4U84A

Human pin1 with s-hydroxyl-cysteine 113
Total Genus 45
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
45
sequence length
157
structure length
144
Chain Sequence
LPPGWEKAMSRSSGRVYYFNHITNASQWERPSEPARVRCSHLLVKHSQSRRPSSWRQEKITRTKEEALELINGYIQKIKSGEEDFESLASQFSDSSAKARGDLGAFSRGQMQKPFEDASFALRTGEMSGPVFTDSGIHIILRTE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Pin1 cysteine-113 oxidation inhibits its catalytic activity and cellular function in Alzheimer's disease.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Isomerase
molecule keywords Peptidyl-prolyl cis-trans isomerase NIMA-interacting 1
total genus 45
structure length 144
sequence length 157
ec nomenclature ec 5.2.1.8: Peptidylprolyl isomerase.
pdb deposition date 2014-08-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00397 WW WW domain
A PF00639 Rotamase PPIC-type PPIASE domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.20.70.10 Mainly Beta Single Sheet Ubiquitin Ligase Nedd4; Chain: W; Ubiquitin Ligase Nedd4; Chain: W; 4u84A01
3.10.50.40 Alpha Beta Roll Chitinase A; domain 3 Chitinase A; domain 3 4u84A02
1K9RA 4J4NA 4TNSA 5BXJA 4JYSA 3ODKA 3GPKA 4R0XA 1FD9A 1D7HA 2M3OW 4DRMA 1W26A 4J4OA 5B8IC 5HW6A 2VCDA 4NNRA 4DH0A 3UI5A 3UI4A 5HUAA 5DITA 2ZR4A 1Y0OA 2MF9A 2ZQTA 2ITKA 2JXWA 3NRKA 3O5GA 4MGVA 2XP8A 1FKBA 1JNTA 1FAPA 1A7XA 2KFWA 3JYJA 3UF8A 4DRQA 2RURA 2PV1A 1FKGA 3JXVA 3O5FA 4DRNA 2DG4A 4IQ2A 5HWBA 1EG4A 2XP5A 2F4EA 5DIVA 1JMQA 1K9QA 4DRHA 4LAWA 1EG3A 1YATA 3CGNA 5HTGA 2LJ4A 4BF8A 4JFIA 3UI6A 2L4JA 3O5PA 4IPXA 4JFLA 2F21A 4ODOA 2PV2A 2LAJA 4QIBA 2ZR5A 4E5RA 5D75A 1Q1CA 4ODMA 2YSFA 2FAPA 3VAWA 3KAIA 4JFMA 4MSPA 4ODNA 1EYMA 2M8IA 1NMVA 3EY6A 3NTPA 5HWCA 2VN1A 2DMVA 2XPAA 1D6OA 2D9FA 3IK8A 2PBCA 4TW6A 2ZAJA 1R9HA 4REXA 1KT0A 2F2DA 1QZ2A 3O5DA 5HW7A 2M2AA 4U85A 3O5LA 2ZR6A 4LAYA 4G50A 2YSIA 2LGOA 1FKJA 1FKSA 2RQSA 2UZ5A 3PA7A 4ODKA 4DZ3A 5HW8A 5DIUA 2DJYA 2ZQUA 3KABA 2EZ5W 4N19A 4U84A 1ROUA 1KT1A 4ODPA 4QT3A 3TDBA 5CQ2A 3O5OA 4ODLA 2M1IA 2DG9A 1FKLA 2RUCA 5GPGA 3RFWA 4FAPA 1D7JA 2BA1A 1FKKA 2ZQSA 2LKNA 2KR7A 1TK7A 2AWGA 2MPHA 2PV3A 4TW7A 1FKIA 1FKRA 1Q6IA 4DRKA 2KI3A 2E45A 2YSGA 2L2SA 3CGMA 2KE0A 2LPVA 3KAHA 4LAVA 4W9PA 3I6CA 3UQBA 2K8IA 3UQAA 2MLYA 3LUOA 1JNSA 1ROTA 3O5IA 3KAFA 4ODQA 1F40A 1L1PA 3OOBA 4TW8A 4FN2A 2PPPA 4QT2A 2DWVA 1N1AA 5J6EA 2OFNA 2RSEA 1WR7A 1Q6HA 2MNTA 2ZQVA 2XP4A 1T11A 2JX8A 4U86A 5AHTA 1ZK6A 2Y78A 3PRBA 3TC5A 1BKFA 1J6YA 2Q5AA 3O5EA 2YSBA 3M85A 1FKFA 2XP6A 1NSGA 2FKEA 4DRPA 3O5RA 3KAGA 4TX0A 4DROA 3LE4A 2KXQA 2XP9A 1M5YA 4DRIA 4LAXA 2IF4A 1Q6UA 1B6CA 1F8AB 1WMVA 2JZVA 1QPLA 2DK1A 5HKGA 2JV4A 1D7IA 3KACA 4GIVA 1HXVA 2RUDA 4JFJA 1BL4A 1NMWA 3H9RB 2RE3A 1EQ3A 3RGCA 2M08A 4C02B 3M7NA 4TYOA 2YSHA 2XPBA 2PPOA 3NI6A 2MLXA 1YW5A 2DG3A 3CNGA 3TCZA 4DIPA 3O5MA 2JMFA 3KADA 2XP7A 1FKDA 1JVWA 1PBKA 2XP3A 3O5KA 2KO7A 1J4HA 5HT1A 1P5QA 2DK7A 1C9HA 2KGJA 3FAPA 3JYMA 1O6WA 3MDYB 3UQIA 4IQCA 4DRJA 1J4IA 1FKTA 3B7XA 4JFKA 3IKGA 2M8JA 3L4HA 1PINA 3KZ7A 4W9QA 2MLZA 3O5QA 1J4RA 1I5HW 3IKDA 2MDIA 4DZ2A 1U79A 4O2TA 3KCEA 2N87A 4G2PA 4GGQA 1TCOC 3O5JA 4ODRA 4W9OA 3WH0A 1ZCNA 1QPFA 2PPNA 2RUQA 4ITZA 4DT4A 1FKHA 5I98A 3PRDA 1FJDA 3IHZA
chains in the Genus database with same CATH superfamily
2A3EA 4JYSA 4R0XA 1D7HA 1UR8A 4DRMA 4J4OA 5B8IC 4NNRA 3UI4A 4ZPWR 1Y0OA 2MF9A 1HKKA 2JXWA 2DPEA 2XP8A 1JNTA 1A7XA 2RURA 1FKGA 3JXVA 1UR9A 1EG4A 4DWSC 1K9QA 4DRHA 3B8SA 1EG3A 1YATA 3CGNA 1NH6A 4BF8A 4JFIA 3UI6A 2L4JA 4ODOA 2F21A 2YSFA 3WD1A 3KAIA 3FY1A 4Q7NA 3EY6A 1NMVA 3FSBA 5HWCA 4KR0B 1D6OA 4WKFA 1ZB5A 1R9HA 1KT0A 3O5DA 3O5LA 4LAYA 4G50A 2YSIA 1FKSA 3WQWA 5DIUA 2ZQUA 3KABA 4XAKA 4N19A 4Z2KA 1KT1A 3TDBA 2M1IA 1LL7A 2BA1A 2ZQSA 4NSBA 2PV3A 2MPHA 3ARUA 1Q6IA 2KE0A 5E64A 3KAHA 1OGBA 2K8IA 2MLYA 1ROTA 3AQUA 4TW8A 2WADA 1W1VA 1EHNA 1WR7A 2MNTA 2XP4A 4U86A 5AHTA 2DT2A 1BKFA 1J6YA 1LQ0A 2YSBA 2FKEA 4HBEA 4DRPA 1GRJA 1M5YA 4LAXA 3AS2A 2YAJB 1D2KA 2DT3A 5HKGA 3MQHA 2OWOA 3RGCA 4TYOA 2XPBA 1FLCA 3CNGA 4L3NA 4GLXA 3O5MA 2AOSA 3KADA 3CH9A 2DK7A 3FAPA 1O6WA 1E9LA 1J4IA 2PI6A 4Z2GA 3B7XA 2G41A 2M8JA 2MLZA 1HKIA 4W5UA 4DZ2A 3WIJA 3AS1A 2DT0A 2N87A 3WD0A 5I98A 4MNMA 4TNSA 5BXJA 1NWRA 3ODKA 1XRVA 1HJWA 1O6IA 3RM8A 2VCDA 4DH0A 3UI5A 2QRVA 2ZR4A 1NWSA 3FXYA 2ITKA 3O5GA 1FKBA 1H0GA 3JYJA 3CHEA 4DRQA 3W4RA 4DRNA 2DG4A 3FS8A 4P8WA 5U47A 4JFLA 4IPXA 2ZR5A 4E5RA 5D75A 3ARQA 4JFMA 3WL0A 1EYMA 2DSVA 3ARRA 3CHCA 2DMVA 1ITXA 2WM0A 2DSUA 2D9FA 4Z2LA 2PBCA 2QF8A 4TW6A 1E44A 2ZR6A 1KFWA 2UZ5A 4ODKA 3ARZA 5HW8A 1W1TA 2PN0A 4MTVA 4A0UA 3EIPA 4ODPA 3ARYA 5CQ2A 4ODLA 4NZCA 2DG9A 1FKLA 2RUCA 3RFWA 3LKXA 4FAPA 1FKKA 2LKNA 2KR7A 1FKIA 3WKZA 3I6CA 1X6NA 1WNOA 3O5IA 1L1PA 2PPPA 1N1AA 1JNDA 3B9EA 1T11A 1RD6A 2F23A 3O5EA 1NSGA 4P8XA 3O5RA 3KAGA 3RM9A 3LE4A 2KXQA 4MNKA 1B6CA 3MQGA 1WMVA 4ZS6A 1QPLA 1EIBA 5E65A 3CHDA 4DWSB 3RM4A 4WKAA 3H9RB 3BMBA 1EQ3A 4C02B 3M7NA 4WKHA 4QZVB 2WLZA 3TCZA 1WB0A 2JMFA 1JVWA 3MCBA 4Z2JA 3O5KA 2KO7A 2IUZA 1GOIA 4MAVA 4JFKA 4Z2IA 4MPKA 4MNLA 3CZ8A 3KZ7A 3O5QA 1J4RA 1I5HW 1EDQA 2MDIA 3IKDA 5HBFA 1U79A 3KCEA 3B9AA 3O5JA 4ODRA 1ZCNA 3CHFA 1QPFA 3WD4A 1FKHA 3ALFA 1VF8A 4PTMA 1H0IA 1K9RA 3WD2A 3GPKA 2M3OW 1LL6A 4KQZA 2DSWA 5HUAA 5DITA 1ZBVA 1E6PA 1LG1A 3NRKA 4MGVA 1GPFA 2KFWA 2DT1A 2PV1A 3O5FA 3FSCA 2XP5A 1JMQA 2WAEA 1OWQA 4LAWA 4HARA 5HTGA 2LJ4A 1LL4A 2B5UB 1ZL1A 3O5PA 2PV2A 1Q1CA 4ODMA 4MSPA 4ODNA 2M8IA 3NTPA 3B9DA 1ZU8A 2VN1A 3WD3A 1IX5A 3MCBB 5GPRA 3IK8A 2ZAJA 2F2DA 2LGOA 3PA7A 1FKJA 1W1YA 1GUVA 4DZ3A 4DWSA 1W1PA 2EZ5W 4S3KA 4HBOA 1D7JA 4IT6A 2WK2A 2A3AA 4ZPTR 2FDMA 2E45A 4W9OA 3CGMA 2LPVA 3UQAA 3PRAA 1XHGA 1F40A 2RSEA 1Q6HA 2ZQVA 3BXWA 1ZK6A 3TC5A 1JCHB 4WIWA 2B31A 2Q5AA 5DF0A 3M85A 1FKFA 2XP6A 1WAWA 2YBTA 1LJYA 4TX0A 5GQBA 4A0TA 4R5EA 2IF4A 1CTNA 1TFVA 2DSZA 2DK1A 1D7IA 3ARSA 3KACA 4GIVA 1HJXA 2G8ZA 2RUDA 1HXVA 1BL4A 1NMWA 2RE3A 2M08A 5DO2A 2YSHA 3G6LA 3GU0A 3NI6A 1SR0A 2DG3A 1FFRA 1SYTA 2XP7A 1FKDA 5E62A 1E6NA 1PBKA 2XP3A 3OA5A 1J4HA 4UDMA 5HT1A 1P5QA 4URIA 1C9HA 3JYMA 4DRJA 3MDYB 1W9VA 4WJXA 3L4HA 2A3BA 4P8UA 1HJVA 1PINA 4W9QA 1E6ZA 3AS0A 1FFQA 4O2TA 3WH0A 2RUQA 4Z2HA 4DT4A 3PRDA 1FJDA 3PQHA 1W9UA 1E15A 4J4NA 3AS3A 1FD9A 4ZPVR 1W26A 3ARTA 5HW6A 3QOKA 2ZQTA 1JNEA 1FAPA 3UF8A 2O9OA 4IQ2A 5HWBA 2F4EA 5DIVA 2ESCA 4S3JA 2LAJA 4QIBA 3VAWA 2FAPA 1RP5A 2A3CA 4Q22A 2XPAA 1ZBWA 1K9TA 3G6MA 4REXA 1QZ2A 3ARPA 2M2AA 4U85A 3PR9A 2RQSA 5HW7A 2DJYA 4U84A 1ROUA 4QT3A 5GPGA 3O5OA 4WK9A 3ARXA 3RMEA 1TK7A 2AWGA 4TW7A 1FKRA 4DRKA 2KI3A 2YSGA 1W9PA 2L2SA 4LAVA 4W9PA 1X6LA 3GTYX 3UQBA 3LUOA 1JNSA 3KAFA 4ODQA 3OOBA 5DEZA 4FN2A 4QT2A 5J6EA 2DWVA 3ARVA 5E5WA 3ALGA 2OFNA 2JX8A 1E6RA 2Y78A 3PRBA 2ETNA 4DROA 2XP9A 5E66A 4DRIA 5JH8A 1Q6UA 2WLYA 4ML4A 2OLHA 1F8AB 1HKMA 2JZVA 4MNJA 2JV4A 4AY1A 1HKJA 4JFJA 4IT4A 4LGXA 1ZBKA 2PPOA 2MLXA 1YW5A 4DIPA 3ARWA 1NWUA 1LG2A 2P4VA 1NWTA 2KGJA 3LKXB 2YBUA 3UQIA 4IQCA 1FKTA 3IKGA 3WQVA 4DWSD 1TR8A 2O92A 3AROA 4P8VA 3WL1A 4G2PA 4GGQA 1TCOC 1ZBCA 1OGGA 2PPNA 4ITZA 2EULA 2Y8NB 4L72B 3IHZA
chains in the Genus database with same CATH topology
2A3EA 4JYSA 4R0XA 1D7HA 1UR8A 4DRMA 4J4OA 5B8IC 4NNRA 3UI4A 4ZPWR 1Y0OA 2MF9A 1HKKA 2JXWA 2DPEA 2XP8A 1JNTA 1A7XA 2RURA 1FKGA 3JXVA 1UR9A 1EG4A 4DWSC 1K9QA 4DRHA 3B8SA 1EG3A 1YATA 3CGNA 1NH6A 4BF8A 4JFIA 3UI6A 2L4JA 4ODOA 2F21A 2YSFA 3WD1A 3KAIA 3FY1A 4Q7NA 3EY6A 1NMVA 3FSBA 5HWCA 4KR0B 1D6OA 4WKFA 1ZB5A 1R9HA 1KT0A 3O5DA 3O5LA 4LAYA 4G50A 2YSIA 1FKSA 3WQWA 5DIUA 2ZQUA 3KABA 4XAKA 4N19A 4Z2KA 1KT1A 3TDBA 2M1IA 1LL7A 2BA1A 2ZQSA 4NSBA 2PV3A 2MPHA 3ARUA 1Q6IA 2KE0A 5E64A 3KAHA 1OGBA 2K8IA 2MLYA 1ROTA 3AQUA 4TW8A 2WADA 1W1VA 1EHNA 1WR7A 2MNTA 2XP4A 4U86A 5AHTA 2DT2A 1BKFA 1J6YA 1LQ0A 2YSBA 2FKEA 4HBEA 4DRPA 1M5YA 4LAXA 3AS2A 2YAJB 1D2KA 2DT3A 5HKGA 3MQHA 2OWOA 3RGCA 4TYOA 2XPBA 1FLCA 3CNGA 4L3NA 4GLXA 3O5MA 2AOSA 3KADA 3CH9A 2DK7A 3FAPA 1O6WA 1E9LA 1J4IA 2PI6A 4Z2GA 3B7XA 2G41A 2M8JA 2MLZA 1HKIA 4W5UA 4DZ2A 3WIJA 3AS1A 2DT0A 2N87A 3WD0A 5I98A 4MNMA 4TNSA 5BXJA 1NWRA 3ODKA 1XRVA 1HJWA 1O6IA 3RM8A 2VCDA 4DH0A 3UI5A 2QRVA 2ZR4A 1NWSA 3FXYA 2ITKA 3O5GA 1FKBA 1H0GA 3JYJA 3CHEA 4DRQA 3W4RA 4DRNA 2DG4A 3FS8A 4P8WA 5U47A 4JFLA 4IPXA 2ZR5A 4E5RA 5D75A 3ARQA 4JFMA 3WL0A 1EYMA 2DSVA 3ARRA 3CHCA 2DMVA 1ITXA 2WM0A 2DSUA 2D9FA 4Z2LA 2PBCA 2QF8A 4TW6A 2ZR6A 1KFWA 2UZ5A 4ODKA 3ARZA 5HW8A 1W1TA 4MTVA 4A0UA 4ODPA 3ARYA 5CQ2A 4ODLA 4NZCA 2DG9A 1FKLA 2RUCA 3RFWA 3LKXA 4FAPA 1FKKA 2LKNA 2KR7A 1FKIA 3WKZA 3I6CA 1X6NA 1WNOA 3O5IA 1L1PA 2PPPA 1N1AA 1JNDA 3B9EA 1T11A 1RD6A 3O5EA 1NSGA 4P8XA 3O5RA 3KAGA 3RM9A 3LE4A 2KXQA 4MNKA 1B6CA 3MQGA 1WMVA 4ZS6A 1QPLA 1EIBA 5E65A 3CHDA 4DWSB 3RM4A 4WKAA 3H9RB 1EQ3A 4C02B 3M7NA 4WKHA 4QZVB 2WLZA 3TCZA 1WB0A 2JMFA 1JVWA 3MCBA 4Z2JA 3O5KA 2KO7A 2IUZA 1GOIA 4MAVA 4JFKA 4Z2IA 4MPKA 4MNLA 3CZ8A 3KZ7A 3O5QA 1J4RA 1I5HW 1EDQA 2MDIA 3IKDA 5HBFA 1U79A 3KCEA 3B9AA 3O5JA 4ODRA 1ZCNA 3CHFA 1QPFA 3WD4A 1FKHA 3ALFA 1VF8A 4PTMA 1H0IA 1K9RA 3WD2A 3GPKA 2M3OW 1LL6A 4KQZA 2DSWA 5HUAA 5DITA 1ZBVA 1E6PA 1LG1A 3NRKA 4MGVA 1GPFA 2KFWA 2DT1A 2PV1A 3O5FA 3FSCA 2XP5A 1JMQA 2WAEA 1OWQA 4LAWA 4HARA 5HTGA 2LJ4A 1LL4A 1ZL1A 3O5PA 2PV2A 1Q1CA 4ODMA 4MSPA 4ODNA 2M8IA 3NTPA 3B9DA 1ZU8A 2VN1A 3WD3A 1IX5A 3MCBB 5GPRA 3IK8A 2ZAJA 2F2DA 2LGOA 3PA7A 1FKJA 1W1YA 1GUVA 4DZ3A 4DWSA 1W1PA 2EZ5W 4S3KA 4HBOA 1D7JA 4IT6A 2WK2A 2A3AA 4ZPTR 2FDMA 2E45A 4W9OA 3CGMA 2LPVA 3UQAA 3PRAA 1XHGA 1F40A 2RSEA 1Q6HA 2ZQVA 3BXWA 1ZK6A 3TC5A 4WIWA 2B31A 2Q5AA 5DF0A 3M85A 1FKFA 2XP6A 1WAWA 2YBTA 1LJYA 4TX0A 5GQBA 4A0TA 4R5EA 2IF4A 1CTNA 1TFVA 2DSZA 2DK1A 1D7IA 3ARSA 3KACA 4GIVA 1HJXA 2G8ZA 2RUDA 1HXVA 1BL4A 1NMWA 2RE3A 2M08A 5DO2A 2YSHA 3G6LA 3NI6A 1SR0A 2DG3A 1FFRA 1SYTA 2XP7A 1FKDA 5E62A 1E6NA 1PBKA 2XP3A 3OA5A 1J4HA 5HT1A 1P5QA 4URIA 1C9HA 3JYMA 4DRJA 3MDYB 1W9VA 4WJXA 3L4HA 2A3BA 4P8UA 1HJVA 1PINA 4W9QA 1E6ZA 3AS0A 1FFQA 4O2TA 3WH0A 2RUQA 4Z2HA 4DT4A 3PRDA 1FJDA 3PQHA 1W9UA 1E15A 4J4NA 3AS3A 1FD9A 4ZPVR 1W26A 3ARTA 5HW6A 3QOKA 2ZQTA 1JNEA 1FAPA 3UF8A 2O9OA 4IQ2A 5HWBA 2F4EA 5DIVA 2ESCA 4S3JA 2LAJA 4QIBA 3VAWA 2FAPA 1RP5A 2A3CA 4Q22A 2XPAA 1ZBWA 1K9TA 3G6MA 4REXA 1QZ2A 3ARPA 2M2AA 4U85A 3PR9A 2RQSA 5HW7A 2DJYA 4U84A 1ROUA 4QT3A 5GPGA 3O5OA 4WK9A 3ARXA 3RMEA 1TK7A 2AWGA 4TW7A 1FKRA 4DRKA 2KI3A 2YSGA 1W9PA 2L2SA 4LAVA 4W9PA 1X6LA 3UQBA 3LUOA 1JNSA 3KAFA 4ODQA 3OOBA 5DEZA 4FN2A 4QT2A 5J6EA 2DWVA 3ARVA 5E5WA 3ALGA 2OFNA 2JX8A 1E6RA 2Y78A 3PRBA 4DROA 2XP9A 5E66A 4DRIA 5JH8A 1Q6UA 2WLYA 4ML4A 2OLHA 1F8AB 1HKMA 2JZVA 4MNJA 2JV4A 4AY1A 1HKJA 4JFJA 4IT4A 4LGXA 1ZBKA 2PPOA 2MLXA 1YW5A 4DIPA 3ARWA 1NWUA 1LG2A 1NWTA 2KGJA 3LKXB 2YBUA 3UQIA 4IQCA 1FKTA 3IKGA 3WQVA 4DWSD 1TR8A 2O92A 3AROA 4P8VA 3WL1A 4G2PA 4GGQA 1TCOC 1ZBCA 1OGGA 2PPNA 4ITZA 2Y8NB 4L72B 3IHZA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1K9R A;  4J4N A;  4TNS A;  5BXJ A;  4JYS A;  3ODK A;  3GPK A;  4R0X A;  1FD9 A;  1D7H A;  2M3O W;  4DRM A;  1W26 A;  4J4O A;  5B8I C;  5HW6 A;  2VCD A;  4NNR A;  4DH0 A;  3UI5 A;  3UI4 A;  5HUA A;  5DIT A;  2ZR4 A;  1Y0O A;  2MF9 A;  2ZQT A;  2ITK A;  2JXW A;  3NRK A;  3O5G A;  4MGV A;  2XP8 A;  1FKB A;  1JNT A;  1FAP A;  1A7X A;  2KFW A;  3JYJ A;  3UF8 A;  4DRQ A;  2RUR A;  2PV1 A;  1FKG A;  3JXV A;  3O5F A;  4DRN A;  2DG4 A;  4IQ2 A;  5HWB A;  1EG4 A;  2XP5 A;  2F4E A;  5DIV A;  1JMQ A;  1K9Q A;  4DRH A;  4LAW A;  1EG3 A;  1YAT A;  3CGN A;  5HTG A;  2LJ4 A;  4BF8 A;  4JFI A;  3UI6 A;  2L4J A;  3O5P A;  4IPX A;  4JFL A;  2F21 A;  4ODO A;  2PV2 A;  2LAJ A;  4QIB A;  2ZR5 A;  4E5R A;  5D75 A;  1Q1C A;  4ODM A;  2YSF A;  2FAP A;  3VAW A;  3KAI A;  4JFM A;  4MSP A;  4ODN A;  1EYM A;  2M8I A;  1NMV A;  3EY6 A;  3NTP A;  5HWC A;  2VN1 A;  2DMV A;  2XPA A;  1D6O A;  2D9F A;  3IK8 A;  2PBC A;  4TW6 A;  2ZAJ A;  1R9H A;  4REX A;  1KT0 A;  2F2D A;  1QZ2 A;  3O5D A;  5HW7 A;  2M2A A;  4U85 A;  3O5L A;  2ZR6 A;  4LAY A;  4G50 A;  2YSI A;  2LGO A;  1FKJ A;  1FKS A;  2RQS A;  2UZ5 A;  3PA7 A;  4ODK A;  4DZ3 A;  5HW8 A;  5DIU A;  2DJY A;  2ZQU A;  3KAB A;  2EZ5 W;  4N19 A;  4U84 A;  1ROU A;  1KT1 A;  4ODP A;  4QT3 A;  3TDB A;  5CQ2 A;  3O5O A;  4ODL A;  2M1I A;  2DG9 A;  1FKL A;  2RUC A;  5GPG A;  3RFW A;  4FAP A;  1D7J A;  2BA1 A;  1FKK A;  2ZQS A;  2LKN A;  2KR7 A;  1TK7 A;  2AWG A;  2MPH A;  2PV3 A;  4TW7 A;  1FKI A;  1FKR A;  1Q6I A;  4DRK A;  2KI3 A;  2E45 A;  2YSG A;  2L2S A;  3CGM A;  2KE0 A;  2LPV A;  3KAH A;  4LAV A;  4W9P A;  3I6C A;  3UQB A;  2K8I A;  3UQA A;  2MLY A;  3LUO A;  1JNS A;  1ROT A;  3O5I A;  3KAF A;  4ODQ A;  1F40 A;  1L1P A;  3OOB A;  4TW8 A;  4FN2 A;  2PPP A;  4QT2 A;  2DWV A;  1N1A A;  5J6E A;  2OFN A;  2RSE A;  1WR7 A;  1Q6H A;  2MNT A;  2ZQV A;  2XP4 A;  1T11 A;  2JX8 A;  4U86 A;  5AHT A;  1ZK6 A;  2Y78 A;  3PRB A;  3TC5 A;  1BKF A;  1J6Y A;  2Q5A A;  3O5E A;  2YSB A;  3M85 A;  1FKF A;  2XP6 A;  1NSG A;  2FKE A;  4DRP A;  3O5R A;  3KAG A;  4TX0 A;  4DRO A;  3LE4 A;  2KXQ A;  2XP9 A;  1M5Y A;  4DRI A;  4LAX A;  2IF4 A;  1Q6U A;  1B6C A;  1F8A B;  1WMV A;  2JZV A;  1QPL A;  2DK1 A;  5HKG A;  2JV4 A;  1D7I A;  3KAC A;  4GIV A;  1HXV A;  2RUD A;  4JFJ A;  1BL4 A;  1NMW A;  3H9R B;  2RE3 A;  1EQ3 A;  3RGC A;  2M08 A;  4C02 B;  3M7N A;  4TYO A;  2YSH A;  2XPB A;  2PPO A;  3NI6 A;  2MLX A;  1YW5 A;  2DG3 A;  3CNG A;  3TCZ A;  4DIP A;  3O5M A;  2JMF A;  3KAD A;  2XP7 A;  1FKD A;  1JVW A;  1PBK A;  2XP3 A;  3O5K A;  2KO7 A;  1J4H A;  5HT1 A;  1P5Q A;  2DK7 A;  1C9H A;  2KGJ A;  3FAP A;  3JYM A;  1O6W A;  3MDY B;  3UQI A;  4IQC A;  4DRJ A;  1J4I A;  1FKT A;  3B7X A;  4JFK A;  3IKG A;  2M8J A;  3L4H A;  1PIN A;  3KZ7 A;  4W9Q A;  2MLZ A;  3O5Q A;  1J4R A;  1I5H W;  3IKD A;  2MDI A;  4DZ2 A;  1U79 A;  4O2T A;  3KCE A;  2N87 A;  4G2P A;  4GGQ A;  1TCO C;  3O5J A;  4ODR A;  4W9O A;  3WH0 A;  1ZCN A;  1QPF A;  2PPN A;  2RUQ A;  4ITZ A;  4DT4 A;  1FKH A;  5I98 A;  3PRD A;  1FJD A;  3IHZ A; 
#chains in the Genus database with same CATH topology
 2A3E A;  4JYS A;  4R0X A;  1D7H A;  1UR8 A;  4DRM A;  4J4O A;  5B8I C;  4NNR A;  3UI4 A;  4ZPW R;  1Y0O A;  2MF9 A;  1HKK A;  2JXW A;  2DPE A;  2XP8 A;  1JNT A;  1A7X A;  2RUR A;  1FKG A;  3JXV A;  1UR9 A;  1EG4 A;  4DWS C;  1K9Q A;  4DRH A;  3B8S A;  1EG3 A;  1YAT A;  3CGN A;  1NH6 A;  4BF8 A;  4JFI A;  3UI6 A;  2L4J A;  4ODO A;  2F21 A;  2YSF A;  3WD1 A;  3KAI A;  3FY1 A;  4Q7N A;  3EY6 A;  1NMV A;  3FSB A;  5HWC A;  4KR0 B;  1D6O A;  4WKF A;  1ZB5 A;  1R9H A;  1KT0 A;  3O5D A;  3O5L A;  4LAY A;  4G50 A;  2YSI A;  1FKS A;  3WQW A;  5DIU A;  2ZQU A;  3KAB A;  4XAK A;  4N19 A;  4Z2K A;  1KT1 A;  3TDB A;  2M1I A;  1LL7 A;  2BA1 A;  2ZQS A;  4NSB A;  2PV3 A;  2MPH A;  3ARU A;  1Q6I A;  2KE0 A;  5E64 A;  3KAH A;  1OGB A;  2K8I A;  2MLY A;  1ROT A;  3AQU A;  4TW8 A;  2WAD A;  1W1V A;  1EHN A;  1WR7 A;  2MNT A;  2XP4 A;  4U86 A;  5AHT A;  2DT2 A;  1BKF A;  1J6Y A;  1LQ0 A;  2YSB A;  2FKE A;  4HBE A;  4DRP A;  1GRJ A;  1M5Y A;  4LAX A;  3AS2 A;  2YAJ B;  1D2K A;  2DT3 A;  5HKG A;  3MQH A;  2OWO A;  3RGC A;  4TYO A;  2XPB A;  1FLC A;  3CNG A;  4L3N A;  4GLX A;  3O5M A;  2AOS A;  3KAD A;  3CH9 A;  2DK7 A;  3FAP A;  1O6W A;  1E9L A;  1J4I A;  2PI6 A;  4Z2G A;  3B7X A;  2G41 A;  2M8J A;  2MLZ A;  1HKI A;  4W5U A;  4DZ2 A;  3WIJ A;  3AS1 A;  2DT0 A;  2N87 A;  3WD0 A;  5I98 A;  4MNM A;  4TNS A;  5BXJ A;  1NWR A;  3ODK A;  1XRV A;  1HJW A;  1O6I A;  3RM8 A;  2VCD A;  4DH0 A;  3UI5 A;  2QRV A;  2ZR4 A;  1NWS A;  3FXY A;  2ITK A;  3O5G A;  1FKB A;  1H0G A;  3JYJ A;  3CHE A;  4DRQ A;  3W4R A;  4DRN A;  2DG4 A;  3FS8 A;  4P8W A;  5U47 A;  4JFL A;  4IPX A;  2ZR5 A;  4E5R A;  5D75 A;  3ARQ A;  4JFM A;  3WL0 A;  1EYM A;  2DSV A;  3ARR A;  3CHC A;  2DMV A;  1ITX A;  2WM0 A;  2DSU A;  2D9F A;  4Z2L A;  2PBC A;  2QF8 A;  4TW6 A;  1E44 A;  2ZR6 A;  1KFW A;  2UZ5 A;  4ODK A;  3ARZ A;  5HW8 A;  1W1T A;  2PN0 A;  4MTV A;  4A0U A;  3EIP A;  4ODP A;  3ARY A;  5CQ2 A;  4ODL A;  4NZC A;  2DG9 A;  1FKL A;  2RUC A;  3RFW A;  3LKX A;  4FAP A;  1FKK A;  2LKN A;  2KR7 A;  1FKI A;  3WKZ A;  3I6C A;  1X6N A;  1WNO A;  3O5I A;  1L1P A;  2PPP A;  1N1A A;  1JND A;  3B9E A;  1T11 A;  1RD6 A;  2F23 A;  3O5E A;  1NSG A;  4P8X A;  3O5R A;  3KAG A;  3RM9 A;  3LE4 A;  2KXQ A;  4MNK A;  1B6C A;  3MQG A;  1WMV A;  4ZS6 A;  1QPL A;  1EIB A;  5E65 A;  3CHD A;  4DWS B;  3RM4 A;  4WKA A;  3H9R B;  3BMB A;  1EQ3 A;  4C02 B;  3M7N A;  4WKH A;  4QZV B;  2WLZ A;  3TCZ A;  1WB0 A;  2JMF A;  1JVW A;  3MCB A;  4Z2J A;  3O5K A;  2KO7 A;  2IUZ A;  1GOI A;  4MAV A;  4JFK A;  4Z2I A;  4MPK A;  4MNL A;  3CZ8 A;  3KZ7 A;  3O5Q A;  1J4R A;  1I5H W;  1EDQ A;  2MDI A;  3IKD A;  5HBF A;  1U79 A;  3KCE A;  3B9A A;  3O5J A;  4ODR A;  1ZCN A;  3CHF A;  1QPF A;  3WD4 A;  1FKH A;  3ALF A;  1VF8 A;  4PTM A;  1H0I A;  1K9R A;  3WD2 A;  3GPK A;  2M3O W;  1LL6 A;  4KQZ A;  2DSW A;  5HUA A;  5DIT A;  1ZBV A;  1E6P A;  1LG1 A;  3NRK A;  4MGV A;  1GPF A;  2KFW A;  2DT1 A;  2PV1 A;  3O5F A;  3FSC A;  2XP5 A;  1JMQ A;  2WAE A;  1OWQ A;  4LAW A;  4HAR A;  5HTG A;  2LJ4 A;  1LL4 A;  2B5U B;  1ZL1 A;  3O5P A;  2PV2 A;  1Q1C A;  4ODM A;  4MSP A;  4ODN A;  2M8I A;  3NTP A;  3B9D A;  1ZU8 A;  2VN1 A;  3WD3 A;  1IX5 A;  3MCB B;  5GPR A;  3IK8 A;  2ZAJ A;  2F2D A;  2LGO A;  3PA7 A;  1FKJ A;  1W1Y A;  1GUV A;  4DZ3 A;  4DWS A;  1W1P A;  2EZ5 W;  4S3K A;  4HBO A;  1D7J A;  4IT6 A;  2WK2 A;  2A3A A;  4ZPT R;  2FDM A;  2E45 A;  4W9O A;  3CGM A;  2LPV A;  3UQA A;  3PRA A;  1XHG A;  1F40 A;  2RSE A;  1Q6H A;  2ZQV A;  3BXW A;  1ZK6 A;  3TC5 A;  1JCH B;  4WIW A;  2B31 A;  2Q5A A;  5DF0 A;  3M85 A;  1FKF A;  2XP6 A;  1WAW A;  2YBT A;  1LJY A;  4TX0 A;  5GQB A;  4A0T A;  4R5E A;  2IF4 A;  1CTN A;  1TFV A;  2DSZ A;  2DK1 A;  1D7I A;  3ARS A;  3KAC A;  4GIV A;  1HJX A;  2G8Z A;  2RUD A;  1HXV A;  1BL4 A;  1NMW A;  2RE3 A;  2M08 A;  5DO2 A;  2YSH A;  3G6L A;  3GU0 A;  3NI6 A;  1SR0 A;  2DG3 A;  1FFR A;  1SYT A;  2XP7 A;  1FKD A;  5E62 A;  1E6N A;  1PBK A;  2XP3 A;  3OA5 A;  1J4H A;  4UDM A;  5HT1 A;  1P5Q A;  4URI A;  1C9H A;  3JYM A;  4DRJ A;  3MDY B;  1W9V A;  4WJX A;  3L4H A;  2A3B A;  4P8U A;  1HJV A;  1PIN A;  4W9Q A;  1E6Z A;  3AS0 A;  1FFQ A;  4O2T A;  3WH0 A;  2RUQ A;  4Z2H A;  4DT4 A;  3PRD A;  1FJD A;  3PQH A;  1W9U A;  1E15 A;  4J4N A;  3AS3 A;  1FD9 A;  4ZPV R;  1W26 A;  3ART A;  5HW6 A;  3QOK A;  2ZQT A;  1JNE A;  1FAP A;  3UF8 A;  2O9O A;  4IQ2 A;  5HWB A;  2F4E A;  5DIV A;  2ESC A;  4S3J A;  2LAJ A;  4QIB A;  3VAW A;  2FAP A;  1RP5 A;  2A3C A;  4Q22 A;  2XPA A;  1ZBW A;  1K9T A;  3G6M A;  4REX A;  1QZ2 A;  3ARP A;  2M2A A;  4U85 A;  3PR9 A;  2RQS A;  5HW7 A;  2DJY A;  4U84 A;  1ROU A;  4QT3 A;  5GPG A;  3O5O A;  4WK9 A;  3ARX A;  3RME A;  1TK7 A;  2AWG A;  4TW7 A;  1FKR A;  4DRK A;  2KI3 A;  2YSG A;  1W9P A;  2L2S A;  4LAV A;  4W9P A;  1X6L A;  3GTY X;  3UQB A;  3LUO A;  1JNS A;  3KAF A;  4ODQ A;  3OOB A;  5DEZ A;  4FN2 A;  4QT2 A;  5J6E A;  2DWV A;  3ARV A;  5E5W A;  3ALG A;  2OFN A;  2JX8 A;  1E6R A;  2Y78 A;  3PRB A;  2ETN A;  4DRO A;  2XP9 A;  5E66 A;  4DRI A;  5JH8 A;  1Q6U A;  2WLY A;  4ML4 A;  2OLH A;  1F8A B;  1HKM A;  2JZV A;  4MNJ A;  2JV4 A;  4AY1 A;  1HKJ A;  4JFJ A;  4IT4 A;  4LGX A;  1ZBK A;  2PPO A;  2MLX A;  1YW5 A;  4DIP A;  3ARW A;  1NWU A;  1LG2 A;  2P4V A;  1NWT A;  2KGJ A;  3LKX B;  2YBU A;  3UQI A;  4IQC A;  1FKT A;  3IKG A;  3WQV A;  4DWS D;  1TR8 A;  2O92 A;  3ARO A;  4P8V A;  3WL1 A;  4G2P A;  4GGQ A;  1TCO C;  1ZBC A;  1OGG A;  2PPN A;  4ITZ A;  2EUL A;  2Y8N B;  4L72 B;  3IHZ A; 
#chains in the Genus database with same CATH homology
 2A3E A;  4JYS A;  4R0X A;  1D7H A;  1UR8 A;  4DRM A;  4J4O A;  5B8I C;  4NNR A;  3UI4 A;  4ZPW R;  1Y0O A;  2MF9 A;  1HKK A;  2JXW A;  2DPE A;  2XP8 A;  1JNT A;  1A7X A;  2RUR A;  1FKG A;  3JXV A;  1UR9 A;  1EG4 A;  4DWS C;  1K9Q A;  4DRH A;  3B8S A;  1EG3 A;  1YAT A;  3CGN A;  1NH6 A;  4BF8 A;  4JFI A;  3UI6 A;  2L4J A;  4ODO A;  2F21 A;  2YSF A;  3WD1 A;  3KAI A;  3FY1 A;  4Q7N A;  3EY6 A;  1NMV A;  3FSB A;  5HWC A;  4KR0 B;  1D6O A;  4WKF A;  1ZB5 A;  1R9H A;  1KT0 A;  3O5D A;  3O5L A;  4LAY A;  4G50 A;  2YSI A;  1FKS A;  3WQW A;  5DIU A;  2ZQU A;  3KAB A;  4XAK A;  4N19 A;  4Z2K A;  1KT1 A;  3TDB A;  2M1I A;  1LL7 A;  2BA1 A;  2ZQS A;  4NSB A;  2PV3 A;  2MPH A;  3ARU A;  1Q6I A;  2KE0 A;  5E64 A;  3KAH A;  1OGB A;  2K8I A;  2MLY A;  1ROT A;  3AQU A;  4TW8 A;  2WAD A;  1W1V A;  1EHN A;  1WR7 A;  2MNT A;  2XP4 A;  4U86 A;  5AHT A;  2DT2 A;  1BKF A;  1J6Y A;  1LQ0 A;  2YSB A;  2FKE A;  4HBE A;  4DRP A;  1M5Y A;  4LAX A;  3AS2 A;  2YAJ B;  1D2K A;  2DT3 A;  5HKG A;  3MQH A;  2OWO A;  3RGC A;  4TYO A;  2XPB A;  1FLC A;  3CNG A;  4L3N A;  4GLX A;  3O5M A;  2AOS A;  3KAD A;  3CH9 A;  2DK7 A;  3FAP A;  1O6W A;  1E9L A;  1J4I A;  2PI6 A;  4Z2G A;  3B7X A;  2G41 A;  2M8J A;  2MLZ A;  1HKI A;  4W5U A;  4DZ2 A;  3WIJ A;  3AS1 A;  2DT0 A;  2N87 A;  3WD0 A;  5I98 A;  4MNM A;  4TNS A;  5BXJ A;  1NWR A;  3ODK A;  1XRV A;  1HJW A;  1O6I A;  3RM8 A;  2VCD A;  4DH0 A;  3UI5 A;  2QRV A;  2ZR4 A;  1NWS A;  3FXY A;  2ITK A;  3O5G A;  1FKB A;  1H0G A;  3JYJ A;  3CHE A;  4DRQ A;  3W4R A;  4DRN A;  2DG4 A;  3FS8 A;  4P8W A;  5U47 A;  4JFL A;  4IPX A;  2ZR5 A;  4E5R A;  5D75 A;  3ARQ A;  4JFM A;  3WL0 A;  1EYM A;  2DSV A;  3ARR A;  3CHC A;  2DMV A;  1ITX A;  2WM0 A;  2DSU A;  2D9F A;  4Z2L A;  2PBC A;  2QF8 A;  4TW6 A;  2ZR6 A;  1KFW A;  2UZ5 A;  4ODK A;  3ARZ A;  5HW8 A;  1W1T A;  4MTV A;  4A0U A;  4ODP A;  3ARY A;  5CQ2 A;  4ODL A;  4NZC A;  2DG9 A;  1FKL A;  2RUC A;  3RFW A;  3LKX A;  4FAP A;  1FKK A;  2LKN A;  2KR7 A;  1FKI A;  3WKZ A;  3I6C A;  1X6N A;  1WNO A;  3O5I A;  1L1P A;  2PPP A;  1N1A A;  1JND A;  3B9E A;  1T11 A;  1RD6 A;  3O5E A;  1NSG A;  4P8X A;  3O5R A;  3KAG A;  3RM9 A;  3LE4 A;  2KXQ A;  4MNK A;  1B6C A;  3MQG A;  1WMV A;  4ZS6 A;  1QPL A;  1EIB A;  5E65 A;  3CHD A;  4DWS B;  3RM4 A;  4WKA A;  3H9R B;  1EQ3 A;  4C02 B;  3M7N A;  4WKH A;  4QZV B;  2WLZ A;  3TCZ A;  1WB0 A;  2JMF A;  1JVW A;  3MCB A;  4Z2J A;  3O5K A;  2KO7 A;  2IUZ A;  1GOI A;  4MAV A;  4JFK A;  4Z2I A;  4MPK A;  4MNL A;  3CZ8 A;  3KZ7 A;  3O5Q A;  1J4R A;  1I5H W;  1EDQ A;  2MDI A;  3IKD A;  5HBF A;  1U79 A;  3KCE A;  3B9A A;  3O5J A;  4ODR A;  1ZCN A;  3CHF A;  1QPF A;  3WD4 A;  1FKH A;  3ALF A;  1VF8 A;  4PTM A;  1H0I A;  1K9R A;  3WD2 A;  3GPK A;  2M3O W;  1LL6 A;  4KQZ A;  2DSW A;  5HUA A;  5DIT A;  1ZBV A;  1E6P A;  1LG1 A;  3NRK A;  4MGV A;  1GPF A;  2KFW A;  2DT1 A;  2PV1 A;  3O5F A;  3FSC A;  2XP5 A;  1JMQ A;  2WAE A;  1OWQ A;  4LAW A;  4HAR A;  5HTG A;  2LJ4 A;  1LL4 A;  1ZL1 A;  3O5P A;  2PV2 A;  1Q1C A;  4ODM A;  4MSP A;  4ODN A;  2M8I A;  3NTP A;  3B9D A;  1ZU8 A;  2VN1 A;  3WD3 A;  1IX5 A;  3MCB B;  5GPR A;  3IK8 A;  2ZAJ A;  2F2D A;  2LGO A;  3PA7 A;  1FKJ A;  1W1Y A;  1GUV A;  4DZ3 A;  4DWS A;  1W1P A;  2EZ5 W;  4S3K A;  4HBO A;  1D7J A;  4IT6 A;  2WK2 A;  2A3A A;  4ZPT R;  2FDM A;  2E45 A;  4W9O A;  3CGM A;  2LPV A;  3UQA A;  3PRA A;  1XHG A;  1F40 A;  2RSE A;  1Q6H A;  2ZQV A;  3BXW A;  1ZK6 A;  3TC5 A;  4WIW A;  2B31 A;  2Q5A A;  5DF0 A;  3M85 A;  1FKF A;  2XP6 A;  1WAW A;  2YBT A;  1LJY A;  4TX0 A;  5GQB A;  4A0T A;  4R5E A;  2IF4 A;  1CTN A;  1TFV A;  2DSZ A;  2DK1 A;  1D7I A;  3ARS A;  3KAC A;  4GIV A;  1HJX A;  2G8Z A;  2RUD A;  1HXV A;  1BL4 A;  1NMW A;  2RE3 A;  2M08 A;  5DO2 A;  2YSH A;  3G6L A;  3NI6 A;  1SR0 A;  2DG3 A;  1FFR A;  1SYT A;  2XP7 A;  1FKD A;  5E62 A;  1E6N A;  1PBK A;  2XP3 A;  3OA5 A;  1J4H A;  5HT1 A;  1P5Q A;  4URI A;  1C9H A;  3JYM A;  4DRJ A;  3MDY B;  1W9V A;  4WJX A;  3L4H A;  2A3B A;  4P8U A;  1HJV A;  1PIN A;  4W9Q A;  1E6Z A;  3AS0 A;  1FFQ A;  4O2T A;  3WH0 A;  2RUQ A;  4Z2H A;  4DT4 A;  3PRD A;  1FJD A;  3PQH A;  1W9U A;  1E15 A;  4J4N A;  3AS3 A;  1FD9 A;  4ZPV R;  1W26 A;  3ART A;  5HW6 A;  3QOK A;  2ZQT A;  1JNE A;  1FAP A;  3UF8 A;  2O9O A;  4IQ2 A;  5HWB A;  2F4E A;  5DIV A;  2ESC A;  4S3J A;  2LAJ A;  4QIB A;  3VAW A;  2FAP A;  1RP5 A;  2A3C A;  4Q22 A;  2XPA A;  1ZBW A;  1K9T A;  3G6M A;  4REX A;  1QZ2 A;  3ARP A;  2M2A A;  4U85 A;  3PR9 A;  2RQS A;  5HW7 A;  2DJY A;  4U84 A;  1ROU A;  4QT3 A;  5GPG A;  3O5O A;  4WK9 A;  3ARX A;  3RME A;  1TK7 A;  2AWG A;  4TW7 A;  1FKR A;  4DRK A;  2KI3 A;  2YSG A;  1W9P A;  2L2S A;  4LAV A;  4W9P A;  1X6L A;  3UQB A;  3LUO A;  1JNS A;  3KAF A;  4ODQ A;  3OOB A;  5DEZ A;  4FN2 A;  4QT2 A;  5J6E A;  2DWV A;  3ARV A;  5E5W A;  3ALG A;  2OFN A;  2JX8 A;  1E6R A;  2Y78 A;  3PRB A;  4DRO A;  2XP9 A;  5E66 A;  4DRI A;  5JH8 A;  1Q6U A;  2WLY A;  4ML4 A;  2OLH A;  1F8A B;  1HKM A;  2JZV A;  4MNJ A;  2JV4 A;  4AY1 A;  1HKJ A;  4JFJ A;  4IT4 A;  4LGX A;  1ZBK A;  2PPO A;  2MLX A;  1YW5 A;  4DIP A;  3ARW A;  1NWU A;  1LG2 A;  1NWT A;  2KGJ A;  3LKX B;  2YBU A;  3UQI A;  4IQC A;  1FKT A;  3IKG A;  3WQV A;  4DWS D;  1TR8 A;  2O92 A;  3ARO A;  4P8V A;  3WL1 A;  4G2P A;  4GGQ A;  1TCO C;  1ZBC A;  1OGG A;  2PPN A;  4ITZ A;  2Y8N B;  4L72 B;  3IHZ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...