWUA 4URIA 5HWCA 3B9DA 2ZR6A 3KZ7A 2DT0A 3ARWA 3OA5A 1ZL1A 2YBTA 3WD1A 2JXWA 4DRMA 2O92A 5HW6A 4Z2LA 1F40A 2OWOA 1JNEA 4W9PA 2DK7A 5E62A 1WMVA 2LAJA 1NMVA 3KADA 2PPOA 3O5RA 4L72B 2YSHA 2XP5A 2ZQTA 5HUAA 1HJWA 1VF8A 3QOKA 1YATA 1E6PA 2O9OA 4JFLA 4PTMA 3WD0A 1I5HW 2ZQUA 2PPPA 1FLCA 1FKGA 1LL6A 3PR9A 4DRIA 4N19A 3FSCA 5B8IC 4ZPVR 1LG1A 5AHTA 1ZBWA 4DRJA 3PRBA 4NNRA 4QT2A 1OGBA 2ZAJA 3AS0A 1FJDA 2RSEA 4P8UA 4R0XA 2DG9A 1EYMA 2XP9A 1GUVA 1RD6A 4JFMA 3CNGA 3ODKA 5HKGA 1E15A 3LKXA 4MTVA 4MNLA 3WL1A 1FFQA 3UQIA 2PV2A 4HARA 1JNSA 1D7HA 1HKMA 4ML4A 3WKZA 4GLXA 4MPKA 5HTGA 2EZ5W 3MDYB 2OFNA 3CHDA 2JX8A 1E9LA 4HBOA 2FAPA 4P8VA 5GPGA 4MNJA 2DMVA 1E6RA 5E64A 2XPAA 3AROA 1FKJA 2DSVA 3M85A 1FKHA 2VN1A 4Q7NA 1K9QA 3H9RB 2MLYA 3FS8A 3PA7A 1K9TA 4LAXA 1FKBA 5HT1A 1EG4A 2WLZA 1PBKA 2ZR4A 1ROTA 1W9VA 2M08A 4E5RA 4MSPA 2YSGA 4DWSA 5E66A 3TDBA 4ODQA 3CZ8A 2RUCA 1HKIA 1ZB5A 3PRAA 1HXVA 4P8WA 1KT1A 5J6EA 4IPXA 3UI4A 3AS3A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4J4O A;  1O6W A;  2JV4 A;  3TCZ A;  1J6Y A;  1L1P A;  2N87 A;  2KR7 A;  3IHZ A;  2D9F A;  2K8I A;  1NMW A;  4ODM A;  2PV3 A;  4G50 A;  4DH0 A;  1QPF A;  3UQA A;  2PBC A;  2UZ5 A;  4GGQ A;  1D7J A;  3TC5 A;  2XP4 A;  3O5G A;  4TYO A;  2KXQ A;  4DRQ A;  2LKN A;  2M2A A;  2DG4 A;  3KAF A;  4ODN A;  4DIP A;  2MLX A;  1D6O A;  3O5M A;  2M8J A;  1BKF A;  1EG3 A;  4TW6 A;  3O5I A;  3JYJ A;  4U84 A;  2DK1 A;  2AWG A;  2ZQV A;  2XP7 A;  2XPB A;  1JVW A;  2XP3 A;  2KI3 A;  5CQ2 A;  3KCE A;  2L2S A;  3FAP A;  2YSI A;  1BL4 A;  3O5P A;  1NSG A;  3O5F A;  3M7N A;  2JMF A;  2KO7 A;  3IK8 A;  2MNT A;  4O2T A;  1PIN A;  4TW8 A;  2ZR5 A;  4C02 B;  4ODP A;  3O5E A;  4TNS A;  4W9O A;  2JZV A;  3RGC A;  4W9Q A;  1Y0O A;  1U79 A;  1FKL A;  1QPL A;  2F2D A;  3KAC A;  2E45 A;  3KAG A;  1J4R A;  4JYS A;  3O5Q A;  2RUD A;  5HW7 A;  1J4H A;  2MPH A;  4DRN A;  2ZQS A;  2M8I A;  4QT3 A;  4IQ2 A;  3JXV A;  3KAI A;  3LUO A;  1TCO C;  2Y78 A;  3PRD A;  1FAP A;  2IF4 A;  4DRH A;  5D75 A;  4FAP A;  4DZ3 A;  1Q1C A;  2LJ4 A;  1JMQ A;  2MDI A;  2RQS A;  1FKS A;  3LE4 A;  2XP6 A;  2LPV A;  2M3O W;  5BXJ A;  4ODR A;  4DRO A;  3OOB A;  4DRK A;  3UI5 A;  1T11 A;  1R9H A;  4J4N A;  1ZCN A;  2KFW A;  4GIV A;  4QIB A;  3UI6 A;  4REX A;  4DT4 A;  1EQ3 A;  3IKD A;  5HW8 A;  3KAH A;  2RE3 A;  1Q6H A;  2MLZ A;  2F21 A;  2MF9 A;  3I6C A;  4JFK A;  1WR7 A;  2LGO A;  4JFI A;  1FKI A;  2ITK A;  4ODO A;  3RFW A;  3L4H A;  4FN2 A;  2DJY A;  4TW7 A;  1FKR A;  4DZ2 A;  2PV1 A;  3O5K A;  4TX0 A;  1KT0 A;  1FKT A;  3CGN A;  3O5D A;  4LAY A;  3B7X A;  4JFJ A;  5DIT A;  2YSF A;  5HWB A;  3NTP A;  5DIV A;  3WH0 A;  2KGJ A;  4ODK A;  1TK7 A;  3KAB A;  2XP8 A;  4LAW A;  3O5L A;  4U86 A;  2F4E A;  1Q6I A;  1YW5 A;  5I98 A;  1FKK A;  4MGV A;  1D7I A;  4ITZ A;  2RUR A;  3UQB A;  1A7X A;  4LAV A;  2FKE A;  3IKG A;  1B6C A;  3CGM A;  2M1I A;  3O5J A;  1Q6U A;  3NRK A;  4DRP A;  3NI6 A;  2DWV A;  1F8A B;  3UF8 A;  4BF8 A;  1K9R A;  3EY6 A;  2YSB A;  1W26 A;  1ZK6 A;  1FD9 A;  2Q5A A;  2VCD A;  1ROU A;  1JNT A;  3GPK A;  4ODL A;  1P5Q A;  1J4I A;  3O5O A;  5DIU A;  1FKD A;  1QZ2 A;  4U85 A;  3VAW A;  2RUQ A;  2L4J A;  1C9H A;  3JYM A;  4G2P A;  1N1A A;  4IQC A;  1M5Y A;  2DG3 A;  1FKF A;  2PPN A;  2KE0 A;  2BA1 A;  5HWC A;  2ZR6 A;  3KZ7 A;  2JXW A;  4DRM A;  5HW6 A;  1F40 A;  4W9P A;  2DK7 A;  1WMV A;  2LAJ A;  1NMV A;  3KAD A;  2PPO A;  3O5R A;  2YSH A;  2XP5 A;  2ZQT A;  5HUA A;  1YAT A;  4JFL A;  1I5H W;  2ZQU A;  2PPP A;  1FKG A;  4DRI A;  4N19 A;  5B8I C;  5AHT A;  4DRJ A;  3PRB A;  4NNR A;  4QT2 A;  2ZAJ A;  1FJD A;  2RSE A;  4R0X A;  2DG9 A;  1EYM A;  2XP9 A;  4JFM A;  3CNG A;  3ODK A;  5HKG A;  3UQI A;  2PV2 A;  1JNS A;  1D7H A;  5HTG A;  2EZ5 W;  3MDY B;  2OFN A;  2JX8 A;  2FAP A;  5GPG A;  2DMV A;  2XPA A;  1FKJ A;  3M85 A;  1FKH A;  2VN1 A;  1K9Q A;  3H9R B;  2MLY A;  3PA7 A;  5HT1 A;  4LAX A;  1FKB A;  1EG4 A;  1PBK A;  2ZR4 A;  1ROT A;  2M08 A;  4E5R A;  4MSP A;  2YSG A;  3TDB A;  4ODQ A;  2RUC A;  1HXV A;  1KT1 A;  5J6E A;  4IPX A;  3UI4 A; 
#chains in the Genus database with same CATH topology
 1UR8 A;  4J4O A;  3LKX B;  1O6W A;  2JV4 A;  2WAE A;  3TCZ A;  1J6Y A;  1E6N A;  1L1P A;  2N87 A;  2KR7 A;  3IHZ A;  3AS2 A;  4LGX A;  2D9F A;  2K8I A;  1NMW A;  4KQZ A;  4P8X A;  4ODM A;  2PV3 A;  1WAW A;  4G50 A;  4DH0 A;  1QPF A;  3UQA A;  2PBC A;  2UZ5 A;  4GGQ A;  1D2K A;  4W5U A;  1D7J A;  3ALF A;  3ARZ A;  3TC5 A;  2YBU A;  2XP4 A;  3O5G A;  4TYO A;  2KXQ A;  4DRQ A;  2LKN A;  3BMB A;  2M2A A;  5HBF A;  2DG4 A;  4DWS B;  3KAF A;  1ZBC A;  4ODN A;  4DIP A;  3WD4 A;  2MLX A;  1JND A;  3ARP A;  4WKA A;  1JCH B;  1D6O A;  3O5M A;  2M8J A;  1BKF A;  2DPE A;  1EG3 A;  4TW6 A;  3O5I A;  1NH6 A;  3JYJ A;  3RM8 A;  4U84 A;  2DK1 A;  2AWG A;  2ZQV A;  2XP7 A;  2XPB A;  1JVW A;  2XP3 A;  2YAJ B;  2F23 A;  3PQH A;  2KI3 A;  5CQ2 A;  3KCE A;  2L2S A;  3FAP A;  1W1P A;  3GTY X;  2YSI A;  3WL0 A;  1ITX A;  1BL4 A;  3ARY A;  3O5P A;  1NSG A;  1W1V A;  3O5F A;  3M7N A;  2PI6 A;  2JMF A;  2WAD A;  2KO7 A;  2QRV A;  3B8S A;  3IK8 A;  4KR0 B;  4DWS C;  1XRV A;  2MNT A;  4O2T A;  3W4R A;  1PIN A;  4TW8 A;  1GOI A;  2ZR5 A;  4C02 B;  2OLH A;  4ODP A;  3O5E A;  1SYT A;  4TNS A;  3MCB A;  1FFR A;  1X6L A;  2JZV A;  4W9O A;  1W9P A;  3RGC A;  4W9Q A;  1Y0O A;  1U79 A;  4IT6 A;  1FKL A;  2G8Z A;  1QPL A;  1SR0 A;  4XAK A;  5E5W A;  2F2D A;  1O6I A;  2E45 A;  3KAC A;  2A3E A;  3B9E A;  3KAG A;  1EIB A;  3BXW A;  1NWR A;  1J4R A;  1HJX A;  4JYS A;  3O5Q A;  1HJV A;  2RUD A;  4IT4 A;  5HW7 A;  4MNK A;  1J4H A;  1LG2 A;  2MPH A;  4Z2H A;  4DRN A;  2ZQS A;  2M8I A;  1OWQ A;  1XHG A;  2WM0 A;  1X6N A;  4QT3 A;  4IQ2 A;  3ARU A;  3JXV A;  4L3N A;  2IUZ A;  3KAI A;  3LUO A;  1TCO C;  2A3B A;  2Y78 A;  3WD3 A;  1W1Y A;  3B9A A;  3PRD A;  1E44 A;  1FAP A;  2IF4 A;  4DRH A;  5D75 A;  4FAP A;  4DZ3 A;  1Q1C A;  4MAV A;  2LJ4 A;  2QF8 A;  1JMQ A;  5E65 A;  2MDI A;  3AQU A;  1HKJ A;  2RQS A;  1FKS A;  4A0U A;  4DWS D;  2A3A A;  3WQW A;  2FDM A;  4Z2J A;  3LE4 A;  2XP6 A;  3CH9 A;  2DSU A;  2LPV A;  3MCB B;  1OGG A;  3EIP A;  4Z2K A;  4ZPW R;  4WKF A;  2M3O W;  5BXJ A;  4ODR A;  4DRO A;  3OOB A;  4DRK A;  3UI5 A;  4NZC A;  1T11 A;  3RM9 A;  1R9H A;  4J4N A;  1ZCN A;  2DT1 A;  2KFW A;  4GIV A;  4A0T A;  5GQB A;  1NWS A;  4QIB A;  3UI6 A;  1IX5 A;  1LL4 A;  3CHC A;  4S3K A;  4REX A;  4DT4 A;  2A3C A;  1EQ3 A;  4Q22 A;  4R5E A;  3IKD A;  5HW8 A;  3KAH A;  2RE3 A;  2WLY A;  1ZBV A;  1ZU8 A;  4HBE A;  4MNM A;  1Q6H A;  3ART A;  2MLZ A;  2P4V A;  2EUL A;  2F21 A;  2MF9 A;  3I6C A;  3ALG A;  4JFK A;  1GPF A;  3WIJ A;  1WR7 A;  2LGO A;  3AS1 A;  4JFI A;  1WNO A;  3WQV A;  1FKI A;  2ITK A;  2WK2 A;  2ESC A;  4ODO A;  3RFW A;  1LL7 A;  1WB0 A;  3L4H A;  4FN2 A;  2DJY A;  4TW7 A;  1FKR A;  4S3J A;  1RP5 A;  5U47 A;  2PV1 A;  1E6Z A;  4DZ2 A;  5JH8 A;  3RM4 A;  3CHF A;  4QZV B;  3O5K A;  4TX0 A;  1KT0 A;  1FKT A;  3CGN A;  3ARX A;  3O5D A;  4LAY A;  4ZPT R;  3B7X A;  4JFJ A;  5DIT A;  2YSF A;  5HWB A;  1LQ0 A;  3NTP A;  3WD2 A;  1W9U A;  5DO2 A;  5DIV A;  3FXY A;  5DEZ A;  1ZBK A;  3WH0 A;  2KGJ A;  4ODK A;  1TK7 A;  3KAB A;  2XP8 A;  4LAW A;  3O5L A;  2Y8N B;  3G6M A;  4U86 A;  2DT2 A;  2F4E A;  1Q6I A;  1TR8 A;  3ARR A;  1YW5 A;  4WKH A;  5I98 A;  1FKK A;  4MGV A;  3MQH A;  1CTN A;  3FY1 A;  4AY1 A;  1D7I A;  1LJY A;  2B5U B;  4ITZ A;  3GU0 A;  1NWT A;  2RUR A;  3UQB A;  1A7X A;  4LAV A;  3RME A;  2DSW A;  1KFW A;  2FKE A;  3IKG A;  1B6C A;  3CGM A;  1UR9 A;  2M1I A;  1GRJ A;  1Q6U A;  2PN0 A;  3ARQ A;  3O5J A;  1W1T A;  3G6L A;  3NRK A;  3MQG A;  4WJX A;  4DRP A;  3NI6 A;  2DWV A;  3CHE A;  5DF0 A;  1F8A B;  1TFV A;  3UF8 A;  4WIW A;  4BF8 A;  1K9R A;  3EY6 A;  2YSB A;  1W26 A;  1ZK6 A;  1HKK A;  1FD9 A;  2Q5A A;  2VCD A;  1ROU A;  1JNT A;  4Z2G A;  3GPK A;  1EHN A;  4ODL A;  1H0I A;  1P5Q A;  1J4I A;  3ARS A;  4UDM A;  3O5O A;  5DIU A;  2G41 A;  2AOS A;  4NSB A;  1FKD A;  4WK9 A;  1QZ2 A;  2B31 A;  4U85 A;  2DSZ A;  2ETN A;  3VAW A;  5GPR A;  2RUQ A;  2L4J A;  1C9H A;  3JYM A;  4G2P A;  4ZS6 A;  1N1A A;  1EDQ A;  1H0G A;  4IQC A;  2DT3 A;  1M5Y A;  3FSB A;  4Z2I A;  2DG3 A;  3ARV A;  1FKF A;  2PPN A;  2KE0 A;  2BA1 A;  1NWU A;  4URI A;  5HWC A;  3B9D A;  2ZR6 A;  3KZ7 A;  2DT0 A;  3ARW A;  3OA5 A;  1ZL1 A;  2YBT A;  3WD1 A;  2JXW A;  4DRM A;  2O92 A;  5HW6 A;  4Z2L A;  1F40 A;  2OWO A;  1JNE A;  4W9P A;  2DK7 A;  5E62 A;  1WMV A;  2LAJ A;  1NMV A;  3KAD A;  2PPO A;  3O5R A;  4L72 B;  2YSH A;  2XP5 A;  2ZQT A;  5HUA A;  1HJW A;  1VF8 A;  3QOK A;  1YAT A;  1E6P A;  2O9O A;  4JFL A;  4PTM A;  3WD0 A;  1I5H W;  2ZQU A;  2PPP A;  1FLC A;  1FKG A;  1LL6 A;  3PR9 A;  4DRI A;  4N19 A;  3FSC A;  5B8I C;  4ZPV R;  1LG1 A;  5AHT A;  1ZBW A;  4DRJ A;  3PRB A;  4NNR A;  4QT2 A;  1OGB A;  2ZAJ A;  3AS0 A;  1FJD A;  2RSE A;  4P8U A;  4R0X A;  2DG9 A;  1EYM A;  2XP9 A;  1GUV A;  1RD6 A;  4JFM A;  3CNG A;  3ODK A;  5HKG A;  1E15 A;  3LKX A;  4MTV A;  4MNL A;  3WL1 A;  1FFQ A;  3UQI A;  2PV2 A;  4HAR A;  1JNS A;  1D7H A;  1HKM A;  4ML4 A;  3WKZ A;  4GLX A;  4MPK A;  5HTG A;  2EZ5 W;  3MDY B;  2OFN A;  3CHD A;  2JX8 A;  1E9L A;  4HBO A;  2FAP A;  4P8V A;  5GPG A;  4MNJ A;  2DMV A;  1E6R A;  5E64 A;  2XPA A;  3ARO A;  1FKJ A;  2DSV A;  3M85 A;  1FKH A;  2VN1 A;  4Q7N A;  1K9Q A;  3H9R B;  2MLY A;  3FS8 A;  3PA7 A;  1K9T A;  4LAX A;  1FKB A;  5HT1 A;  1EG4 A;  2WLZ A;  1PBK A;  2ZR4 A;  1ROT A;  1W9V A;  2M08 A;  4E5R A;  4MSP A;  2YSG A;  4DWS A;  5E66 A;  3TDB A;  4ODQ A;  3CZ8 A;  2RUC A;  1HKI A;  1ZB5 A;  3PRA A;  1HXV A;  4P8W A;  1KT1 A;  5J6E A;  4IPX A;  3UI4 A;  3AS3 A; 
#chains in the Genus database with same CATH homology
 1UR8 A;  4J4O A;  3LKX B;  1O6W A;  2JV4 A;  2WAE A;  3TCZ A;  1J6Y A;  1E6N A;  1L1P A;  2N87 A;  2KR7 A;  3IHZ A;  3AS2 A;  4LGX A;  2D9F A;  2K8I A;  1NMW A;  4KQZ A;  4P8X A;  4ODM A;  2PV3 A;  1WAW A;  4G50 A;  4DH0 A;  1QPF A;  3UQA A;  2PBC A;  2UZ5 A;  4GGQ A;  1D2K A;  4W5U A;  1D7J A;  3ALF A;  3ARZ A;  3TC5 A;  2YBU A;  2XP4 A;  3O5G A;  4TYO A;  2KXQ A;  4DRQ A;  2LKN A;  2M2A A;  5HBF A;  2DG4 A;  4DWS B;  3KAF A;  1ZBC A;  4ODN A;  4DIP A;  3WD4 A;  2MLX A;  1JND A;  3ARP A;  4WKA A;  1D6O A;  3O5M A;  2M8J A;  1BKF A;  2DPE A;  1EG3 A;  4TW6 A;  3O5I A;  1NH6 A;  3JYJ A;  3RM8 A;  4U84 A;  2DK1 A;  2AWG A;  2ZQV A;  2XP7 A;  2XPB A;  1JVW A;  2XP3 A;  2YAJ B;  3PQH A;  2KI3 A;  5CQ2 A;  3KCE A;  2L2S A;  3FAP A;  1W1P A;  2YSI A;  3WL0 A;  1ITX A;  1BL4 A;  3ARY A;  3O5P A;  1NSG A;  1W1V A;  3O5F A;  3M7N A;  2PI6 A;  2JMF A;  2WAD A;  2KO7 A;  2QRV A;  3B8S A;  3IK8 A;  4KR0 B;  4DWS C;  1XRV A;  2MNT A;  4O2T A;  3W4R A;  1PIN A;  4TW8 A;  1GOI A;  2ZR5 A;  4C02 B;  2OLH A;  4ODP A;  3O5E A;  1SYT A;  4TNS A;  3MCB A;  1FFR A;  1X6L A;  2JZV A;  4W9O A;  1W9P A;  3RGC A;  4W9Q A;  1Y0O A;  1U79 A;  4IT6 A;  1FKL A;  2G8Z A;  1QPL A;  1SR0 A;  4XAK A;  5E5W A;  2F2D A;  1O6I A;  2E45 A;  3KAC A;  2A3E A;  3B9E A;  3KAG A;  1EIB A;  3BXW A;  1NWR A;  1J4R A;  1HJX A;  4JYS A;  3O5Q A;  1HJV A;  2RUD A;  4IT4 A;  5HW7 A;  4MNK A;  1J4H A;  1LG2 A;  2MPH A;  4Z2H A;  4DRN A;  2ZQS A;  2M8I A;  1OWQ A;  1XHG A;  2WM0 A;  1X6N A;  4QT3 A;  4IQ2 A;  3ARU A;  3JXV A;  4L3N A;  2IUZ A;  3KAI A;  3LUO A;  1TCO C;  2A3B A;  2Y78 A;  3WD3 A;  1W1Y A;  3B9A A;  3PRD A;  1FAP A;  2IF4 A;  4DRH A;  5D75 A;  4FAP A;  4DZ3 A;  1Q1C A;  4MAV A;  2LJ4 A;  2QF8 A;  1JMQ A;  5E65 A;  2MDI A;  3AQU A;  1HKJ A;  2RQS A;  1FKS A;  4A0U A;  4DWS D;  2A3A A;  3WQW A;  2FDM A;  4Z2J A;  3LE4 A;  2XP6 A;  3CH9 A;  2DSU A;  2LPV A;  3MCB B;  1OGG A;  4Z2K A;  4ZPW R;  4WKF A;  2M3O W;  5BXJ A;  4ODR A;  4DRO A;  3OOB A;  4DRK A;  3UI5 A;  4NZC A;  1T11 A;  3RM9 A;  1R9H A;  4J4N A;  1ZCN A;  2DT1 A;  2KFW A;  4GIV A;  4A0T A;  5GQB A;  1NWS A;  4QIB A;  3UI6 A;  1IX5 A;  1LL4 A;  3CHC A;  4S3K A;  4REX A;  4DT4 A;  2A3C A;  1EQ3 A;  4Q22 A;  4R5E A;  3IKD A;  5HW8 A;  3KAH A;  2RE3 A;  2WLY A;  1ZBV A;  1ZU8 A;  4HBE A;  4MNM A;  1Q6H A;  3ART A;  2MLZ A;  2F21 A;  2MF9 A;  3I6C A;  3ALG A;  4JFK A;  1GPF A;  3WIJ A;  1WR7 A;  2LGO A;  3AS1 A;  4JFI A;  1WNO A;  3WQV A;  1FKI A;  2ITK A;  2WK2 A;  2ESC A;  4ODO A;  3RFW A;  1LL7 A;  1WB0 A;  3L4H A;  4FN2 A;  2DJY A;  4TW7 A;  1FKR A;  4S3J A;  1RP5 A;  5U47 A;  2PV1 A;  1E6Z A;  4DZ2 A;  5JH8 A;  3RM4 A;  3CHF A;  4QZV B;  3O5K A;  4TX0 A;  1KT0 A;  1FKT A;  3CGN A;  3ARX A;  3O5D A;  4LAY A;  4ZPT R;  3B7X A;  4JFJ A;  5DIT A;  2YSF A;  5HWB A;  1LQ0 A;  3NTP A;  3WD2 A;  1W9U A;  5DO2 A;  5DIV A;  3FXY A;  5DEZ A;  1ZBK A;  3WH0 A;  2KGJ A;  4ODK A;  1TK7 A;  3KAB A;  2XP8 A;  4LAW A;  3O5L A;  2Y8N B;  3G6M A;  4U86 A;  2DT2 A;  2F4E A;  1Q6I A;  1TR8 A;  3ARR A;  1YW5 A;  4WKH A;  5I98 A;  1FKK A;  4MGV A;  3MQH A;  1CTN A;  3FY1 A;  4AY1 A;  1D7I A;  1LJY A;  4ITZ A;  1NWT A;  2RUR A;  3UQB A;  1A7X A;  4LAV A;  3RME A;  2DSW A;  1KFW A;  2FKE A;  3IKG A;  1B6C A;  3CGM A;  1UR9 A;  2M1I A;  3O5J A;  1Q6U A;  3ARQ A;  1W1T A;  3G6L A;  3NRK A;  3MQG A;  4WJX A;  4DRP A;  3NI6 A;  2DWV A;  3CHE A;  5DF0 A;  1F8A B;  1TFV A;  3UF8 A;  4WIW A;  4BF8 A;  1K9R A;  3EY6 A;  2YSB A;  1W26 A;  1ZK6 A;  1HKK A;  1FD9 A;  2Q5A A;  2VCD A;  1ROU A;  1JNT A;  4Z2G A;  3GPK A;  1EHN A;  4ODL A;  1H0I A;  1P5Q A;  1J4I A;  3ARS A;  3O5O A;  5DIU A;  2G41 A;  2AOS A;  4NSB A;  1FKD A;  4WK9 A;  1QZ2 A;  2B31 A;  4U85 A;  2DSZ A;  3VAW A;  5GPR A;  2RUQ A;  2L4J A;  1C9H A;  3JYM A;  4G2P A;  4ZS6 A;  1N1A A;  1EDQ A;  1H0G A;  4IQC A;  2DT3 A;  1M5Y A;  3FSB A;  4Z2I A;  2DG3 A;  3ARV A;  1FKF A;  2PPN A;  2KE0 A;  2BA1 A;  1NWU A;  4URI A;  5HWC A;  3B9D A;  2ZR6 A;  3KZ7 A;  2DT0 A;  3ARW A;  3OA5 A;  1ZL1 A;  2YBT A;  3WD1 A;  2JXW A;  4DRM A;  2O92 A;  5HW6 A;  4Z2L A;  1F40 A;  2OWO A;  1JNE A;  4W9P A;  2DK7 A;  5E62 A;  1WMV A;  2LAJ A;  1NMV A;  3KAD A;  2PPO A;  3O5R A;  4L72 B;  2YSH A;  2XP5 A;  2ZQT A;  5HUA A;  1HJW A;  1VF8 A;  3QOK A;  1YAT A;  1E6P A;  2O9O A;  4JFL A;  4PTM A;  3WD0 A;  1I5H W;  2ZQU A;  2PPP A;  1FLC A;  1FKG A;  1LL6 A;  3PR9 A;  4DRI A;  4N19 A;  3FSC A;  5B8I C;  4ZPV R;  1LG1 A;  5AHT A;  1ZBW A;  4DRJ A;  3PRB A;  4NNR A;  4QT2 A;  1OGB A;  2ZAJ A;  3AS0 A;  1FJD A;  2RSE A;  4P8U A;  4R0X A;  2DG9 A;  1EYM A;  2XP9 A;  1GUV A;  1RD6 A;  4JFM A;  3CNG A;  3ODK A;  5HKG A;  1E15 A;  3LKX A;  4MTV A;  4MNL A;  3WL1 A;  1FFQ A;  3UQI A;  2PV2 A;  4HAR A;  1JNS A;  1D7H A;  1HKM A;  4ML4 A;  3WKZ A;  4GLX A;  4MPK A;  5HTG A;  2EZ5 W;  3MDY B;  2OFN A;  3CHD A;  2JX8 A;  1E9L A;  4HBO A;  2FAP A;  4P8V A;  5GPG A;  4MNJ A;  2DMV A;  1E6R A;  5E64 A;  2XPA A;  3ARO A;  1FKJ A;  2DSV A;  3M85 A;  1FKH A;  2VN1 A;  4Q7N A;  1K9Q A;  3H9R B;  2MLY A;  3FS8 A;  3PA7 A;  1K9T A;  4LAX A;  1FKB A;  5HT1 A;  1EG4 A;  2WLZ A;  1PBK A;  2ZR4 A;  1ROT A;  1W9V A;  2M08 A;  4E5R A;  4MSP A;  2YSG A;  4DWS A;  5E66 A;  3TDB A;  4ODQ A;  3CZ8 A;  2RUC A;  1HKI A;  1ZB5 A;  3PRA A;  1HXV A;  4P8W A;  1KT1 A;  5J6E A;  4IPX A;  3UI4 A;  3AS3 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...