4U84A

Human pin1 with s-hydroxyl-cysteine 113
Total Genus 45
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
45
sequence length
157
structure length
144
Chain Sequence
LPPGWEKAMSRSSGRVYYFNHITNASQWERPSEPARVRCSHLLVKHSQSRRPSSWRQEKITRTKEEALELINGYIQKIKSGEEDFESLASQFSDSSAKARGDLGAFSRGQMQKPFEDASFALRTGEMSGPVFTDSGIHIILRTE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Isomerase
molecule keywords Peptidyl-prolyl cis-trans isomerase NIMA-interacting 1
publication title Pin1 cysteine-113 oxidation inhibits its catalytic activity and cellular function in Alzheimer's disease.
pubmed doi rcsb
source organism Homo sapiens
total genus 45
structure length 144
sequence length 157
ec nomenclature ec 5.2.1.8: Peptidylprolyl isomerase.
pdb deposition date 2014-08-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00397 WW WW domain
A PF00639 Rotamase PPIC-type PPIASE domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.20.70.10 Mainly Beta Single Sheet Ubiquitin Ligase Nedd4; Chain: W; Ubiquitin Ligase Nedd4; Chain: W; 4u84A01
3.10.50.40 Alpha Beta Roll Chitinase A; domain 3 Chitinase A; domain 3 4u84A02
2RSEA 1QZ2A 4JFLA 2ZQSA 2ZR5A 1PINA 3O5KA 4DRMA 3LUOA 2PBCA 2MNTA 1YATA 5HW6A 1I5HW 3VAWA 4ODMA 4TYOA 3NI6A 4O2TA 1YW5A 1C9HA 3KABA 2XP5A 4TW6A 3NTPA 2DWVA 1N1AA 3CGMA 1JVWA 2D9FA 3KAFA 2F4EA 1FKBA 4NNRA 2DG4A 1D6OA 4LAWA 1ZK6A 1FJDA 3KAGA 1BKFA 1Y0OA 1F40A 2JZVA 3ODKA 1BL4A 3JYMA 2MLXA 5HW8A 1JNTA 3EY6A 5HWBA 5DIUA 4MSPA 1NMWA 5HT1A 1HXVA 3UI6A 1FKTA 3UQAA 2M1IA 3IK8A 1FKGA 1ROTA 2UZ5A 5B8IC 2PV1A 2MPHA 3OOBA 3UQBA 1QPFA 2ZQVA 4U84A 4GIVA 3KCEA 3CGNA 4DROA 3KZ7A 1Q6UA 4W9QA 5CQ2A 2FAPA 3O5OA 2LJ4A 3RFWA 3LE4A 2DG3A 3MDYB 1EG4A 3TDBA 4REXA 4E5RA 2F2DA 1ROUA 2ZR4A 4C02B 3I6CA 3IHZA 2VCDA 2KI3A 3JYJA 3TCZA 3H9RB 1U79A 4DRPA 2EZ5W 4DRJA 4ODPA 1Q6IA 2BA1A 2KE0A 2ITKA 1FKFA 2L4JA 2LKNA 2FKEA 2AWGA 4FAPA 4DT4A 1R9HA 2DMVA 5HKGA 3PRBA 2KO7A 4J4NA 4W9PA 3B7XA 1JNSA 2XP9A 5D75A 3M7NA 2YSFA 2ZQTA 4R0XA 2RUQA 3UI5A 4BF8A 4JFKA 2IF4A 4TW8A 5HW7A 4LAYA 4JFMA 1PBKA 1FKRA 3O5PA 5DITA 2ZAJA 5DIVA 4DRQA 2PPNA 2M8IA 2ZR6A 2DG9A 2KXQA 2PV3A 2VN1A 2N87A 4DIPA 2M3OW 2XPAA 1J4IA 1EG3A 3O5DA 4ODRA 2RUCA 3NRKA 2DJYA 2F21A 4MGVA 4TX0A 4U85A 1J4HA 4FN2A 5HWCA 1J4RA 2XP8A 3O5MA 4IQCA 3PA7A 2M2AA 2RURA 3IKGA 1FKJA 3UI4A 3KAIA 4ODKA 2YSIA 1JMQA 1WMVA 1F8AB 1D7IA 2KGJA 2MLYA 4U86A 1FKLA 4JYSA 2MLZA 4QT2A 4ITZA 4G50A 2MF9A 3M85A 1KT0A 4IPXA 2M8JA 5BXJA 2JX8A 1K9QA 3JXVA 3O5JA 2JXWA 3CNGA 2OFNA 3IKDA 2XP6A 1EYMA 1FKKA 1K9RA 3GPKA 3KADA 1ZCNA 1P5QA 2RE3A 3L4HA 4IQ2A 5AHTA 1FKIA 2PPOA 4ODOA 3O5QA 1O6WA 4JFJA 5GPGA 3TC5A 1TCOC 2LPVA 2ZQUA 2RQSA 3WH0A 2PPPA 3O5RA 5J6EA 1Q1CA 5I98A 4LAXA 4GGQA 3UF8A 4DZ3A 4DRIA 2XP3A 2XP7A 3O5IA 3RGCA 1FAPA 2JMFA 4DRHA 1QPLA 2XP4A 3PRDA 2KR7A 4DZ2A 2E45A 2K8IA 2MDIA 1FKDA 3KACA 2LGOA 1D7HA 1EQ3A 2L2SA 2JV4A 1NSGA 4ODQA 1B6CA 5HUAA 2DK7A 2PV2A 1D7JA 2Q5AA 2RUDA 4TW7A 3O5EA 1NMVA 4LAVA 2XPBA 1W26A 3KAHA 1TK7A 2Y78A 1A7XA 2YSHA 3O5FA 3O5LA 4N19A 1FD9A 1WR7A 2LAJA 4DRNA 2DK1A 1FKSA 4JFIA 4ODLA 2KFWA 1J6YA 4QIBA 2YSBA 3O5GA 1FKHA 4DH0A 2M08A 1KT1A 3UQIA 4DRKA 2YSGA 1T11A 1M5YA 4TNSA 5HTGA 3FAPA 4J4OA 4W9OA 4QT3A 4G2PA 1L1PA 4ODNA 1Q6HA
chains in the Genus database with same CATH superfamily
3ARYA 3MQGA 2RSEA 1QZ2A 4JFLA 3ARUA 2OLHA 2ZQSA 5E5WA 2ZR5A 1PINA 3O5KA 4DWSB 4DRMA 3LUOA 4WJXA 1GUVA 2PBCA 5HBFA 2MNTA 1LQ0A 2A3EA 1YATA 5HW6A 1I5HW 5JH8A 4A0UA 3VAWA 4ODMA 4TYOA 3NI6A 4O2TA 1YW5A 4QZVB 3ARQA 2WLZA 1C9HA 3KABA 2XP5A 4TW6A 2B31A 3NTPA 2DWVA 1E6PA 4WK9A 3W4RA 1N1AA 3CGMA 3WD4A 1W1YA 3BMBA 1JVWA 4HBOA 1SYTA 1W1VA 3MCBB 2D9FA 2O92A 3FY1A 1WNOA 3CHDA 3KAFA 2F4EA 1FKBA 3FSBA 1GPFA 4NNRA 1EIBA 2DG4A 1D6OA 1ZBKA 4LAWA 2AOSA 3B8SA 1ZK6A 4Z2HA 4KQZA 1FJDA 3LKXA 2G8ZA 3RM4A 3KAGA 1BKFA 1Y0OA 1F40A 2JZVA 3ODKA 4Z2IA 1BL4A 3JYMA 1LL7A 2MLXA 1X6LA 1JCHB 1KFWA 5HW8A 1JNTA 3EY6A 1ZU8A 1HJWA 5HWBA 1E9LA 1TR8A 5DIUA 4MSPA 4L72B 1NMWA 5HT1A 1HXVA 3UI6A 1FLCA 1FKTA 1H0GA 3WL0A 3UQAA 4WIWA 3PQHA 2M1IA 3IK8A 1FKGA 3ARRA 4PTMA 1UR8A 2ETNA 1RP5A 2DT1A 1E15A 1ROTA 2UZ5A 4NZCA 2PV1A 3AS1A 2MPHA 3OOBA 5B8IC 2DT2A 3UQBA 3ARPA 1QPFA 1HJVA 2ZQVA 4U84A 3WQVA 4GIVA 3KCEA 1W9VA 2DSWA 3CGNA 4DROA 3KZ7A 1OWQA 1Q6UA 4AY1A 4XAKA 4IT4A 1HKJA 3B9EA 4W9QA 5CQ2A 2DPEA 2FAPA 3CZ8A 2LJ4A 3O5OA 3RFWA 3LE4A 2DG3A 3MDYB 1EG4A 3TDBA 3GU0A 4REXA 1E6ZA 3FS8A 4E5RA 2F2DA 3AROA 1ROUA 2ZR4A 3ARXA 1LL4A 4C02B 3I6CA 4LGXA 1CTNA 3IHZA 4P8WA 2VCDA 2KI3A 3JYJA 3TCZA 1O6IA 1JNEA 3H9RB 1U79A 2PI6A 4DRPA 2WADA 3ARSA 4ZPWR 2EZ5W 4URIA 4DRJA 4ODPA 5GQBA 4P8UA 1Q6IA 2BA1A 2KE0A 2ITKA 1FKFA 2L4JA 2LKNA 5DEZA 2FKEA 2AWGA 4FAPA 4DT4A 1R9HA 2DMVA 4UDMA 5HKGA 3PRBA 2KO7A 1W9UA 1W1TA 4J4NA 4W9PA 3B7XA 1WB0A 3AS2A 1JNSA 3WKZA 2XP9A 5D75A 5DF0A 2Y8NB 1EDQA 1ZL1A 3RM8A 3RMEA 3M7NA 2YSFA 2ZQTA 4R0XA 2A3CA 2RUQA 3UI5A 4BF8A 4JFKA 2IF4A 4TW8A 5HW7A 4LAYA 4JFMA 1PBKA 1EHNA 1FKRA 3O5PA 5E64A 5DITA 2ZAJA 5DIVA 4DRQA 2PPNA 2M8IA 2ZR6A 2DG9A 2KXQA 1ZBCA 4Z2GA 2PV3A 2VN1A 2N87A 2QF8A 4DIPA 2M3OW 2XPAA 1XRVA 1J4IA 4MTVA 1GOIA 1EG3A 3O5DA 4ODRA 3G6LA 2RUCA 1VF8A 3NRKA 2DJYA 2F21A 3CHFA 1LJYA 4MGVA 3LKXB 1NH6A 4TX0A 4U85A 1J4HA 4ZPTR 1W9PA 3RM9A 4FN2A 5HWCA 1J4RA 2XP8A 3O5MA 4IQCA 3G6MA 2YAJB 1HKMA 3PA7A 2DSZA 5U47A 1E44A 2M2AA 2RURA 3IKGA 4MPKA 1FKJA 3WIJA 3GTYX 3UI4A 3WL1A 4HARA 3KAIA 4ODKA 2YSIA 1JMQA 3ALGA 1WMVA 1F8AB 4Q7NA 1D7IA 4WKAA 1D2KA 1RD6A 2KGJA 1NWTA 1NWRA 2MLYA 2QRVA 4U86A 1FKLA 4JYSA 2MLZA 3BXWA 4QT2A 4ITZA 4G50A 2MF9A 3B9AA 3M85A 1KT0A 3ARTA 4IPXA 2M8JA 1ITXA 2YBUA 5BXJA 4W5UA 2JX8A 3WD2A 1LG2A 4ZPVR 1K9QA 3JXVA 3O5JA 2JXWA 3CNGA 2OFNA 3IKDA 2XP6A 1EYMA 2G41A 1ZBVA 1FKKA 1K9RA 2DT0A 3GPKA 3KADA 1ZCNA 4DWSA 1P5QA 3WD0A 2RE3A 3L4HA 4IQ2A 4ZS6A 5AHTA 5E62A 3B9DA 4ML4A 1FKIA 2PPOA 4ODOA 3ARWA 3O5QA 1O6WA 3CHCA 4NSBA 2EULA 1UR9A 4JFJA 4S3KA 1K9TA 4KR0B 5GPGA 4A0TA 3TC5A 4MAVA 2YBTA 1TCOC 4Z2KA 2LPVA 2ZQUA 1ZBWA 3WH0A 2RQSA 2PPPA 3O5RA 4WKHA 5J6EA 1Q1CA 5I98A 4LAXA 3AQUA 4GGQA 3UF8A 4DZ3A 1LG1A 4P8VA 3MCBA 1TFVA 4DRIA 2XP3A 2XP7A 1LL6A 2WLYA 3O5IA 3RGCA 1FAPA 2JMFA 4L3NA 3WD1A 1QPLA 4DRHA 3MQHA 3WD3A 2XP4A 3PRDA 2KR7A 3EIPA 2PN0A 4DZ2A 2E45A 2K8IA 2MDIA 5E66A 1FKDA 2DSUA 3KACA 1IX5A 2DSVA 4R5EA 2LGOA 4S3JA 1D7HA 1EQ3A 2L2SA 2JV4A 1NSGA 2A3AA 2WAEA 3AS3A 4ODQA 3OA5A 1B6CA 5HUAA 1JNDA 4MNKA 3CHEA 1E6NA 2DK7A 1X6NA 2ESCA 4HBEA 1FFRA 1GRJA 1SR0A 2DT3A 3CH9A 2PV2A 3PRAA 1D7JA 1E6RA 2Q5AA 4Q22A 2RUDA 4TW7A 3O5EA 2WM0A 1FFQA 1NMVA 5E65A 3WQWA 4LAVA 2XPBA 1W26A 3KAHA 3FXYA 4Z2JA 1TK7A 2Y78A 1HKKA 2FDMA 2P4VA 4P8XA 1A7XA 1NWSA 2YSHA 2F23A 1HKIA 3ARZA 3O5FA 3O5LA 5GPRA 4N19A 4DWSD 1FD9A 1WR7A 4MNMA 2OWOA 2LAJA 4DRNA 2DK1A 4MNLA 2IUZA 1FKSA 4WKFA 1WAWA 3PR9A 4JFIA 4ODLA 4MNJA 2KFWA 2O9OA 1J6YA 4QIBA 2YSBA 3O5GA 5DO2A 1FKHA 4IT6A 1H0IA 4DH0A 2WK2A 1OGBA 4DWSC 2M08A 1KT1A 1NWUA 2A3BA 1XHGA 3QOKA 3ARVA 3FSCA 1W1PA 3UQIA 4DRKA 4Z2LA 2YSGA 2B5UB 1T11A 1M5YA 1HJXA 1ZB5A 4TNSA 1OGGA 5HTGA 3FAPA 4J4OA 4GLXA 4W9OA 4QT3A 4G2PA 3AS0A 1L1PA 3ALFA 4ODNA 1Q6HA
chains in the Genus database with same CATH topology
3ARYA 3MQGA 2RSEA 1QZ2A 4JFLA 3ARUA 2OLHA 2ZQSA 5E5WA 2ZR5A 1PINA 3O5KA 4DWSB 4DRMA 3LUOA 4WJXA 1GUVA 2PBCA 5HBFA 2MNTA 1LQ0A 2A3EA 1YATA 5HW6A 1I5HW 5JH8A 4A0UA 3VAWA 4ODMA 4TYOA 3NI6A 4O2TA 1YW5A 4QZVB 3ARQA 2WLZA 1C9HA 3KABA 2XP5A 4TW6A 2B31A 3NTPA 2DWVA 1E6PA 4WK9A 3W4RA 1N1AA 3CGMA 3WD4A 1W1YA 1JVWA 4HBOA 1SYTA 1W1VA 3MCBB 2D9FA 2O92A 3FY1A 1WNOA 3CHDA 3KAFA 2F4EA 1FKBA 3FSBA 1GPFA 4NNRA 1EIBA 2DG4A 1D6OA 1ZBKA 4LAWA 2AOSA 3B8SA 1ZK6A 4Z2HA 4KQZA 1FJDA 3LKXA 2G8ZA 3RM4A 3KAGA 1BKFA 1Y0OA 1F40A 2JZVA 3ODKA 4Z2IA 1BL4A 3JYMA 1LL7A 2MLXA 1X6LA 1KFWA 5HW8A 1JNTA 3EY6A 1ZU8A 1HJWA 5HWBA 1E9LA 1TR8A 5DIUA 4MSPA 4L72B 1NMWA 5HT1A 1HXVA 3UI6A 1FLCA 1FKTA 1H0GA 3WL0A 3UQAA 4WIWA 3PQHA 2M1IA 3IK8A 1FKGA 3ARRA 4PTMA 1UR8A 1RP5A 2DT1A 1E15A 1ROTA 2UZ5A 4NZCA 2PV1A 3AS1A 2MPHA 3OOBA 5B8IC 2DT2A 3UQBA 3ARPA 1QPFA 1HJVA 2ZQVA 4U84A 3WQVA 4GIVA 3KCEA 1W9VA 2DSWA 3CGNA 4DROA 3KZ7A 1OWQA 1Q6UA 4AY1A 4XAKA 4IT4A 1HKJA 3B9EA 4W9QA 5CQ2A 2DPEA 2FAPA 3CZ8A 2LJ4A 3O5OA 3RFWA 3LE4A 2DG3A 3MDYB 1EG4A 3TDBA 4REXA 1E6ZA 3FS8A 4E5RA 2F2DA 3AROA 1ROUA 2ZR4A 3ARXA 1LL4A 4C02B 3I6CA 4LGXA 1CTNA 3IHZA 4P8WA 2VCDA 2KI3A 3JYJA 3TCZA 1O6IA 1JNEA 3H9RB 1U79A 2PI6A 4DRPA 2WADA 3ARSA 4ZPWR 2EZ5W 4URIA 4DRJA 4ODPA 5GQBA 4P8UA 1Q6IA 2BA1A 2KE0A 2ITKA 1FKFA 2L4JA 2LKNA 5DEZA 2FKEA 2AWGA 4FAPA 4DT4A 1R9HA 2DMVA 5HKGA 3PRBA 2KO7A 1W9UA 1W1TA 4J4NA 4W9PA 3B7XA 1WB0A 3AS2A 1JNSA 3WKZA 2XP9A 5D75A 5DF0A 2Y8NB 1EDQA 1ZL1A 3RM8A 3RMEA 3M7NA 2YSFA 2ZQTA 4R0XA 2A3CA 2RUQA 3UI5A 4BF8A 4JFKA 2IF4A 4TW8A 5HW7A 4LAYA 4JFMA 1PBKA 1EHNA 1FKRA 3O5PA 5E64A 5DITA 2ZAJA 5DIVA 4DRQA 2PPNA 2M8IA 2ZR6A 2DG9A 2KXQA 1ZBCA 4Z2GA 2PV3A 2VN1A 2N87A 2QF8A 4DIPA 2M3OW 2XPAA 1XRVA 1J4IA 4MTVA 1GOIA 1EG3A 3O5DA 4ODRA 3G6LA 2RUCA 1VF8A 3NRKA 2DJYA 2F21A 3CHFA 1LJYA 4MGVA 3LKXB 1NH6A 4TX0A 4U85A 1J4HA 4ZPTR 1W9PA 3RM9A 4FN2A 5HWCA 1J4RA 2XP8A 3O5MA 4IQCA 3G6MA 2YAJB 1HKMA 3PA7A 2DSZA 5U47A 2M2AA 2RURA 3IKGA 4MPKA 1FKJA 3WIJA 3UI4A 3WL1A 4HARA 3KAIA 4ODKA 2YSIA 1JMQA 3ALGA 1WMVA 1F8AB 4Q7NA 1D7IA 4WKAA 1D2KA 1RD6A 2KGJA 1NWTA 1NWRA 2MLYA 2QRVA 4U86A 1FKLA 4JYSA 2MLZA 3BXWA 4QT2A 4ITZA 4G50A 2MF9A 3B9AA 3M85A 1KT0A 3ARTA 4IPXA 2M8JA 1ITXA 2YBUA 5BXJA 4W5UA 2JX8A 3WD2A 1LG2A 4ZPVR 1K9QA 3JXVA 3O5JA 2JXWA 3CNGA 2OFNA 3IKDA 2XP6A 1EYMA 2G41A 1ZBVA 1FKKA 1K9RA 2DT0A 3GPKA 3KADA 1ZCNA 4DWSA 1P5QA 3WD0A 2RE3A 3L4HA 4IQ2A 4ZS6A 5AHTA 5E62A 3B9DA 4ML4A 1FKIA 2PPOA 4ODOA 3ARWA 3O5QA 1O6WA 3CHCA 4NSBA 1UR9A 4JFJA 4S3KA 1K9TA 4KR0B 5GPGA 4A0TA 3TC5A 4MAVA 2YBTA 1TCOC 4Z2KA 2LPVA 2ZQUA 1ZBWA 3WH0A 2RQSA 2PPPA 3O5RA 4WKHA 5J6EA 1Q1CA 5I98A 4LAXA 3AQUA 4GGQA 3UF8A 4DZ3A 1LG1A 4P8VA 3MCBA 1TFVA 4DRIA 2XP3A 2XP7A 1LL6A 2WLYA 3O5IA 3RGCA 1FAPA 2JMFA 4L3NA 3WD1A 1QPLA 4DRHA 3MQHA 3WD3A 2XP4A 3PRDA 2KR7A 4DZ2A 2E45A 2K8IA 2MDIA 5E66A 1FKDA 2DSUA 3KACA 1IX5A 2DSVA 4R5EA 2LGOA 4S3JA 1D7HA 1EQ3A 2L2SA 2JV4A 1NSGA 2A3AA 2WAEA 3AS3A 4ODQA 3OA5A 1B6CA 5HUAA 1JNDA 4MNKA 3CHEA 1E6NA 2DK7A 1X6NA 2ESCA 4HBEA 1FFRA 1SR0A 2DT3A 3CH9A 2PV2A 3PRAA 1D7JA 1E6RA 2Q5AA 4Q22A 2RUDA 4TW7A 3O5EA 2WM0A 1FFQA 1NMVA 5E65A 3WQWA 4LAVA 2XPBA 1W26A 3KAHA 3FXYA 4Z2JA 1TK7A 2Y78A 1HKKA 2FDMA 4P8XA 1A7XA 1NWSA 2YSHA 1HKIA 3ARZA 3O5FA 3O5LA 5GPRA 4N19A 4DWSD 1FD9A 1WR7A 4MNMA 2OWOA 2LAJA 4DRNA 2DK1A 4MNLA 2IUZA 1FKSA 4WKFA 1WAWA 3PR9A 4JFIA 4ODLA 4MNJA 2KFWA 2O9OA 1J6YA 4QIBA 2YSBA 3O5GA 5DO2A 1FKHA 4IT6A 1H0IA 4DH0A 2WK2A 1OGBA 4DWSC 2M08A 1KT1A 1NWUA 2A3BA 1XHGA 3QOKA 3ARVA 3FSCA 1W1PA 3UQIA 4DRKA 4Z2LA 2YSGA 1T11A 1M5YA 1HJXA 1ZB5A 4TNSA 1OGGA 5HTGA 3FAPA 4J4OA 4GLXA 4W9OA 4QT3A 4G2PA 3AS0A 1L1PA 3ALFA 4ODNA 1Q6HA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2RSE A;  1QZ2 A;  4JFL A;  2ZQS A;  2ZR5 A;  1PIN A;  3O5K A;  4DRM A;  3LUO A;  2PBC A;  2MNT A;  1YAT A;  5HW6 A;  1I5H W;  3VAW A;  4ODM A;  4TYO A;  3NI6 A;  4O2T A;  1YW5 A;  1C9H A;  3KAB A;  2XP5 A;  4TW6 A;  3NTP A;  2DWV A;  1N1A A;  3CGM A;  1JVW A;  2D9F A;  3KAF A;  2F4E A;  1FKB A;  4NNR A;  2DG4 A;  1D6O A;  4LAW A;  1ZK6 A;  1FJD A;  3KAG A;  1BKF A;  1Y0O A;  1F40 A;  2JZV A;  3ODK A;  1BL4 A;  3JYM A;  2MLX A;  5HW8 A;  1JNT A;  3EY6 A;  5HWB A;  5DIU A;  4MSP A;  1NMW A;  5HT1 A;  1HXV A;  3UI6 A;  1FKT A;  3UQA A;  2M1I A;  3IK8 A;  1FKG A;  1ROT A;  2UZ5 A;  5B8I C;  2PV1 A;  2MPH A;  3OOB A;  3UQB A;  1QPF A;  2ZQV A;  4U84 A;  4GIV A;  3KCE A;  3CGN A;  4DRO A;  3KZ7 A;  1Q6U A;  4W9Q A;  5CQ2 A;  2FAP A;  3O5O A;  2LJ4 A;  3RFW A;  3LE4 A;  2DG3 A;  3MDY B;  1EG4 A;  3TDB A;  4REX A;  4E5R A;  2F2D A;  1ROU A;  2ZR4 A;  4C02 B;  3I6C A;  3IHZ A;  2VCD A;  2KI3 A;  3JYJ A;  3TCZ A;  3H9R B;  1U79 A;  4DRP A;  2EZ5 W;  4DRJ A;  4ODP A;  1Q6I A;  2BA1 A;  2KE0 A;  2ITK A;  1FKF A;  2L4J A;  2LKN A;  2FKE A;  2AWG A;  4FAP A;  4DT4 A;  1R9H A;  2DMV A;  5HKG A;  3PRB A;  2KO7 A;  4J4N A;  4W9P A;  3B7X A;  1JNS A;  2XP9 A;  5D75 A;  3M7N A;  2YSF A;  2ZQT A;  4R0X A;  2RUQ A;  3UI5 A;  4BF8 A;  4JFK A;  2IF4 A;  4TW8 A;  5HW7 A;  4LAY A;  4JFM A;  1PBK A;  1FKR A;  3O5P A;  5DIT A;  2ZAJ A;  5DIV A;  4DRQ A;  2PPN A;  2M8I A;  2ZR6 A;  2DG9 A;  2KXQ A;  2PV3 A;  2VN1 A;  2N87 A;  4DIP A;  2M3O W;  2XPA A;  1J4I A;  1EG3 A;  3O5D A;  4ODR A;  2RUC A;  3NRK A;  2DJY A;  2F21 A;  4MGV A;  4TX0 A;  4U85 A;  1J4H A;  4FN2 A;  5HWC A;  1J4R A;  2XP8 A;  3O5M A;  4IQC A;  3PA7 A;  2M2A A;  2RUR A;  3IKG A;  1FKJ A;  3UI4 A;  3KAI A;  4ODK A;  2YSI A;  1JMQ A;  1WMV A;  1F8A B;  1D7I A;  2KGJ A;  2MLY A;  4U86 A;  1FKL A;  4JYS A;  2MLZ A;  4QT2 A;  4ITZ A;  4G50 A;  2MF9 A;  3M85 A;  1KT0 A;  4IPX A;  2M8J A;  5BXJ A;  2JX8 A;  1K9Q A;  3JXV A;  3O5J A;  2JXW A;  3CNG A;  2OFN A;  3IKD A;  2XP6 A;  1EYM A;  1FKK A;  1K9R A;  3GPK A;  3KAD A;  1ZCN A;  1P5Q A;  2RE3 A;  3L4H A;  4IQ2 A;  5AHT A;  1FKI A;  2PPO A;  4ODO A;  3O5Q A;  1O6W A;  4JFJ A;  5GPG A;  3TC5 A;  1TCO C;  2LPV A;  2ZQU A;  2RQS A;  3WH0 A;  2PPP A;  3O5R A;  5J6E A;  1Q1C A;  5I98 A;  4LAX A;  4GGQ A;  3UF8 A;  4DZ3 A;  4DRI A;  2XP3 A;  2XP7 A;  3O5I A;  3RGC A;  1FAP A;  2JMF A;  4DRH A;  1QPL A;  2XP4 A;  3PRD A;  2KR7 A;  4DZ2 A;  2E45 A;  2K8I A;  2MDI A;  1FKD A;  3KAC A;  2LGO A;  1D7H A;  1EQ3 A;  2L2S A;  2JV4 A;  1NSG A;  4ODQ A;  1B6C A;  5HUA A;  2DK7 A;  2PV2 A;  1D7J A;  2Q5A A;  2RUD A;  4TW7 A;  3O5E A;  1NMV A;  4LAV A;  2XPB A;  1W26 A;  3KAH A;  1TK7 A;  2Y78 A;  1A7X A;  2YSH A;  3O5F A;  3O5L A;  4N19 A;  1FD9 A;  1WR7 A;  2LAJ A;  4DRN A;  2DK1 A;  1FKS A;  4JFI A;  4ODL A;  2KFW A;  1J6Y A;  4QIB A;  2YSB A;  3O5G A;  1FKH A;  4DH0 A;  2M08 A;  1KT1 A;  3UQI A;  4DRK A;  2YSG A;  1T11 A;  1M5Y A;  4TNS A;  5HTG A;  3FAP A;  4J4O A;  4W9O A;  4QT3 A;  4G2P A;  1L1P A;  4ODN A;  1Q6H A; 
#chains in the Genus database with same CATH topology
 3ARY A;  3MQG A;  2RSE A;  1QZ2 A;  4JFL A;  3ARU A;  2OLH A;  2ZQS A;  5E5W A;  2ZR5 A;  1PIN A;  3O5K A;  4DWS B;  4DRM A;  3LUO A;  4WJX A;  1GUV A;  2PBC A;  5HBF A;  2MNT A;  1LQ0 A;  2A3E A;  1YAT A;  5HW6 A;  1I5H W;  5JH8 A;  4A0U A;  3VAW A;  4ODM A;  4TYO A;  3NI6 A;  4O2T A;  1YW5 A;  4QZV B;  3ARQ A;  2WLZ A;  1C9H A;  3KAB A;  2XP5 A;  4TW6 A;  2B31 A;  3NTP A;  2DWV A;  1E6P A;  4WK9 A;  3W4R A;  1N1A A;  3CGM A;  3WD4 A;  1W1Y A;  3BMB A;  1JVW A;  4HBO A;  1SYT A;  1W1V A;  3MCB B;  2D9F A;  2O92 A;  3FY1 A;  1WNO A;  3CHD A;  3KAF A;  2F4E A;  1FKB A;  3FSB A;  1GPF A;  4NNR A;  1EIB A;  2DG4 A;  1D6O A;  1ZBK A;  4LAW A;  2AOS A;  3B8S A;  1ZK6 A;  4Z2H A;  4KQZ A;  1FJD A;  3LKX A;  2G8Z A;  3RM4 A;  3KAG A;  1BKF A;  1Y0O A;  1F40 A;  2JZV A;  3ODK A;  4Z2I A;  1BL4 A;  3JYM A;  1LL7 A;  2MLX A;  1X6L A;  1JCH B;  1KFW A;  5HW8 A;  1JNT A;  3EY6 A;  1ZU8 A;  1HJW A;  5HWB A;  1E9L A;  1TR8 A;  5DIU A;  4MSP A;  4L72 B;  1NMW A;  5HT1 A;  1HXV A;  3UI6 A;  1FLC A;  1FKT A;  1H0G A;  3WL0 A;  3UQA A;  4WIW A;  3PQH A;  2M1I A;  3IK8 A;  1FKG A;  3ARR A;  4PTM A;  1UR8 A;  2ETN A;  1RP5 A;  2DT1 A;  1E15 A;  1ROT A;  2UZ5 A;  4NZC A;  2PV1 A;  3AS1 A;  2MPH A;  3OOB A;  5B8I C;  2DT2 A;  3UQB A;  3ARP A;  1QPF A;  1HJV A;  2ZQV A;  4U84 A;  3WQV A;  4GIV A;  3KCE A;  1W9V A;  2DSW A;  3CGN A;  4DRO A;  3KZ7 A;  1OWQ A;  1Q6U A;  4AY1 A;  4XAK A;  4IT4 A;  1HKJ A;  3B9E A;  4W9Q A;  5CQ2 A;  2DPE A;  2FAP A;  3CZ8 A;  2LJ4 A;  3O5O A;  3RFW A;  3LE4 A;  2DG3 A;  3MDY B;  1EG4 A;  3TDB A;  3GU0 A;  4REX A;  1E6Z A;  3FS8 A;  4E5R A;  2F2D A;  3ARO A;  1ROU A;  2ZR4 A;  3ARX A;  1LL4 A;  4C02 B;  3I6C A;  4LGX A;  1CTN A;  3IHZ A;  4P8W A;  2VCD A;  2KI3 A;  3JYJ A;  3TCZ A;  1O6I A;  1JNE A;  3H9R B;  1U79 A;  2PI6 A;  4DRP A;  2WAD A;  3ARS A;  4ZPW R;  2EZ5 W;  4URI A;  4DRJ A;  4ODP A;  5GQB A;  4P8U A;  1Q6I A;  2BA1 A;  2KE0 A;  2ITK A;  1FKF A;  2L4J A;  2LKN A;  5DEZ A;  2FKE A;  2AWG A;  4FAP A;  4DT4 A;  1R9H A;  2DMV A;  4UDM A;  5HKG A;  3PRB A;  2KO7 A;  1W9U A;  1W1T A;  4J4N A;  4W9P A;  3B7X A;  1WB0 A;  3AS2 A;  1JNS A;  3WKZ A;  2XP9 A;  5D75 A;  5DF0 A;  2Y8N B;  1EDQ A;  1ZL1 A;  3RM8 A;  3RME A;  3M7N A;  2YSF A;  2ZQT A;  4R0X A;  2A3C A;  2RUQ A;  3UI5 A;  4BF8 A;  4JFK A;  2IF4 A;  4TW8 A;  5HW7 A;  4LAY A;  4JFM A;  1PBK A;  1EHN A;  1FKR A;  3O5P A;  5E64 A;  5DIT A;  2ZAJ A;  5DIV A;  4DRQ A;  2PPN A;  2M8I A;  2ZR6 A;  2DG9 A;  2KXQ A;  1ZBC A;  4Z2G A;  2PV3 A;  2VN1 A;  2N87 A;  2QF8 A;  4DIP A;  2M3O W;  2XPA A;  1XRV A;  1J4I A;  4MTV A;  1GOI A;  1EG3 A;  3O5D A;  4ODR A;  3G6L A;  2RUC A;  1VF8 A;  3NRK A;  2DJY A;  2F21 A;  3CHF A;  1LJY A;  4MGV A;  3LKX B;  1NH6 A;  4TX0 A;  4U85 A;  1J4H A;  4ZPT R;  1W9P A;  3RM9 A;  4FN2 A;  5HWC A;  1J4R A;  2XP8 A;  3O5M A;  4IQC A;  3G6M A;  2YAJ B;  1HKM A;  3PA7 A;  2DSZ A;  5U47 A;  1E44 A;  2M2A A;  2RUR A;  3IKG A;  4MPK A;  1FKJ A;  3WIJ A;  3GTY X;  3UI4 A;  3WL1 A;  4HAR A;  3KAI A;  4ODK A;  2YSI A;  1JMQ A;  3ALG A;  1WMV A;  1F8A B;  4Q7N A;  1D7I A;  4WKA A;  1D2K A;  1RD6 A;  2KGJ A;  1NWT A;  1NWR A;  2MLY A;  2QRV A;  4U86 A;  1FKL A;  4JYS A;  2MLZ A;  3BXW A;  4QT2 A;  4ITZ A;  4G50 A;  2MF9 A;  3B9A A;  3M85 A;  1KT0 A;  3ART A;  4IPX A;  2M8J A;  1ITX A;  2YBU A;  5BXJ A;  4W5U A;  2JX8 A;  3WD2 A;  1LG2 A;  4ZPV R;  1K9Q A;  3JXV A;  3O5J A;  2JXW A;  3CNG A;  2OFN A;  3IKD A;  2XP6 A;  1EYM A;  2G41 A;  1ZBV A;  1FKK A;  1K9R A;  2DT0 A;  3GPK A;  3KAD A;  1ZCN A;  4DWS A;  1P5Q A;  3WD0 A;  2RE3 A;  3L4H A;  4IQ2 A;  4ZS6 A;  5AHT A;  5E62 A;  3B9D A;  4ML4 A;  1FKI A;  2PPO A;  4ODO A;  3ARW A;  3O5Q A;  1O6W A;  3CHC A;  4NSB A;  2EUL A;  1UR9 A;  4JFJ A;  4S3K A;  1K9T A;  4KR0 B;  5GPG A;  4A0T A;  3TC5 A;  4MAV A;  2YBT A;  1TCO C;  4Z2K A;  2LPV A;  2ZQU A;  1ZBW A;  3WH0 A;  2RQS A;  2PPP A;  3O5R A;  4WKH A;  5J6E A;  1Q1C A;  5I98 A;  4LAX A;  3AQU A;  4GGQ A;  3UF8 A;  4DZ3 A;  1LG1 A;  4P8V A;  3MCB A;  1TFV A;  4DRI A;  2XP3 A;  2XP7 A;  1LL6 A;  2WLY A;  3O5I A;  3RGC A;  1FAP A;  2JMF A;  4L3N A;  3WD1 A;  1QPL A;  4DRH A;  3MQH A;  3WD3 A;  2XP4 A;  3PRD A;  2KR7 A;  3EIP A;  2PN0 A;  4DZ2 A;  2E45 A;  2K8I A;  2MDI A;  5E66 A;  1FKD A;  2DSU A;  3KAC A;  1IX5 A;  2DSV A;  4R5E A;  2LGO A;  4S3J A;  1D7H A;  1EQ3 A;  2L2S A;  2JV4 A;  1NSG A;  2A3A A;  2WAE A;  3AS3 A;  4ODQ A;  3OA5 A;  1B6C A;  5HUA A;  1JND A;  4MNK A;  3CHE A;  1E6N A;  2DK7 A;  1X6N A;  2ESC A;  4HBE A;  1FFR A;  1GRJ A;  1SR0 A;  2DT3 A;  3CH9 A;  2PV2 A;  3PRA A;  1D7J A;  1E6R A;  2Q5A A;  4Q22 A;  2RUD A;  4TW7 A;  3O5E A;  2WM0 A;  1FFQ A;  1NMV A;  5E65 A;  3WQW A;  4LAV A;  2XPB A;  1W26 A;  3KAH A;  3FXY A;  4Z2J A;  1TK7 A;  2Y78 A;  1HKK A;  2FDM A;  2P4V A;  4P8X A;  1A7X A;  1NWS A;  2YSH A;  2F23 A;  1HKI A;  3ARZ A;  3O5F A;  3O5L A;  5GPR A;  4N19 A;  4DWS D;  1FD9 A;  1WR7 A;  4MNM A;  2OWO A;  2LAJ A;  4DRN A;  2DK1 A;  4MNL A;  2IUZ A;  1FKS A;  4WKF A;  1WAW A;  3PR9 A;  4JFI A;  4ODL A;  4MNJ A;  2KFW A;  2O9O A;  1J6Y A;  4QIB A;  2YSB A;  3O5G A;  5DO2 A;  1FKH A;  4IT6 A;  1H0I A;  4DH0 A;  2WK2 A;  1OGB A;  4DWS C;  2M08 A;  1KT1 A;  1NWU A;  2A3B A;  1XHG A;  3QOK A;  3ARV A;  3FSC A;  1W1P A;  3UQI A;  4DRK A;  4Z2L A;  2YSG A;  2B5U B;  1T11 A;  1M5Y A;  1HJX A;  1ZB5 A;  4TNS A;  1OGG A;  5HTG A;  3FAP A;  4J4O A;  4GLX A;  4W9O A;  4QT3 A;  4G2P A;  3AS0 A;  1L1P A;  3ALF A;  4ODN A;  1Q6H A; 
#chains in the Genus database with same CATH homology
 3ARY A;  3MQG A;  2RSE A;  1QZ2 A;  4JFL A;  3ARU A;  2OLH A;  2ZQS A;  5E5W A;  2ZR5 A;  1PIN A;  3O5K A;  4DWS B;  4DRM A;  3LUO A;  4WJX A;  1GUV A;  2PBC A;  5HBF A;  2MNT A;  1LQ0 A;  2A3E A;  1YAT A;  5HW6 A;  1I5H W;  5JH8 A;  4A0U A;  3VAW A;  4ODM A;  4TYO A;  3NI6 A;  4O2T A;  1YW5 A;  4QZV B;  3ARQ A;  2WLZ A;  1C9H A;  3KAB A;  2XP5 A;  4TW6 A;  2B31 A;  3NTP A;  2DWV A;  1E6P A;  4WK9 A;  3W4R A;  1N1A A;  3CGM A;  3WD4 A;  1W1Y A;  1JVW A;  4HBO A;  1SYT A;  1W1V A;  3MCB B;  2D9F A;  2O92 A;  3FY1 A;  1WNO A;  3CHD A;  3KAF A;  2F4E A;  1FKB A;  3FSB A;  1GPF A;  4NNR A;  1EIB A;  2DG4 A;  1D6O A;  1ZBK A;  4LAW A;  2AOS A;  3B8S A;  1ZK6 A;  4Z2H A;  4KQZ A;  1FJD A;  3LKX A;  2G8Z A;  3RM4 A;  3KAG A;  1BKF A;  1Y0O A;  1F40 A;  2JZV A;  3ODK A;  4Z2I A;  1BL4 A;  3JYM A;  1LL7 A;  2MLX A;  1X6L A;  1KFW A;  5HW8 A;  1JNT A;  3EY6 A;  1ZU8 A;  1HJW A;  5HWB A;  1E9L A;  1TR8 A;  5DIU A;  4MSP A;  4L72 B;  1NMW A;  5HT1 A;  1HXV A;  3UI6 A;  1FLC A;  1FKT A;  1H0G A;  3WL0 A;  3UQA A;  4WIW A;  3PQH A;  2M1I A;  3IK8 A;  1FKG A;  3ARR A;  4PTM A;  1UR8 A;  1RP5 A;  2DT1 A;  1E15 A;  1ROT A;  2UZ5 A;  4NZC A;  2PV1 A;  3AS1 A;  2MPH A;  3OOB A;  5B8I C;  2DT2 A;  3UQB A;  3ARP A;  1QPF A;  1HJV A;  2ZQV A;  4U84 A;  3WQV A;  4GIV A;  3KCE A;  1W9V A;  2DSW A;  3CGN A;  4DRO A;  3KZ7 A;  1OWQ A;  1Q6U A;  4AY1 A;  4XAK A;  4IT4 A;  1HKJ A;  3B9E A;  4W9Q A;  5CQ2 A;  2DPE A;  2FAP A;  3CZ8 A;  2LJ4 A;  3O5O A;  3RFW A;  3LE4 A;  2DG3 A;  3MDY B;  1EG4 A;  3TDB A;  4REX A;  1E6Z A;  3FS8 A;  4E5R A;  2F2D A;  3ARO A;  1ROU A;  2ZR4 A;  3ARX A;  1LL4 A;  4C02 B;  3I6C A;  4LGX A;  1CTN A;  3IHZ A;  4P8W A;  2VCD A;  2KI3 A;  3JYJ A;  3TCZ A;  1O6I A;  1JNE A;  3H9R B;  1U79 A;  2PI6 A;  4DRP A;  2WAD A;  3ARS A;  4ZPW R;  2EZ5 W;  4URI A;  4DRJ A;  4ODP A;  5GQB A;  4P8U A;  1Q6I A;  2BA1 A;  2KE0 A;  2ITK A;  1FKF A;  2L4J A;  2LKN A;  5DEZ A;  2FKE A;  2AWG A;  4FAP A;  4DT4 A;  1R9H A;  2DMV A;  5HKG A;  3PRB A;  2KO7 A;  1W9U A;  1W1T A;  4J4N A;  4W9P A;  3B7X A;  1WB0 A;  3AS2 A;  1JNS A;  3WKZ A;  2XP9 A;  5D75 A;  5DF0 A;  2Y8N B;  1EDQ A;  1ZL1 A;  3RM8 A;  3RME A;  3M7N A;  2YSF A;  2ZQT A;  4R0X A;  2A3C A;  2RUQ A;  3UI5 A;  4BF8 A;  4JFK A;  2IF4 A;  4TW8 A;  5HW7 A;  4LAY A;  4JFM A;  1PBK A;  1EHN A;  1FKR A;  3O5P A;  5E64 A;  5DIT A;  2ZAJ A;  5DIV A;  4DRQ A;  2PPN A;  2M8I A;  2ZR6 A;  2DG9 A;  2KXQ A;  1ZBC A;  4Z2G A;  2PV3 A;  2VN1 A;  2N87 A;  2QF8 A;  4DIP A;  2M3O W;  2XPA A;  1XRV A;  1J4I A;  4MTV A;  1GOI A;  1EG3 A;  3O5D A;  4ODR A;  3G6L A;  2RUC A;  1VF8 A;  3NRK A;  2DJY A;  2F21 A;  3CHF A;  1LJY A;  4MGV A;  3LKX B;  1NH6 A;  4TX0 A;  4U85 A;  1J4H A;  4ZPT R;  1W9P A;  3RM9 A;  4FN2 A;  5HWC A;  1J4R A;  2XP8 A;  3O5M A;  4IQC A;  3G6M A;  2YAJ B;  1HKM A;  3PA7 A;  2DSZ A;  5U47 A;  2M2A A;  2RUR A;  3IKG A;  4MPK A;  1FKJ A;  3WIJ A;  3UI4 A;  3WL1 A;  4HAR A;  3KAI A;  4ODK A;  2YSI A;  1JMQ A;  3ALG A;  1WMV A;  1F8A B;  4Q7N A;  1D7I A;  4WKA A;  1D2K A;  1RD6 A;  2KGJ A;  1NWT A;  1NWR A;  2MLY A;  2QRV A;  4U86 A;  1FKL A;  4JYS A;  2MLZ A;  3BXW A;  4QT2 A;  4ITZ A;  4G50 A;  2MF9 A;  3B9A A;  3M85 A;  1KT0 A;  3ART A;  4IPX A;  2M8J A;  1ITX A;  2YBU A;  5BXJ A;  4W5U A;  2JX8 A;  3WD2 A;  1LG2 A;  4ZPV R;  1K9Q A;  3JXV A;  3O5J A;  2JXW A;  3CNG A;  2OFN A;  3IKD A;  2XP6 A;  1EYM A;  2G41 A;  1ZBV A;  1FKK A;  1K9R A;  2DT0 A;  3GPK A;  3KAD A;  1ZCN A;  4DWS A;  1P5Q A;  3WD0 A;  2RE3 A;  3L4H A;  4IQ2 A;  4ZS6 A;  5AHT A;  5E62 A;  3B9D A;  4ML4 A;  1FKI A;  2PPO A;  4ODO A;  3ARW A;  3O5Q A;  1O6W A;  3CHC A;  4NSB A;  1UR9 A;  4JFJ A;  4S3K A;  1K9T A;  4KR0 B;  5GPG A;  4A0T A;  3TC5 A;  4MAV A;  2YBT A;  1TCO C;  4Z2K A;  2LPV A;  2ZQU A;  1ZBW A;  3WH0 A;  2RQS A;  2PPP A;  3O5R A;  4WKH A;  5J6E A;  1Q1C A;  5I98 A;  4LAX A;  3AQU A;  4GGQ A;  3UF8 A;  4DZ3 A;  1LG1 A;  4P8V A;  3MCB A;  1TFV A;  4DRI A;  2XP3 A;  2XP7 A;  1LL6 A;  2WLY A;  3O5I A;  3RGC A;  1FAP A;  2JMF A;  4L3N A;  3WD1 A;  1QPL A;  4DRH A;  3MQH A;  3WD3 A;  2XP4 A;  3PRD A;  2KR7 A;  4DZ2 A;  2E45 A;  2K8I A;  2MDI A;  5E66 A;  1FKD A;  2DSU A;  3KAC A;  1IX5 A;  2DSV A;  4R5E A;  2LGO A;  4S3J A;  1D7H A;  1EQ3 A;  2L2S A;  2JV4 A;  1NSG A;  2A3A A;  2WAE A;  3AS3 A;  4ODQ A;  3OA5 A;  1B6C A;  5HUA A;  1JND A;  4MNK A;  3CHE A;  1E6N A;  2DK7 A;  1X6N A;  2ESC A;  4HBE A;  1FFR A;  1SR0 A;  2DT3 A;  3CH9 A;  2PV2 A;  3PRA A;  1D7J A;  1E6R A;  2Q5A A;  4Q22 A;  2RUD A;  4TW7 A;  3O5E A;  2WM0 A;  1FFQ A;  1NMV A;  5E65 A;  3WQW A;  4LAV A;  2XPB A;  1W26 A;  3KAH A;  3FXY A;  4Z2J A;  1TK7 A;  2Y78 A;  1HKK A;  2FDM A;  4P8X A;  1A7X A;  1NWS A;  2YSH A;  1HKI A;  3ARZ A;  3O5F A;  3O5L A;  5GPR A;  4N19 A;  4DWS D;  1FD9 A;  1WR7 A;  4MNM A;  2OWO A;  2LAJ A;  4DRN A;  2DK1 A;  4MNL A;  2IUZ A;  1FKS A;  4WKF A;  1WAW A;  3PR9 A;  4JFI A;  4ODL A;  4MNJ A;  2KFW A;  2O9O A;  1J6Y A;  4QIB A;  2YSB A;  3O5G A;  5DO2 A;  1FKH A;  4IT6 A;  1H0I A;  4DH0 A;  2WK2 A;  1OGB A;  4DWS C;  2M08 A;  1KT1 A;  1NWU A;  2A3B A;  1XHG A;  3QOK A;  3ARV A;  3FSC A;  1W1P A;  3UQI A;  4DRK A;  4Z2L A;  2YSG A;  1T11 A;  1M5Y A;  1HJX A;  1ZB5 A;  4TNS A;  1OGG A;  5HTG A;  3FAP A;  4J4O A;  4GLX A;  4W9O A;  4QT3 A;  4G2P A;  3AS0 A;  1L1P A;  3ALF A;  4ODN A;  1Q6H A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...