4U84A

Human pin1 with s-hydroxyl-cysteine 113
Total Genus 45
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
45
sequence length
157
structure length
144
Chain Sequence
LPPGWEKAMSRSSGRVYYFNHITNASQWERPSEPARVRCSHLLVKHSQSRRPSSWRQEKITRTKEEALELINGYIQKIKSGEEDFESLASQFSDSSAKARGDLGAFSRGQMQKPFEDASFALRTGEMSGPVFTDSGIHIILRTE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Pin1 cysteine-113 oxidation inhibits its catalytic activity and cellular function in Alzheimer's disease.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Isomerase
molecule keywords Peptidyl-prolyl cis-trans isomerase NIMA-interacting 1
total genus 45
structure length 144
sequence length 157
ec nomenclature ec 5.2.1.8: Peptidylprolyl isomerase.
pdb deposition date 2014-08-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00397 WW WW domain
A PF00639 Rotamase PPIC-type PPIASE domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.20.70.10 Mainly Beta Single Sheet Ubiquitin Ligase Nedd4; Chain: W; Ubiquitin Ligase Nedd4; Chain: W; 4u84A01
3.10.50.40 Alpha Beta Roll Chitinase A; domain 3 Chitinase A; domain 3 4u84A02
1ZCNA 3EY6A 3NI6A 3O5FA 2ZR4A 2XP7A 3H9RB 2ZQVA 2RSEA 4DZ2A 3UI5A 4JFLA 5J6EA 1Q6UA 2ZR6A 4U85A 1W26A 1EQ3A 3O5QA 4DRQA 1EG4A 1FJDA 4GGQA 3MDYB 2JMFA 2M3OW 1M5YA 4O2TA 4DH0A 4TYOA 3LUOA 4DROA 1I5HW 2XP4A 1R9HA 2LGOA 2XPAA 1Y0OA 2F2DA 2RQSA 3GPKA 4ODQA 5DITA 4JFMA 4JYSA 2E45A 4ODNA 3O5OA 1D7JA 1JMQA 2YSBA 2XP5A 2D9FA 4MSPA 1PINA 4NNRA 1NMWA 5HW7A 5HWBA 3NRKA 1HXVA 2LJ4A 2RURA 1ROTA 2ZQUA 1ROUA 3O5LA 2DG4A 5DIUA 3RGCA 3PRBA 1D7HA 1NSGA 4ODPA 2M1IA 4TNSA 1FKIA 3KCEA 4G50A 1JVWA 2KO7A 2Y78A 4ODRA 2XP9A 4U84A 3KAHA 2ZAJA 5AHTA 1JNTA 1FKJA 3I6CA 3IKGA 1FKHA 2JX8A 5I98A 3O5IA 2LAJA 4DRPA 3KABA 2YSGA 4DIPA 2BA1A 2F4EA 2MLYA 1FD9A 4DRJA 2KXQA 3CNGA 2RE3A 3KAFA 2FKEA 4REXA 2M08A 3UF8A 2MDIA 2N87A 4LAXA 3M7NA 1QPLA 2MLZA 1FKKA 5HWCA 3L4HA 1FKDA 3TC5A 2FAPA 5HT1A 2RUCA 2DK7A 2XP6A 1J4RA 2MF9A 3JXVA 1WR7A 3O5EA 4JFKA 2XP3A 4J4OA 4LAVA 3JYMA 4FN2A 2VCDA 2UZ5A 4TW6A 2PV1A 1F40A 2YSHA 2EZ5W 4MGVA 1F8AB 4QT3A 1BL4A 5B8IC 1FKFA 2PV2A 3O5GA 5HW6A 1J4HA 3JYJA 3RFWA 2DMVA 1TK7A 4G2PA 2LKNA 2MLXA 2KFWA 2MNTA 4TW8A 1WMVA 3O5MA 2LPVA 4DRNA 2Q5AA 1BKFA 2VN1A 3O5KA 4R0XA 2XPBA 3NTPA 4DT4A 1FKRA 3UI6A 4DZ3A 3IKDA 4N19A 3IHZA 3O5DA 3KACA 4LAWA 2K8IA 4W9OA 4DRKA 3O5RA 4FAPA 2YSIA 3TCZA 3TDBA 2KI3A 1N1AA 2JZVA 3UQAA 1O6WA 1FKLA 3UQIA 1J6YA 3UI4A 1EG3A 2AWGA 5HUAA 5DIVA 3FAPA 4JFIA 3B7XA 1FKBA 1J4IA 1B6CA 2M2AA 5HW8A 2PBCA 4U86A 4QT2A 1QPFA 2IF4A 4J4NA 1P5QA 3UQBA 4JFJA 2ITKA 3CGNA 3PRDA 1YATA 3OOBA 4IQCA 2DJYA 1U79A 2KE0A 1KT0A 3WH0A 1TCOC 5GPGA 1A7XA 3KAGA 1T11A 4LAYA 3KADA 1FKGA 2KGJA 2OFNA 2PPOA 2ZQTA 4W9PA 5CQ2A 4ODLA 1D7IA 2M8IA 2PPNA 1Q6HA 1K9QA 4GIVA 2F21A 4ITZA 1K9RA 4BF8A 4DRMA 1QZ2A 3ODKA 2RUQA 3VAWA 1Q6IA 2DG9A 3PA7A 3KAIA 1Q1CA 1FKSA 3IK8A 3O5JA 1L1PA 4IQ2A 2PV3A 5HKGA 1FKTA 1KT1A 4DRIA 2L4JA 2L2SA 3KZ7A 1NMVA 4ODMA 2DWVA 5BXJA 1EYMA 4ODOA 1JNSA 4QIBA 2M8JA 1ZK6A 4TW7A 5HTGA 4E5RA 4W9QA 2DG3A 2DK1A 1YW5A 2JV4A 2JXWA 1C9HA 2YSFA 1D6OA 4IPXA 2PPPA 2ZR5A 2XP8A 2MPHA 4TX0A 3CGMA 4C02B 4DRHA 2ZQSA 1PBKA 4ODKA 2KR7A 3M85A 2RUDA 3LE4A 1FAPA 3O5PA 5D75A
chains in the Genus database with same CATH superfamily
3EY6A 2RSEA 4JFLA 1FJDA 2P4VA 3LUOA 4KQZA 5BXJA 1R9HA 1HKMA 4L72B 4HBEA 2YSBA 1W9VA 4NNRA 5HW7A 4P8UA 3B9EA 1HXVA 2ZQUA 3G6MA 5DO2A 2G8ZA 1NSGA 4IT4A 1FKIA 1JVWA 3KAHA 5AHTA 1JNTA 1FKJA 3IKGA 2JX8A 5DEZA 4MNJA 3ARRA 3PR9A 1GOIA 4MNLA 2BA1A 2MLYA 3AQUA 3CNGA 2RE3A 2M08A 1ITXA 2MDIA 1W1TA 3FS8A 1GPFA 4LAXA 3L4HA 3TC5A 2RUCA 2DK7A 2YBUA 3JXVA 4JFKA 4DROA 1HJXA 4TW6A 3ARWA 2UZ5A 2YSHA 2WK2A 1FKFA 2PV2A 3O5GA 1J4HA 3JYJA 2G41A 2KFWA 1WMVA 4WKHA 2Q5AA 1HKJA 1UR9A 4R0XA 4DT4A 3NTPA 3AS1A 3MCBA 3O5DA 4P8XA 2K8IA 1XHGA 1LL7A 3O5RA 4A0TA 1O6WA 1FKLA 3UQIA 3UI4A 4HBOA 5HW8A 1E6RA 1QPFA 4J4NA 2DSUA 4JFJA 3PRDA 1E15A 1TCOC 2DT2A 3W4RA 1ZBKA 4W9PA 2A3AA 3WD4A 4BF8A 5I98A 1Q6HA 4DRMA 3VAWA 1Q6IA 2F23A 3PA7A 1UR8A 1L1PA 1IX5A 4LGXA 2L4JA 3KZ7A 1NMVA 4IT6A 2DWVA 3FSBA 1JNSA 4TW7A 1E9LA 3CHFA 2DG3A 2DK1A 2B5UB 2ZR5A 4TX0A 1JCHB 4DRHA 3ARUA 3MCBB 3M85A 3ARSA 3LE4A 3O5PA 4ZPWR 3O5FA 3AS2A 1LL4A 4U85A 1W1YA 3MDYB 2JMFA 2M3OW 1ZL1A 1Y0OA 5DITA 3CZ8A 1ZBWA 1WAWA 3EIPA 4JYSA 4ODNA 3WL1A 1GUVA 3PRAA 3NRKA 5DIUA 3OA5A 1D7HA 1RD6A 3LKXA 5HBFA 3ALGA 1TFVA 2Y78A 4ODRA 4AY1A 1NWTA 2ZAJA 1W9PA 4DWSC 2B31A 1LG2A 3ARXA 1NH6A 1LL6A 4WIWA 2F4EA 4DRJA 2KXQA 3UF8A 2N87A 3M7NA 2FAPA 5HT1A 1J4RA 2XP6A 3G6LA 3O5EA 1WR7A 2XP3A 3JYMA 1X6LA 4FN2A 1F40A 1RP5A 4S3JA 2DMVA 2O9OA 4G2PA 2MNTA 2LPVA 3WD1A 3RM4A 2DT0A 3IKDA 1JNDA 4DRKA 2WAEA 4FAPA 1HJWA 2KI3A 2JZVA 1NWRA 1TR8A 5HUAA 3B7XA 3WQVA 2O92A 1B6CA 2PBCA 3BMBA 3UQBA 3RM8A 2ITKA 3B8SA 3WD0A 3KAGA 2WADA 1FKGA 2PPOA 3CHCA 2ZQTA 2DT1A 1D7IA 2M8IA 4GIVA 4ITZA 1K9QA 2DSZA 2DG9A 3IK8A 2PV3A 1NWSA 5HKGA 1OGGA 1SR0A 4DRIA 1FFRA 3WD3A 4E5RA 4W9QA 1WB0A 2FDMA 1K9TA 4IPXA 2PPPA 4ZPVR 2XP8A 4ML4A 4C02B 2WLYA 3CGMA 1SYTA 1E6ZA 3WKZA 3MQHA 3NI6A 4Z2LA 3WL0A 2XP7A 3GU0A 4DZ2A 4WJXA 3UI5A 2ETNA 5JH8A 4Z2KA 1EQ3A 3ARVA 1M5YA 4DH0A 4O2TA 1I5HW 2XP4A 1W1PA 2XPAA 2F2DA 3GPKA 3WIJA 4JFMA 5GPRA 4R5EA 1EHNA 1D7JA 1JMQA 1W9UA 2D9FA 2XP5A 2IUZA 1WNOA 2PN0A 1PINA 4MSPA 1NMWA 4NSBA 5E5WA 4DWSB 1GRJA 2LJ4A 3O5LA 3RGCA 1ZB5A 2DG4A 4P8VA 3QOKA 4TNSA 3KCEA 4G50A 2XP9A 4U84A 5E66A 3O5IA 4DRPA 2YSGA 4DIPA 1FD9A 3CHEA 1FKRA 3PQHA 2FKEA 4REXA 1ZBVA 1KFWA 1CTNA 1QPLA 2MLZA 4GLXA 1FKKA 1VF8A 5HWCA 1FKDA 1LJYA 5HTGA 2AOSA 4MGVA 5E65A 1F8AB 2QRVA 4DWSD 1EDQA 3RM9A 1TK7A 2LKNA 4TW8A 1XRVA 2VN1A 4Z2GA 5E64A 2DSVA 2XPBA 3UI6A 4N19A 3IHZA 3KACA 4LAWA 1X6NA 3ARPA 4W5UA 4Z2HA 2ESCA 3TCZA 3TDBA 4MNMA 4PTMA 2QF8A 1N1AA 3FSCA 1EG3A 4WKFA 4JFIA 4Z2JA 2M2AA 2A3EA 4U86A 4QT2A 2IF4A 1P5QA 3CGNA 1YATA 4IQCA 2DJYA 2KE0A 3WH0A 1A7XA 1HKKA 1T11A 4LAYA 3KADA 2OFNA 2A3CA 5CQ2A 2F21A 5U47A 1K9RA 2DSWA 2RUQA 1FKSA 2YAJB 4ZS6A 3ARZA 3RMEA 1KT1A 4WKAA 2L2SA 4QIBA 4L3NA 2OLHA 1E6NA 2JV4A 1YW5A 2PI6A 4Z2IA 5E62A 2WM0A 2MPHA 4A0UA 1PBKA 4ODKA 5DF0A 2KR7A 1FAPA 1LG1A 3ARYA 2OWOA 5D75A 1ZCNA 2ZR4A 3H9RB 2ZQVA 5J6EA 4Q22A 1Q6UA 2ZR6A 1W26A 3O5QA 4DRQA 1EG4A 2DT3A 4MNKA 4GGQA 3ARTA 4TYOA 2LGOA 2RQSA 4WK9A 4ODQA 1H0IA 3WQWA 1OGBA 2E45A 3O5OA 1LQ0A 4MAVA 4P8WA 3AS0A 4DWSA 5HWBA 4NZCA 2RURA 1ROTA 1ROUA 4Q7NA 3PRBA 3ARQA 3LKXB 4ODPA 2M1IA 2KO7A 3MQGA 3I6CA 1FKHA 4HARA 2LAJA 3B9AA 1E44A 3KABA 1FLCA 5GQBA 3KAFA 1ZBCA 2Y8NB 3CHDA 4MTVA 3B9DA 1E6PA 2MF9A 1NWUA 4LAVA 4J4OA 2VCDA 1EIBA 2EULA 2PV1A 3WD2A 2EZ5W 4QZVB 1HJVA 1OWQA 1BL4A 4QT3A 1O6IA 5B8IC 4XAKA 5HW6A 3RFWA 2MLXA 2A3BA 3O5MA 4DRNA 1BKFA 3O5KA 3FY1A 3BXWA 4DZ3A 4S3KA 4W9OA 2YBTA 2YSIA 4URIA 3FXYA 3UQAA 1W1VA 4UDMA 3AROA 1J6YA 2AWGA 5DIVA 3FAPA 4KR0B 1FKBA 1J4IA 1JNEA 1HKIA 3OOBA 1D2KA 1U79A 1KT0A 5GPGA 2KGJA 4ODLA 3ALFA 2PPNA 1ZU8A 1QZ2A 1H0GA 3ODKA 3AS3A 3KAIA 1Q1CA 2DPEA 3GTYX 3O5JA 4MPKA 4IQ2A 1FKTA 4ODMA 1EYMA 4ODOA 2M8JA 1ZK6A 1C9HA 2JXWA 2YSFA 1D6OA 3CH9A 2WLZA 1FFQA 2ZQSA 4ZPTR 2RUDA
chains in the Genus database with same CATH topology
3EY6A 2RSEA 4JFLA 1FJDA 3LUOA 4KQZA 5BXJA 1R9HA 1HKMA 4L72B 4HBEA 2YSBA 1W9VA 4NNRA 5HW7A 4P8UA 3B9EA 1HXVA 2ZQUA 3G6MA 5DO2A 2G8ZA 1NSGA 4IT4A 1FKIA 1JVWA 3KAHA 5AHTA 1JNTA 1FKJA 3IKGA 2JX8A 5DEZA 4MNJA 3ARRA 3PR9A 1GOIA 4MNLA 2BA1A 2MLYA 3AQUA 3CNGA 2RE3A 2M08A 1ITXA 2MDIA 1W1TA 3FS8A 1GPFA 4LAXA 3L4HA 3TC5A 2RUCA 2DK7A 2YBUA 3JXVA 4JFKA 4DROA 1HJXA 4TW6A 3ARWA 2UZ5A 2YSHA 2WK2A 1FKFA 2PV2A 3O5GA 1J4HA 3JYJA 2G41A 2KFWA 1WMVA 4WKHA 2Q5AA 1HKJA 1UR9A 4R0XA 4DT4A 3NTPA 3AS1A 3MCBA 3O5DA 4P8XA 2K8IA 1XHGA 1LL7A 3O5RA 4A0TA 1O6WA 1FKLA 3UQIA 3UI4A 4HBOA 5HW8A 1E6RA 1QPFA 4J4NA 2DSUA 4JFJA 3PRDA 1E15A 1TCOC 2DT2A 3W4RA 1ZBKA 4W9PA 2A3AA 3WD4A 4BF8A 5I98A 1Q6HA 4DRMA 3VAWA 1Q6IA 3PA7A 1UR8A 1L1PA 1IX5A 4LGXA 2L4JA 3KZ7A 1NMVA 4IT6A 2DWVA 3FSBA 1JNSA 4TW7A 1E9LA 3CHFA 2DG3A 2DK1A 2ZR5A 4TX0A 4DRHA 3ARUA 3MCBB 3M85A 3ARSA 3LE4A 3O5PA 4ZPWR 3O5FA 3AS2A 1LL4A 4U85A 1W1YA 3MDYB 2JMFA 2M3OW 1ZL1A 1Y0OA 5DITA 3CZ8A 1ZBWA 1WAWA 4JYSA 4ODNA 3WL1A 1GUVA 3PRAA 3NRKA 5DIUA 3OA5A 1D7HA 1RD6A 3LKXA 5HBFA 3ALGA 1TFVA 2Y78A 4ODRA 4AY1A 1NWTA 2ZAJA 1W9PA 4DWSC 2B31A 1LG2A 3ARXA 1NH6A 1LL6A 4WIWA 2F4EA 4DRJA 2KXQA 3UF8A 2N87A 3M7NA 2FAPA 5HT1A 1J4RA 2XP6A 3G6LA 3O5EA 1WR7A 2XP3A 3JYMA 1X6LA 4FN2A 1F40A 1RP5A 4S3JA 2DMVA 2O9OA 4G2PA 2MNTA 2LPVA 3WD1A 3RM4A 2DT0A 3IKDA 1JNDA 4DRKA 2WAEA 4FAPA 1HJWA 2KI3A 2JZVA 1NWRA 1TR8A 5HUAA 3B7XA 3WQVA 2O92A 1B6CA 2PBCA 3UQBA 3RM8A 2ITKA 3B8SA 3WD0A 3KAGA 2WADA 1FKGA 2PPOA 3CHCA 2ZQTA 2DT1A 1D7IA 2M8IA 4GIVA 4ITZA 1K9QA 2DSZA 2DG9A 3IK8A 2PV3A 1NWSA 5HKGA 1OGGA 1SR0A 4DRIA 1FFRA 3WD3A 4E5RA 4W9QA 1WB0A 2FDMA 1K9TA 4IPXA 2PPPA 4ZPVR 2XP8A 4ML4A 4C02B 2WLYA 3CGMA 1SYTA 1E6ZA 3WKZA 3MQHA 3NI6A 4Z2LA 3WL0A 2XP7A 4DZ2A 4WJXA 3UI5A 5JH8A 4Z2KA 1EQ3A 3ARVA 1M5YA 4DH0A 4O2TA 1I5HW 2XP4A 1W1PA 2XPAA 2F2DA 3GPKA 3WIJA 4JFMA 5GPRA 4R5EA 1EHNA 1D7JA 1JMQA 1W9UA 2D9FA 2XP5A 2IUZA 1WNOA 4MSPA 1PINA 4NSBA 1NMWA 5E5WA 4DWSB 2LJ4A 3O5LA 3RGCA 1ZB5A 2DG4A 4P8VA 3QOKA 4TNSA 3KCEA 4G50A 2XP9A 4U84A 5E66A 3O5IA 4DRPA 2YSGA 4DIPA 1FD9A 3CHEA 1FKRA 3PQHA 2FKEA 4REXA 1ZBVA 1KFWA 1CTNA 1QPLA 2MLZA 4GLXA 1FKKA 1VF8A 5HWCA 1FKDA 1LJYA 5HTGA 2AOSA 4MGVA 5E65A 1F8AB 2QRVA 4DWSD 1EDQA 3RM9A 1TK7A 2LKNA 4TW8A 1XRVA 2VN1A 4Z2GA 5E64A 2DSVA 2XPBA 3UI6A 4N19A 3IHZA 3KACA 4LAWA 1X6NA 3ARPA 4W5UA 4Z2HA 2ESCA 3TCZA 3TDBA 4MNMA 4PTMA 2QF8A 1N1AA 3FSCA 1EG3A 4WKFA 4JFIA 4Z2JA 2M2AA 2A3EA 4U86A 4QT2A 2IF4A 1P5QA 3CGNA 1YATA 4IQCA 2DJYA 2KE0A 3WH0A 1A7XA 1HKKA 1T11A 4LAYA 3KADA 2OFNA 2A3CA 5CQ2A 2F21A 5U47A 1K9RA 2DSWA 2RUQA 1FKSA 2YAJB 4ZS6A 3ARZA 3RMEA 1KT1A 4WKAA 2L2SA 4QIBA 4L3NA 2OLHA 1E6NA 2JV4A 1YW5A 2PI6A 4Z2IA 5E62A 2WM0A 2MPHA 4A0UA 1PBKA 4ODKA 5DF0A 2KR7A 1FAPA 1LG1A 3ARYA 2OWOA 5D75A 1ZCNA 2ZR4A 3H9RB 2ZQVA 5J6EA 4Q22A 1Q6UA 2ZR6A 1W26A 3O5QA 4DRQA 1EG4A 2DT3A 4MNKA 4GGQA 3ARTA 4TYOA 2LGOA 2RQSA 4WK9A 4ODQA 1H0IA 3WQWA 1OGBA 2E45A 3O5OA 1LQ0A 4MAVA 4P8WA 3AS0A 4DWSA 5HWBA 4NZCA 2RURA 1ROTA 1ROUA 4Q7NA 3PRBA 3ARQA 3LKXB 4ODPA 2M1IA 2KO7A 3MQGA 3I6CA 1FKHA 4HARA 2LAJA 3B9AA 3KABA 1FLCA 5GQBA 3KAFA 1ZBCA 2Y8NB 3CHDA 4MTVA 3B9DA 1E6PA 2MF9A 1NWUA 4LAVA 4J4OA 2VCDA 1EIBA 2PV1A 3WD2A 2EZ5W 4QZVB 1HJVA 1OWQA 1BL4A 4QT3A 1O6IA 5B8IC 4XAKA 5HW6A 3RFWA 2MLXA 2A3BA 3O5MA 4DRNA 1BKFA 3O5KA 3FY1A 3BXWA 4DZ3A 4S3KA 4W9OA 2YBTA 2YSIA 4URIA 3FXYA 3UQAA 1W1VA 3AROA 1J6YA 2AWGA 5DIVA 3FAPA 4KR0B 1FKBA 1J4IA 1JNEA 1HKIA 3OOBA 1D2KA 1U79A 1KT0A 5GPGA 2KGJA 4ODLA 3ALFA 2PPNA 1ZU8A 1QZ2A 1H0GA 3ODKA 3AS3A 3KAIA 1Q1CA 2DPEA 3O5JA 4MPKA 4IQ2A 1FKTA 4ODMA 1EYMA 4ODOA 2M8JA 1ZK6A 1C9HA 2JXWA 2YSFA 1D6OA 3CH9A 2WLZA 1FFQA 2ZQSA 4ZPTR 2RUDA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1ZCN A;  3EY6 A;  3NI6 A;  3O5F A;  2ZR4 A;  2XP7 A;  3H9R B;  2ZQV A;  2RSE A;  4DZ2 A;  3UI5 A;  4JFL A;  5J6E A;  1Q6U A;  2ZR6 A;  4U85 A;  1W26 A;  1EQ3 A;  3O5Q A;  4DRQ A;  1EG4 A;  1FJD A;  4GGQ A;  3MDY B;  2JMF A;  2M3O W;  1M5Y A;  4O2T A;  4DH0 A;  4TYO A;  3LUO A;  4DRO A;  1I5H W;  2XP4 A;  1R9H A;  2LGO A;  2XPA A;  1Y0O A;  2F2D A;  2RQS A;  3GPK A;  4ODQ A;  5DIT A;  4JFM A;  4JYS A;  2E45 A;  4ODN A;  3O5O A;  1D7J A;  1JMQ A;  2YSB A;  2XP5 A;  2D9F A;  4MSP A;  1PIN A;  4NNR A;  1NMW A;  5HW7 A;  5HWB A;  3NRK A;  1HXV A;  2LJ4 A;  2RUR A;  1ROT A;  2ZQU A;  1ROU A;  3O5L A;  2DG4 A;  5DIU A;  3RGC A;  3PRB A;  1D7H A;  1NSG A;  4ODP A;  2M1I A;  4TNS A;  1FKI A;  3KCE A;  4G50 A;  1JVW A;  2KO7 A;  2Y78 A;  4ODR A;  2XP9 A;  4U84 A;  3KAH A;  2ZAJ A;  5AHT A;  1JNT A;  1FKJ A;  3I6C A;  3IKG A;  1FKH A;  2JX8 A;  5I98 A;  3O5I A;  2LAJ A;  4DRP A;  3KAB A;  2YSG A;  4DIP A;  2BA1 A;  2F4E A;  2MLY A;  1FD9 A;  4DRJ A;  2KXQ A;  3CNG A;  2RE3 A;  3KAF A;  2FKE A;  4REX A;  2M08 A;  3UF8 A;  2MDI A;  2N87 A;  4LAX A;  3M7N A;  1QPL A;  2MLZ A;  1FKK A;  5HWC A;  3L4H A;  1FKD A;  3TC5 A;  2FAP A;  5HT1 A;  2RUC A;  2DK7 A;  2XP6 A;  1J4R A;  2MF9 A;  3JXV A;  1WR7 A;  3O5E A;  4JFK A;  2XP3 A;  4J4O A;  4LAV A;  3JYM A;  4FN2 A;  2VCD A;  2UZ5 A;  4TW6 A;  2PV1 A;  1F40 A;  2YSH A;  2EZ5 W;  4MGV A;  1F8A B;  4QT3 A;  1BL4 A;  5B8I C;  1FKF A;  2PV2 A;  3O5G A;  5HW6 A;  1J4H A;  3JYJ A;  3RFW A;  2DMV A;  1TK7 A;  4G2P A;  2LKN A;  2MLX A;  2KFW A;  2MNT A;  4TW8 A;  1WMV A;  3O5M A;  2LPV A;  4DRN A;  2Q5A A;  1BKF A;  2VN1 A;  3O5K A;  4R0X A;  2XPB A;  3NTP A;  4DT4 A;  1FKR A;  3UI6 A;  4DZ3 A;  3IKD A;  4N19 A;  3IHZ A;  3O5D A;  3KAC A;  4LAW A;  2K8I A;  4W9O A;  4DRK A;  3O5R A;  4FAP A;  2YSI A;  3TCZ A;  3TDB A;  2KI3 A;  1N1A A;  2JZV A;  3UQA A;  1O6W A;  1FKL A;  3UQI A;  1J6Y A;  3UI4 A;  1EG3 A;  2AWG A;  5HUA A;  5DIV A;  3FAP A;  4JFI A;  3B7X A;  1FKB A;  1J4I A;  1B6C A;  2M2A A;  5HW8 A;  2PBC A;  4U86 A;  4QT2 A;  1QPF A;  2IF4 A;  4J4N A;  1P5Q A;  3UQB A;  4JFJ A;  2ITK A;  3CGN A;  3PRD A;  1YAT A;  3OOB A;  4IQC A;  2DJY A;  1U79 A;  2KE0 A;  1KT0 A;  3WH0 A;  1TCO C;  5GPG A;  1A7X A;  3KAG A;  1T11 A;  4LAY A;  3KAD A;  1FKG A;  2KGJ A;  2OFN A;  2PPO A;  2ZQT A;  4W9P A;  5CQ2 A;  4ODL A;  1D7I A;  2M8I A;  2PPN A;  1Q6H A;  1K9Q A;  4GIV A;  2F21 A;  4ITZ A;  1K9R A;  4BF8 A;  4DRM A;  1QZ2 A;  3ODK A;  2RUQ A;  3VAW A;  1Q6I A;  2DG9 A;  3PA7 A;  3KAI A;  1Q1C A;  1FKS A;  3IK8 A;  3O5J A;  1L1P A;  4IQ2 A;  2PV3 A;  5HKG A;  1FKT A;  1KT1 A;  4DRI A;  2L4J A;  2L2S A;  3KZ7 A;  1NMV A;  4ODM A;  2DWV A;  5BXJ A;  1EYM A;  4ODO A;  1JNS A;  4QIB A;  2M8J A;  1ZK6 A;  4TW7 A;  5HTG A;  4E5R A;  4W9Q A;  2DG3 A;  2DK1 A;  1YW5 A;  2JV4 A;  2JXW A;  1C9H A;  2YSF A;  1D6O A;  4IPX A;  2PPP A;  2ZR5 A;  2XP8 A;  2MPH A;  4TX0 A;  3CGM A;  4C02 B;  4DRH A;  2ZQS A;  1PBK A;  4ODK A;  2KR7 A;  3M85 A;  2RUD A;  3LE4 A;  1FAP A;  3O5P A;  5D75 A; 
#chains in the Genus database with same CATH topology
 3EY6 A;  2RSE A;  4JFL A;  1FJD A;  2P4V A;  3LUO A;  4KQZ A;  5BXJ A;  1R9H A;  1HKM A;  4L72 B;  4HBE A;  2YSB A;  1W9V A;  4NNR A;  5HW7 A;  4P8U A;  3B9E A;  1HXV A;  2ZQU A;  3G6M A;  5DO2 A;  2G8Z A;  1NSG A;  4IT4 A;  1FKI A;  1JVW A;  3KAH A;  5AHT A;  1JNT A;  1FKJ A;  3IKG A;  2JX8 A;  5DEZ A;  4MNJ A;  3ARR A;  3PR9 A;  1GOI A;  4MNL A;  2BA1 A;  2MLY A;  3AQU A;  3CNG A;  2RE3 A;  2M08 A;  1ITX A;  2MDI A;  1W1T A;  3FS8 A;  1GPF A;  4LAX A;  3L4H A;  3TC5 A;  2RUC A;  2DK7 A;  2YBU A;  3JXV A;  4JFK A;  4DRO A;  1HJX A;  4TW6 A;  3ARW A;  2UZ5 A;  2YSH A;  2WK2 A;  1FKF A;  2PV2 A;  3O5G A;  1J4H A;  3JYJ A;  2G41 A;  2KFW A;  1WMV A;  4WKH A;  2Q5A A;  1HKJ A;  1UR9 A;  4R0X A;  4DT4 A;  3NTP A;  3AS1 A;  3MCB A;  3O5D A;  4P8X A;  2K8I A;  1XHG A;  1LL7 A;  3O5R A;  4A0T A;  1O6W A;  1FKL A;  3UQI A;  3UI4 A;  4HBO A;  5HW8 A;  1E6R A;  1QPF A;  4J4N A;  2DSU A;  4JFJ A;  3PRD A;  1E15 A;  1TCO C;  2DT2 A;  3W4R A;  1ZBK A;  4W9P A;  2A3A A;  3WD4 A;  4BF8 A;  5I98 A;  1Q6H A;  4DRM A;  3VAW A;  1Q6I A;  2F23 A;  3PA7 A;  1UR8 A;  1L1P A;  1IX5 A;  4LGX A;  2L4J A;  3KZ7 A;  1NMV A;  4IT6 A;  2DWV A;  3FSB A;  1JNS A;  4TW7 A;  1E9L A;  3CHF A;  2DG3 A;  2DK1 A;  2B5U B;  2ZR5 A;  4TX0 A;  1JCH B;  4DRH A;  3ARU A;  3MCB B;  3M85 A;  3ARS A;  3LE4 A;  3O5P A;  4ZPW R;  3O5F A;  3AS2 A;  1LL4 A;  4U85 A;  1W1Y A;  3MDY B;  2JMF A;  2M3O W;  1ZL1 A;  1Y0O A;  5DIT A;  3CZ8 A;  1ZBW A;  1WAW A;  3EIP A;  4JYS A;  4ODN A;  3WL1 A;  1GUV A;  3PRA A;  3NRK A;  5DIU A;  3OA5 A;  1D7H A;  1RD6 A;  3LKX A;  5HBF A;  3ALG A;  1TFV A;  2Y78 A;  4ODR A;  4AY1 A;  1NWT A;  2ZAJ A;  1W9P A;  4DWS C;  2B31 A;  1LG2 A;  3ARX A;  1NH6 A;  1LL6 A;  4WIW A;  2F4E A;  4DRJ A;  2KXQ A;  3UF8 A;  2N87 A;  3M7N A;  2FAP A;  5HT1 A;  1J4R A;  2XP6 A;  3G6L A;  3O5E A;  1WR7 A;  2XP3 A;  3JYM A;  1X6L A;  4FN2 A;  1F40 A;  1RP5 A;  4S3J A;  2DMV A;  2O9O A;  4G2P A;  2MNT A;  2LPV A;  3WD1 A;  3RM4 A;  2DT0 A;  3IKD A;  1JND A;  4DRK A;  2WAE A;  4FAP A;  1HJW A;  2KI3 A;  2JZV A;  1NWR A;  1TR8 A;  5HUA A;  3B7X A;  3WQV A;  2O92 A;  1B6C A;  2PBC A;  3BMB A;  3UQB A;  3RM8 A;  2ITK A;  3B8S A;  3WD0 A;  3KAG A;  2WAD A;  1FKG A;  2PPO A;  3CHC A;  2ZQT A;  2DT1 A;  1D7I A;  2M8I A;  4GIV A;  4ITZ A;  1K9Q A;  2DSZ A;  2DG9 A;  3IK8 A;  2PV3 A;  1NWS A;  5HKG A;  1OGG A;  1SR0 A;  4DRI A;  1FFR A;  3WD3 A;  4E5R A;  4W9Q A;  1WB0 A;  2FDM A;  1K9T A;  4IPX A;  2PPP A;  4ZPV R;  2XP8 A;  4ML4 A;  4C02 B;  2WLY A;  3CGM A;  1SYT A;  1E6Z A;  3WKZ A;  3MQH A;  3NI6 A;  4Z2L A;  3WL0 A;  2XP7 A;  3GU0 A;  4DZ2 A;  4WJX A;  3UI5 A;  2ETN A;  5JH8 A;  4Z2K A;  1EQ3 A;  3ARV A;  1M5Y A;  4DH0 A;  4O2T A;  1I5H W;  2XP4 A;  1W1P A;  2XPA A;  2F2D A;  3GPK A;  3WIJ A;  4JFM A;  5GPR A;  4R5E A;  1EHN A;  1D7J A;  1JMQ A;  1W9U A;  2D9F A;  2XP5 A;  2IUZ A;  1WNO A;  2PN0 A;  1PIN A;  4MSP A;  1NMW A;  4NSB A;  5E5W A;  4DWS B;  1GRJ A;  2LJ4 A;  3O5L A;  3RGC A;  1ZB5 A;  2DG4 A;  4P8V A;  3QOK A;  4TNS A;  3KCE A;  4G50 A;  2XP9 A;  4U84 A;  5E66 A;  3O5I A;  4DRP A;  2YSG A;  4DIP A;  1FD9 A;  3CHE A;  1FKR A;  3PQH A;  2FKE A;  4REX A;  1ZBV A;  1KFW A;  1CTN A;  1QPL A;  2MLZ A;  4GLX A;  1FKK A;  1VF8 A;  5HWC A;  1FKD A;  1LJY A;  5HTG A;  2AOS A;  4MGV A;  5E65 A;  1F8A B;  2QRV A;  4DWS D;  1EDQ A;  3RM9 A;  1TK7 A;  2LKN A;  4TW8 A;  1XRV A;  2VN1 A;  4Z2G A;  5E64 A;  2DSV A;  2XPB A;  3UI6 A;  4N19 A;  3IHZ A;  3KAC A;  4LAW A;  1X6N A;  3ARP A;  4W5U A;  4Z2H A;  2ESC A;  3TCZ A;  3TDB A;  4MNM A;  4PTM A;  2QF8 A;  1N1A A;  3FSC A;  1EG3 A;  4WKF A;  4JFI A;  4Z2J A;  2M2A A;  2A3E A;  4U86 A;  4QT2 A;  2IF4 A;  1P5Q A;  3CGN A;  1YAT A;  4IQC A;  2DJY A;  2KE0 A;  3WH0 A;  1A7X A;  1HKK A;  1T11 A;  4LAY A;  3KAD A;  2OFN A;  2A3C A;  5CQ2 A;  2F21 A;  5U47 A;  1K9R A;  2DSW A;  2RUQ A;  1FKS A;  2YAJ B;  4ZS6 A;  3ARZ A;  3RME A;  1KT1 A;  4WKA A;  2L2S A;  4QIB A;  4L3N A;  2OLH A;  1E6N A;  2JV4 A;  1YW5 A;  2PI6 A;  4Z2I A;  5E62 A;  2WM0 A;  2MPH A;  4A0U A;  1PBK A;  4ODK A;  5DF0 A;  2KR7 A;  1FAP A;  1LG1 A;  3ARY A;  2OWO A;  5D75 A;  1ZCN A;  2ZR4 A;  3H9R B;  2ZQV A;  5J6E A;  4Q22 A;  1Q6U A;  2ZR6 A;  1W26 A;  3O5Q A;  4DRQ A;  1EG4 A;  2DT3 A;  4MNK A;  4GGQ A;  3ART A;  4TYO A;  2LGO A;  2RQS A;  4WK9 A;  4ODQ A;  1H0I A;  3WQW A;  1OGB A;  2E45 A;  3O5O A;  1LQ0 A;  4MAV A;  4P8W A;  3AS0 A;  4DWS A;  5HWB A;  4NZC A;  2RUR A;  1ROT A;  1ROU A;  4Q7N A;  3PRB A;  3ARQ A;  3LKX B;  4ODP A;  2M1I A;  2KO7 A;  3MQG A;  3I6C A;  1FKH A;  4HAR A;  2LAJ A;  3B9A A;  1E44 A;  3KAB A;  1FLC A;  5GQB A;  3KAF A;  1ZBC A;  2Y8N B;  3CHD A;  4MTV A;  3B9D A;  1E6P A;  2MF9 A;  1NWU A;  4LAV A;  4J4O A;  2VCD A;  1EIB A;  2EUL A;  2PV1 A;  3WD2 A;  2EZ5 W;  4QZV B;  1HJV A;  1OWQ A;  1BL4 A;  4QT3 A;  1O6I A;  5B8I C;  4XAK A;  5HW6 A;  3RFW A;  2MLX A;  2A3B A;  3O5M A;  4DRN A;  1BKF A;  3O5K A;  3FY1 A;  3BXW A;  4DZ3 A;  4S3K A;  4W9O A;  2YBT A;  2YSI A;  4URI A;  3FXY A;  3UQA A;  1W1V A;  4UDM A;  3ARO A;  1J6Y A;  2AWG A;  5DIV A;  3FAP A;  4KR0 B;  1FKB A;  1J4I A;  1JNE A;  1HKI A;  3OOB A;  1D2K A;  1U79 A;  1KT0 A;  5GPG A;  2KGJ A;  4ODL A;  3ALF A;  2PPN A;  1ZU8 A;  1QZ2 A;  1H0G A;  3ODK A;  3AS3 A;  3KAI A;  1Q1C A;  2DPE A;  3GTY X;  3O5J A;  4MPK A;  4IQ2 A;  1FKT A;  4ODM A;  1EYM A;  4ODO A;  2M8J A;  1ZK6 A;  1C9H A;  2JXW A;  2YSF A;  1D6O A;  3CH9 A;  2WLZ A;  1FFQ A;  2ZQS A;  4ZPT R;  2RUD A; 
#chains in the Genus database with same CATH homology
 3EY6 A;  2RSE A;  4JFL A;  1FJD A;  3LUO A;  4KQZ A;  5BXJ A;  1R9H A;  1HKM A;  4L72 B;  4HBE A;  2YSB A;  1W9V A;  4NNR A;  5HW7 A;  4P8U A;  3B9E A;  1HXV A;  2ZQU A;  3G6M A;  5DO2 A;  2G8Z A;  1NSG A;  4IT4 A;  1FKI A;  1JVW A;  3KAH A;  5AHT A;  1JNT A;  1FKJ A;  3IKG A;  2JX8 A;  5DEZ A;  4MNJ A;  3ARR A;  3PR9 A;  1GOI A;  4MNL A;  2BA1 A;  2MLY A;  3AQU A;  3CNG A;  2RE3 A;  2M08 A;  1ITX A;  2MDI A;  1W1T A;  3FS8 A;  1GPF A;  4LAX A;  3L4H A;  3TC5 A;  2RUC A;  2DK7 A;  2YBU A;  3JXV A;  4JFK A;  4DRO A;  1HJX A;  4TW6 A;  3ARW A;  2UZ5 A;  2YSH A;  2WK2 A;  1FKF A;  2PV2 A;  3O5G A;  1J4H A;  3JYJ A;  2G41 A;  2KFW A;  1WMV A;  4WKH A;  2Q5A A;  1HKJ A;  1UR9 A;  4R0X A;  4DT4 A;  3NTP A;  3AS1 A;  3MCB A;  3O5D A;  4P8X A;  2K8I A;  1XHG A;  1LL7 A;  3O5R A;  4A0T A;  1O6W A;  1FKL A;  3UQI A;  3UI4 A;  4HBO A;  5HW8 A;  1E6R A;  1QPF A;  4J4N A;  2DSU A;  4JFJ A;  3PRD A;  1E15 A;  1TCO C;  2DT2 A;  3W4R A;  1ZBK A;  4W9P A;  2A3A A;  3WD4 A;  4BF8 A;  5I98 A;  1Q6H A;  4DRM A;  3VAW A;  1Q6I A;  3PA7 A;  1UR8 A;  1L1P A;  1IX5 A;  4LGX A;  2L4J A;  3KZ7 A;  1NMV A;  4IT6 A;  2DWV A;  3FSB A;  1JNS A;  4TW7 A;  1E9L A;  3CHF A;  2DG3 A;  2DK1 A;  2ZR5 A;  4TX0 A;  4DRH A;  3ARU A;  3MCB B;  3M85 A;  3ARS A;  3LE4 A;  3O5P A;  4ZPW R;  3O5F A;  3AS2 A;  1LL4 A;  4U85 A;  1W1Y A;  3MDY B;  2JMF A;  2M3O W;  1ZL1 A;  1Y0O A;  5DIT A;  3CZ8 A;  1ZBW A;  1WAW A;  4JYS A;  4ODN A;  3WL1 A;  1GUV A;  3PRA A;  3NRK A;  5DIU A;  3OA5 A;  1D7H A;  1RD6 A;  3LKX A;  5HBF A;  3ALG A;  1TFV A;  2Y78 A;  4ODR A;  4AY1 A;  1NWT A;  2ZAJ A;  1W9P A;  4DWS C;  2B31 A;  1LG2 A;  3ARX A;  1NH6 A;  1LL6 A;  4WIW A;  2F4E A;  4DRJ A;  2KXQ A;  3UF8 A;  2N87 A;  3M7N A;  2FAP A;  5HT1 A;  1J4R A;  2XP6 A;  3G6L A;  3O5E A;  1WR7 A;  2XP3 A;  3JYM A;  1X6L A;  4FN2 A;  1F40 A;  1RP5 A;  4S3J A;  2DMV A;  2O9O A;  4G2P A;  2MNT A;  2LPV A;  3WD1 A;  3RM4 A;  2DT0 A;  3IKD A;  1JND A;  4DRK A;  2WAE A;  4FAP A;  1HJW A;  2KI3 A;  2JZV A;  1NWR A;  1TR8 A;  5HUA A;  3B7X A;  3WQV A;  2O92 A;  1B6C A;  2PBC A;  3UQB A;  3RM8 A;  2ITK A;  3B8S A;  3WD0 A;  3KAG A;  2WAD A;  1FKG A;  2PPO A;  3CHC A;  2ZQT A;  2DT1 A;  1D7I A;  2M8I A;  4GIV A;  4ITZ A;  1K9Q A;  2DSZ A;  2DG9 A;  3IK8 A;  2PV3 A;  1NWS A;  5HKG A;  1OGG A;  1SR0 A;  4DRI A;  1FFR A;  3WD3 A;  4E5R A;  4W9Q A;  1WB0 A;  2FDM A;  1K9T A;  4IPX A;  2PPP A;  4ZPV R;  2XP8 A;  4ML4 A;  4C02 B;  2WLY A;  3CGM A;  1SYT A;  1E6Z A;  3WKZ A;  3MQH A;  3NI6 A;  4Z2L A;  3WL0 A;  2XP7 A;  4DZ2 A;  4WJX A;  3UI5 A;  5JH8 A;  4Z2K A;  1EQ3 A;  3ARV A;  1M5Y A;  4DH0 A;  4O2T A;  1I5H W;  2XP4 A;  1W1P A;  2XPA A;  2F2D A;  3GPK A;  3WIJ A;  4JFM A;  5GPR A;  4R5E A;  1EHN A;  1D7J A;  1JMQ A;  1W9U A;  2D9F A;  2XP5 A;  2IUZ A;  1WNO A;  4MSP A;  1PIN A;  4NSB A;  1NMW A;  5E5W A;  4DWS B;  2LJ4 A;  3O5L A;  3RGC A;  1ZB5 A;  2DG4 A;  4P8V A;  3QOK A;  4TNS A;  3KCE A;  4G50 A;  2XP9 A;  4U84 A;  5E66 A;  3O5I A;  4DRP A;  2YSG A;  4DIP A;  1FD9 A;  3CHE A;  1FKR A;  3PQH A;  2FKE A;  4REX A;  1ZBV A;  1KFW A;  1CTN A;  1QPL A;  2MLZ A;  4GLX A;  1FKK A;  1VF8 A;  5HWC A;  1FKD A;  1LJY A;  5HTG A;  2AOS A;  4MGV A;  5E65 A;  1F8A B;  2QRV A;  4DWS D;  1EDQ A;  3RM9 A;  1TK7 A;  2LKN A;  4TW8 A;  1XRV A;  2VN1 A;  4Z2G A;  5E64 A;  2DSV A;  2XPB A;  3UI6 A;  4N19 A;  3IHZ A;  3KAC A;  4LAW A;  1X6N A;  3ARP A;  4W5U A;  4Z2H A;  2ESC A;  3TCZ A;  3TDB A;  4MNM A;  4PTM A;  2QF8 A;  1N1A A;  3FSC A;  1EG3 A;  4WKF A;  4JFI A;  4Z2J A;  2M2A A;  2A3E A;  4U86 A;  4QT2 A;  2IF4 A;  1P5Q A;  3CGN A;  1YAT A;  4IQC A;  2DJY A;  2KE0 A;  3WH0 A;  1A7X A;  1HKK A;  1T11 A;  4LAY A;  3KAD A;  2OFN A;  2A3C A;  5CQ2 A;  2F21 A;  5U47 A;  1K9R A;  2DSW A;  2RUQ A;  1FKS A;  2YAJ B;  4ZS6 A;  3ARZ A;  3RME A;  1KT1 A;  4WKA A;  2L2S A;  4QIB A;  4L3N A;  2OLH A;  1E6N A;  2JV4 A;  1YW5 A;  2PI6 A;  4Z2I A;  5E62 A;  2WM0 A;  2MPH A;  4A0U A;  1PBK A;  4ODK A;  5DF0 A;  2KR7 A;  1FAP A;  1LG1 A;  3ARY A;  2OWO A;  5D75 A;  1ZCN A;  2ZR4 A;  3H9R B;  2ZQV A;  5J6E A;  4Q22 A;  1Q6U A;  2ZR6 A;  1W26 A;  3O5Q A;  4DRQ A;  1EG4 A;  2DT3 A;  4MNK A;  4GGQ A;  3ART A;  4TYO A;  2LGO A;  2RQS A;  4WK9 A;  4ODQ A;  1H0I A;  3WQW A;  1OGB A;  2E45 A;  3O5O A;  1LQ0 A;  4MAV A;  4P8W A;  3AS0 A;  4DWS A;  5HWB A;  4NZC A;  2RUR A;  1ROT A;  1ROU A;  4Q7N A;  3PRB A;  3ARQ A;  3LKX B;  4ODP A;  2M1I A;  2KO7 A;  3MQG A;  3I6C A;  1FKH A;  4HAR A;  2LAJ A;  3B9A A;  3KAB A;  1FLC A;  5GQB A;  3KAF A;  1ZBC A;  2Y8N B;  3CHD A;  4MTV A;  3B9D A;  1E6P A;  2MF9 A;  1NWU A;  4LAV A;  4J4O A;  2VCD A;  1EIB A;  2PV1 A;  3WD2 A;  2EZ5 W;  4QZV B;  1HJV A;  1OWQ A;  1BL4 A;  4QT3 A;  1O6I A;  5B8I C;  4XAK A;  5HW6 A;  3RFW A;  2MLX A;  2A3B A;  3O5M A;  4DRN A;  1BKF A;  3O5K A;  3FY1 A;  3BXW A;  4DZ3 A;  4S3K A;  4W9O A;  2YBT A;  2YSI A;  4URI A;  3FXY A;  3UQA A;  1W1V A;  3ARO A;  1J6Y A;  2AWG A;  5DIV A;  3FAP A;  4KR0 B;  1FKB A;  1J4I A;  1JNE A;  1HKI A;  3OOB A;  1D2K A;  1U79 A;  1KT0 A;  5GPG A;  2KGJ A;  4ODL A;  3ALF A;  2PPN A;  1ZU8 A;  1QZ2 A;  1H0G A;  3ODK A;  3AS3 A;  3KAI A;  1Q1C A;  2DPE A;  3O5J A;  4MPK A;  4IQ2 A;  1FKT A;  4ODM A;  1EYM A;  4ODO A;  2M8J A;  1ZK6 A;  1C9H A;  2JXW A;  2YSF A;  1D6O A;  3CH9 A;  2WLZ A;  1FFQ A;  2ZQS A;  4ZPT R;  2RUD A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...