4U84A

Human pin1 with s-hydroxyl-cysteine 113
Total Genus 45
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
45
sequence length
157
structure length
144
Chain Sequence
b'LPPGWEKAMSRSSGRVYYFNHITNASQWERPSEPARVRCSHLLVKHSQSRRPSSWRQEKITRTKEEALELINGYIQKIKSGEEDFESLASQFSDSSAKARGDLGAFSRGQMQKPFEDASFALRTGEMSGPVFTDSGIHIILRTE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Peptidyl-prolyl cis-trans isomerase NIMA-interacting 1
publication title Pin1 cysteine-113 oxidation inhibits its catalytic activity and cellular function in Alzheimer's disease.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Isomerase
total genus 45
structure length 144
sequence length 157
ec nomenclature ec 5.2.1.8: Peptidylprolyl isomerase.
pdb deposition date 2014-08-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00397 WW WW domain
A PF00639 Rotamase PPIC-type PPIASE domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.20.70.10 Mainly Beta Single Sheet Ubiquitin Ligase Nedd4; Chain: W; Ubiquitin Ligase Nedd4; Chain: W; 4u84A01
3.10.50.40 Alpha Beta Roll Chitinase A; domain 3 Chitinase A; domain 3 4u84A02
2ITKA 1FKLA 4W9OA 3O5PA 2M8JA 3TDBA 1J4RA 1D7IA 1Q6UA 1FJDA 4IPXA 3H9RB 5B8IC 2KGJA 3EY6A 1I5HW 3TCZA 4FN2A 4O2TA 4FAPA 2VN1A 4ITZA 4ODLA 2YSFA 1NMWA 2RQSA 1F40A 3O5QA 2ZQUA 2XP9A 2PV2A 4DRPA 4ODRA 2JMFA 2M8IA 3KAGA 1FKSA 2IF4A 2M3OW 4DRKA 1L1PA 3ODKA 1ROTA 1J6YA 2JX8A 4TW8A 1R9HA 1Q6IA 5I98A 1FKRA 3VAWA 1ZK6A 1D6OA 2XP4A 4J4OA 4R0XA 3NTPA 2ZQSA 2DMVA 1FD9A 3KADA 1K9QA 5HWCA 2RSEA 4U86A 2JZVA 1JNSA 2KXQA 4LAYA 1YW5A 3UQIA 1JNTA 1QPLA 1FKFA 1KT1A 1FKIA 3TC5A 2BA1A 1O6WA 2MLXA 5HT1A 2DJYA 1ROUA 2LPVA 5DIUA 3KACA 3M7NA 2DG3A 1FKDA 3O5LA 2JV4A 2E45A 1D7HA 5HKGA 2YSHA 3KABA 3LUOA 5J6EA 3O5MA 2M1IA 2PPOA 3O5DA 3L4HA 4ODKA 4TW7A 2RUDA 3WH0A 2F4EA 2PPNA 1K9RA 4J4NA 2N87A 4JFIA 2Y78A 4N19A 2MNTA 3RFWA 4MSPA 2FKEA 3GPKA 3IK8A 5BXJA 1Y0OA 2D9FA 3O5KA 1QPFA 4QT3A 4ODMA 4TNSA 2DK7A 2YSIA 2XP6A 2AWGA 3KCEA 4DRMA 1PBKA 3PRBA 5GPGA 2RUQA 2PV1A 2YSBA 4ODPA 3MDYB 1C9HA 4E5RA 4W9QA 3CNGA 2XP8A 2XP7A 5AHTA 5DITA 4ODQA 4GGQA 2KI3A 4JFMA 4DRIA 1F8AB 4U84A 4G2PA 4DRNA 2XPBA 4DRJA 5D75A 3JYJA 1JMQA 3B7XA 1EQ3A 3O5GA 4LAVA 4C02B 2LJ4A 2PPPA 4QT2A 1QZ2A 2XP5A 4DH0A 4DT4A 2MDIA 1NMVA 2OFNA 2JXWA 2DWVA 2VCDA 4JFKA 4QIBA 3UI4A 2KFWA 3JYMA 2DG4A 4JFJA 5DIVA 1PINA 3O5IA 2DG9A 2MLZA 3NRKA 2MLYA 2ZAJA 3M85A 3UI5A 3PA7A 1FKKA 2MPHA 3O5EA 2UZ5A 3CGMA 2M08A 4BF8A 1WMVA 2RUCA 4LAWA 4MGVA 2L2SA 3UQAA 2LKNA 2YSGA 3I6CA 4ODNA 4DROA 2K8IA 1FKGA 1HXVA 1BL4A 1D7JA 3UF8A 1FKJA 3O5RA 1J4HA 2LGOA 2ZR6A 4JYSA 2XP3A 3IHZA 3UI6A 4TYOA 5HWBA 2F2DA 2RE3A 1U79A 3UQBA 2ZR4A 4W9PA 1EG4A 4LAXA 1ZCNA 2F21A 3O5FA 1KT0A 2ZQVA 1TCOC 4ODOA 3KAIA 5HW8A 1J4IA 3IKDA 1WR7A 2KE0A 4GIVA 1JVWA 2EZ5W 3KZ7A 4IQ2A 4DRQA 3IKGA 1FKHA 1FAPA 1B6CA 4DIPA 1EYMA 1NSGA 4REXA 1YATA 2ZR5A 3LE4A 3O5OA 3KAFA 5HW6A 1Q1CA 2RURA 4G50A 2KO7A 1TK7A 1FKBA 2LAJA 2XPAA 2PV3A 4DZ3A 2ZQTA 1P5QA 2Q5AA 1T11A 4TW6A 2KR7A 4U85A 2L4JA 2PBCA 4TX0A 2M2AA 1FKTA 3JXVA 3KAHA 3O5JA 4NNRA 4JFLA 1N1AA 4DRHA 3OOBA 1EG3A 3CGNA 5HW7A 1W26A 5HUAA 4IQCA 3NI6A 5CQ2A 3PRDA 2DK1A 3FAPA 1BKFA 5HTGA 1M5YA 1Q6HA 4DZ2A 3RGCA 2FAPA 2MF9A 1A7XA
chains in the Genus database with same CATH superfamily
2ITKA 2DT0A 1FKLA 5E64A 2OLHA 3O5PA 4Q7NA 4W9OA 3WD4A 2M8JA 1LG2A 3TDBA 1J4RA 1D7IA 1Q6UA 3ARZA 2ESCA 1FJDA 5DEZA 1W1VA 2PN0A 4URIA 4IPXA 3H9RB 5B8IC 3ARYA 2KGJA 3EY6A 4Z2GA 4GLXA 1I5HW 4Q22A 2AOSA 1UR8A 4L3NA 4Z2LA 1WB0A 3TCZA 3G6LA 3WIJA 4FN2A 4O2TA 4FAPA 1XRVA 2VN1A 3W4RA 3WD2A 4HBOA 4ITZA 1OGGA 4ODLA 2YSFA 2PI6A 1NMWA 2RQSA 1F40A 3O5QA 2ZQUA 2P4VA 2XP9A 1NWUA 2PV2A 4MNLA 2A3AA 4DRPA 4ODRA 2JMFA 5E66A 5HBFA 2M8IA 3KAGA 1FKSA 2IF4A 2M3OW 4DRKA 1L1PA 3ODKA 1ROTA 1UR9A 1J6YA 1HKJA 2JX8A 3EIPA 3FY1A 4TW8A 1R9HA 1OGBA 2OWOA 1Q6IA 5I98A 1FKRA 3VAWA 1ZK6A 1D6OA 2XP4A 2B31A 4J4OA 4R0XA 3FSCA 3NTPA 1W9UA 4WKHA 2ZQSA 1W9VA 4NSBA 2DMVA 1FD9A 2ETNA 4UDMA 3KADA 1K9QA 5HWCA 2RSEA 4HBEA 4U86A 2DT1A 2QRVA 2JZVA 1JNSA 2KXQA 1X6NA 1YW5A 4LAYA 3UQIA 1JNTA 1W9PA 1QPLA 3ARVA 1FKFA 1KT1A 1FKIA 3TC5A 1ZBVA 2BA1A 5JH8A 3AS0A 4ZPVR 2EULA 1O6WA 3ARUA 1TFVA 2MLXA 5HT1A 2DJYA 1NWSA 1ROUA 3QOKA 5E65A 2LPVA 4WKFA 4IT4A 5DIUA 3KACA 1JNEA 3M7NA 2DG3A 1FFQA 3GU0A 1FKDA 3O5LA 2JV4A 4AY1A 1LG1A 2E45A 1D7HA 5HKGA 2YSHA 3PQHA 3KABA 1ZB5A 3LUOA 5J6EA 3O5MA 2DSZA 3AS1A 2M1IA 2PPOA 3O5DA 2YBUA 3L4HA 4ODKA 4TW7A 2RUDA 3LKXB 2DT2A 3B9EA 3WH0A 2F4EA 1NWTA 5DF0A 5E62A 1ZBCA 2PPNA 1K9RA 4J4NA 3WL1A 2N87A 3CHFA 4JFIA 4W5UA 2Y78A 3OA5A 4NZCA 2IUZA 3RMEA 4N19A 1EDQA 1JCHB 4XAKA 2MNTA 3RFWA 1KFWA 4MSPA 2FKEA 3GPKA 3IK8A 5BXJA 1Y0OA 2D9FA 3O5KA 1QPFA 4QT3A 3MQGA 3WKZA 3ARXA 4ODMA 4TNSA 2A3BA 2DK7A 2YSIA 3ALFA 4ZS6A 2XP6A 3MCBB 1HJVA 4MTVA 2AWGA 3KCEA 4DRMA 1WAWA 1PBKA 3PRBA 3FSBA 5GPGA 2RUQA 2PV1A 2YSBA 4ODPA 3MDYB 1C9HA 4E5RA 4W9QA 1O6IA 3CNGA 2XP8A 1E15A 4MAVA 2XP7A 4IT6A 3WD0A 3CHDA 1E6RA 5AHTA 5DITA 4ODQA 4GGQA 1IX5A 2KI3A 4JFMA 1EIBA 1HKMA 4MPKA 2B5UB 4DRIA 4Z2JA 1F8AB 1E9LA 1NH6A 1H0GA 1H0IA 4U84A 4G2PA 4DRNA 2XPBA 4DRJA 3ARRA 1W1TA 5D75A 3WQWA 3AQUA 3JYJA 1JMQA 3B7XA 3AS2A 1EQ3A 3MQHA 3O5GA 3RM8A 4HARA 4LAVA 4C02B 4MNJA 1LL4A 2LJ4A 2PPPA 2WM0A 4QT2A 1QZ2A 3FS8A 2XP5A 4DH0A 4DT4A 2MDIA 1GPFA 1NMVA 2WLZA 3ARTA 2OFNA 2JXWA 3WL0A 2DWVA 2VCDA 4JFKA 4QIBA 3UI4A 2YAJB 2KFWA 3JYMA 2DG4A 4JFJA 5DIVA 1FLCA 3ARPA 1PINA 3O5IA 2DG9A 4P8WA 2MLZA 3NRKA 2MLYA 1HKIA 2WLYA 2ZAJA 3M85A 3FXYA 2QF8A 3UI5A 2Y8NB 3WQVA 3PA7A 1FKKA 2MPHA 3O5EA 2UZ5A 3CGMA 4DWSB 1RP5A 3G6MA 1FFRA 2M08A 4BF8A 4QZVB 3CZ8A 1WMVA 2RUCA 1SR0A 2DSVA 3BMBA 1NWRA 4LAWA 3B8SA 4MGVA 2L2SA 3RM9A 3UQAA 1D2KA 1VF8A 1HJXA 2LKNA 2YSGA 1EHNA 3ARSA 3I6CA 4ODNA 4DROA 1W1PA 2K8IA 4A0TA 1FKGA 1HXVA 1BL4A 2O9OA 3PR9A 1D7JA 3UF8A 1FKJA 3O5RA 5DO2A 1J4HA 2LGOA 2ZR6A 2WADA 3GTYX 4Z2IA 2FDMA 4JYSA 2DT3A 2XP3A 3IHZA 4P8UA 1LL7A 3UI6A 4TYOA 3B9DA 5HWBA 4L72B 3ARQA 2F2DA 1SYTA 1ZL1A 2RE3A 1U79A 3UQBA 3AROA 2ZR4A 4W9PA 1EG4A 3CHCA 1ZBWA 4LAXA 1ZCNA 2F21A 1CTNA 4ZPTR 3O5FA 1KT0A 2ZQVA 4WKAA 1HJWA 4DWSA 1TCOC 4ODOA 4DWSD 3AS3A 3KAIA 1LQ0A 4KQZA 5HW8A 1J4IA 3IKDA 1WR7A 4MNKA 2KE0A 1K9TA 1GUVA 4GIVA 4P8XA 3LKXA 1JVWA 1HKKA 3CHEA 3RM4A 2EZ5W 1WNOA 3KZ7A 2O92A 1E6PA 4Z2KA 4IQ2A 4DRQA 1E6NA 3IKGA 4PTMA 1FKHA 1OWQA 1E6ZA 1FAPA 1B6CA 5E5WA 4DIPA 5U47A 1EYMA 1NSGA 4REXA 2WAEA 1YATA 5GQBA 2ZR5A 1GOIA 3LE4A 2WK2A 4DWSC 3B9AA 3O5OA 3KAFA 5HW6A 1Q1CA 2RURA 4Z2HA 2G8ZA 3MCBA 2YBTA 4G50A 2KO7A 1TK7A 1ZU8A 1FKBA 2LAJA 1ZBKA 2XPAA 2PV3A 1GRJA 4DZ3A 4LGXA 1TR8A 3CH9A 2ZQTA 1P5QA 1LJYA 4P8VA 4A0UA 4S3JA 2Q5AA 1T11A 4TW6A 2KR7A 4WK9A 4U85A 2L4JA 1JNDA 1W1YA 2G41A 1XHGA 2PBCA 4TX0A 2DPEA 2DSUA 2M2AA 1FKTA 3JXVA 4S3KA 3KAHA 1RD6A 3O5JA 3BXWA 4NNRA 1LL6A 4JFLA 1X6LA 1N1AA 4DRHA 3OOBA 2A3EA 1EG3A 3WD1A 3CGNA 3WD3A 5HW7A 1E44A 1W26A 5HUAA 4KR0B 4WJXA 4IQCA 2DSWA 3NI6A 3ALGA 5CQ2A 4R5EA 3PRAA 4ZPWR 3PRDA 2F23A 2DK1A 3FAPA 2A3CA 4WIWA 1BKFA 4ML4A 5HTGA 1M5YA 1Q6HA 4MNMA 5GPRA 3ARWA 4DZ2A 3RGCA 1ITXA 2FAPA 2MF9A 1A7XA
chains in the Genus database with same CATH topology
2ITKA 2DT0A 1FKLA 5E64A 2OLHA 3O5PA 4Q7NA 4W9OA 3WD4A 2M8JA 1LG2A 3TDBA 1J4RA 1D7IA 1Q6UA 3ARZA 2ESCA 1FJDA 5DEZA 1W1VA 4URIA 4IPXA 3H9RB 5B8IC 3ARYA 2KGJA 3EY6A 4Z2GA 4GLXA 1I5HW 4Q22A 2AOSA 1UR8A 4L3NA 4Z2LA 1WB0A 3TCZA 3G6LA 3WIJA 4FN2A 4O2TA 4FAPA 1XRVA 2VN1A 3W4RA 3WD2A 4HBOA 4ITZA 1OGGA 4ODLA 2YSFA 2PI6A 1NMWA 2RQSA 1F40A 3O5QA 2ZQUA 2XP9A 1NWUA 2PV2A 4MNLA 2A3AA 4DRPA 4ODRA 2JMFA 5E66A 5HBFA 2M8IA 3KAGA 1FKSA 2IF4A 2M3OW 4DRKA 1L1PA 3ODKA 1ROTA 1UR9A 1J6YA 1HKJA 2JX8A 3FY1A 4TW8A 1R9HA 1OGBA 2OWOA 1Q6IA 5I98A 1FKRA 3VAWA 1ZK6A 1D6OA 2XP4A 2B31A 4J4OA 4R0XA 3FSCA 3NTPA 1W9UA 4WKHA 2ZQSA 1W9VA 4NSBA 2DMVA 1FD9A 3KADA 1K9QA 5HWCA 2RSEA 4HBEA 4U86A 2DT1A 2QRVA 2JZVA 1JNSA 2KXQA 1X6NA 1YW5A 4LAYA 3UQIA 1JNTA 1W9PA 1QPLA 3ARVA 1FKFA 1KT1A 1FKIA 3TC5A 1ZBVA 2BA1A 5JH8A 3AS0A 4ZPVR 1O6WA 3ARUA 1TFVA 2MLXA 5HT1A 2DJYA 1NWSA 1ROUA 3QOKA 5E65A 2LPVA 4WKFA 4IT4A 5DIUA 3KACA 1JNEA 3M7NA 2DG3A 1FFQA 1FKDA 3O5LA 2JV4A 4AY1A 1LG1A 2E45A 1D7HA 5HKGA 2YSHA 3PQHA 3KABA 1ZB5A 3LUOA 5J6EA 3O5MA 2DSZA 3AS1A 2M1IA 2PPOA 3O5DA 2YBUA 3L4HA 4ODKA 4TW7A 2RUDA 3LKXB 2DT2A 3B9EA 3WH0A 2F4EA 1NWTA 5DF0A 5E62A 1ZBCA 2PPNA 1K9RA 4J4NA 3WL1A 2N87A 3CHFA 4JFIA 4W5UA 2Y78A 3OA5A 4NZCA 2IUZA 3RMEA 4N19A 1EDQA 4XAKA 2MNTA 3RFWA 1KFWA 4MSPA 2FKEA 3GPKA 3IK8A 5BXJA 1Y0OA 2D9FA 3O5KA 1QPFA 4QT3A 3MQGA 3WKZA 3ARXA 4ODMA 4TNSA 2A3BA 2DK7A 2YSIA 3ALFA 4ZS6A 2XP6A 3MCBB 1HJVA 4MTVA 2AWGA 3KCEA 4DRMA 1WAWA 1PBKA 3PRBA 3FSBA 5GPGA 2RUQA 2PV1A 2YSBA 4ODPA 3MDYB 1C9HA 4E5RA 4W9QA 1O6IA 3CNGA 2XP8A 1E15A 4MAVA 2XP7A 4IT6A 3WD0A 3CHDA 1E6RA 5AHTA 5DITA 4ODQA 4GGQA 1IX5A 2KI3A 4JFMA 1EIBA 1HKMA 4MPKA 4DRIA 4Z2JA 1F8AB 1E9LA 1NH6A 1H0GA 1H0IA 4U84A 4G2PA 4DRNA 2XPBA 4DRJA 3ARRA 1W1TA 5D75A 3WQWA 3AQUA 3JYJA 1JMQA 3B7XA 3AS2A 1EQ3A 3MQHA 3O5GA 3RM8A 4HARA 4LAVA 4C02B 4MNJA 1LL4A 2LJ4A 2PPPA 2WM0A 4QT2A 1QZ2A 3FS8A 2XP5A 4DH0A 4DT4A 2MDIA 1GPFA 1NMVA 2WLZA 3ARTA 2OFNA 2JXWA 3WL0A 2DWVA 2VCDA 4JFKA 4QIBA 3UI4A 2YAJB 2KFWA 3JYMA 2DG4A 4JFJA 5DIVA 1FLCA 3ARPA 1PINA 3O5IA 2DG9A 4P8WA 2MLZA 3NRKA 2MLYA 1HKIA 2WLYA 2ZAJA 3M85A 3FXYA 2QF8A 3UI5A 2Y8NB 3WQVA 3PA7A 1FKKA 2MPHA 3O5EA 2UZ5A 3CGMA 4DWSB 1RP5A 3G6MA 1FFRA 2M08A 4BF8A 4QZVB 3CZ8A 1WMVA 2RUCA 1SR0A 2DSVA 1NWRA 4LAWA 3B8SA 4MGVA 2L2SA 3RM9A 3UQAA 1D2KA 1VF8A 1HJXA 2LKNA 2YSGA 1EHNA 3ARSA 3I6CA 4ODNA 4DROA 1W1PA 2K8IA 4A0TA 1FKGA 1HXVA 1BL4A 2O9OA 3PR9A 1D7JA 3UF8A 1FKJA 3O5RA 5DO2A 1J4HA 2LGOA 2ZR6A 2WADA 4Z2IA 2FDMA 4JYSA 2DT3A 2XP3A 3IHZA 4P8UA 1LL7A 3UI6A 4TYOA 3B9DA 5HWBA 4L72B 3ARQA 2F2DA 1SYTA 1ZL1A 2RE3A 1U79A 3UQBA 3AROA 2ZR4A 4W9PA 1EG4A 3CHCA 1ZBWA 4LAXA 1ZCNA 2F21A 1CTNA 4ZPTR 3O5FA 1KT0A 2ZQVA 4WKAA 1HJWA 4DWSA 1TCOC 4ODOA 4DWSD 3AS3A 3KAIA 1LQ0A 4KQZA 5HW8A 1J4IA 3IKDA 1WR7A 4MNKA 2KE0A 1K9TA 1GUVA 4GIVA 4P8XA 3LKXA 1JVWA 1HKKA 3CHEA 3RM4A 2EZ5W 1WNOA 3KZ7A 2O92A 1E6PA 4Z2KA 4IQ2A 4DRQA 1E6NA 3IKGA 4PTMA 1FKHA 1OWQA 1E6ZA 1FAPA 1B6CA 5E5WA 4DIPA 5U47A 1EYMA 1NSGA 4REXA 2WAEA 1YATA 5GQBA 2ZR5A 1GOIA 3LE4A 2WK2A 4DWSC 3B9AA 3O5OA 3KAFA 5HW6A 1Q1CA 2RURA 4Z2HA 2G8ZA 3MCBA 2YBTA 4G50A 2KO7A 1TK7A 1ZU8A 1FKBA 2LAJA 1ZBKA 2XPAA 2PV3A 4DZ3A 4LGXA 1TR8A 3CH9A 2ZQTA 1P5QA 1LJYA 4P8VA 4A0UA 4S3JA 2Q5AA 1T11A 4TW6A 2KR7A 4WK9A 4U85A 2L4JA 1JNDA 1W1YA 2G41A 1XHGA 2PBCA 4TX0A 2DPEA 2DSUA 2M2AA 1FKTA 3JXVA 4S3KA 3KAHA 1RD6A 3O5JA 3BXWA 4NNRA 1LL6A 4JFLA 1X6LA 1N1AA 4DRHA 3OOBA 2A3EA 1EG3A 3WD1A 3CGNA 3WD3A 5HW7A 1W26A 5HUAA 4KR0B 4WJXA 4IQCA 2DSWA 3NI6A 3ALGA 5CQ2A 4R5EA 3PRAA 4ZPWR 3PRDA 2DK1A 3FAPA 2A3CA 4WIWA 1BKFA 4ML4A 5HTGA 1M5YA 1Q6HA 4MNMA 5GPRA 3ARWA 4DZ2A 3RGCA 1ITXA 2FAPA 2MF9A 1A7XA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2ITK A;  1FKL A;  4W9O A;  3O5P A;  2M8J A;  3TDB A;  1J4R A;  1D7I A;  1Q6U A;  1FJD A;  4IPX A;  3H9R B;  5B8I C;  2KGJ A;  3EY6 A;  1I5H W;  3TCZ A;  4FN2 A;  4O2T A;  4FAP A;  2VN1 A;  4ITZ A;  4ODL A;  2YSF A;  1NMW A;  2RQS A;  1F40 A;  3O5Q A;  2ZQU A;  2XP9 A;  2PV2 A;  4DRP A;  4ODR A;  2JMF A;  2M8I A;  3KAG A;  1FKS A;  2IF4 A;  2M3O W;  4DRK A;  1L1P A;  3ODK A;  1ROT A;  1J6Y A;  2JX8 A;  4TW8 A;  1R9H A;  1Q6I A;  5I98 A;  1FKR A;  3VAW A;  1ZK6 A;  1D6O A;  2XP4 A;  4J4O A;  4R0X A;  3NTP A;  2ZQS A;  2DMV A;  1FD9 A;  3KAD A;  1K9Q A;  5HWC A;  2RSE A;  4U86 A;  2JZV A;  1JNS A;  2KXQ A;  4LAY A;  1YW5 A;  3UQI A;  1JNT A;  1QPL A;  1FKF A;  1KT1 A;  1FKI A;  3TC5 A;  2BA1 A;  1O6W A;  2MLX A;  5HT1 A;  2DJY A;  1ROU A;  2LPV A;  5DIU A;  3KAC A;  3M7N A;  2DG3 A;  1FKD A;  3O5L A;  2JV4 A;  2E45 A;  1D7H A;  5HKG A;  2YSH A;  3KAB A;  3LUO A;  5J6E A;  3O5M A;  2M1I A;  2PPO A;  3O5D A;  3L4H A;  4ODK A;  4TW7 A;  2RUD A;  3WH0 A;  2F4E A;  2PPN A;  1K9R A;  4J4N A;  2N87 A;  4JFI A;  2Y78 A;  4N19 A;  2MNT A;  3RFW A;  4MSP A;  2FKE A;  3GPK A;  3IK8 A;  5BXJ A;  1Y0O A;  2D9F A;  3O5K A;  1QPF A;  4QT3 A;  4ODM A;  4TNS A;  2DK7 A;  2YSI A;  2XP6 A;  2AWG A;  3KCE A;  4DRM A;  1PBK A;  3PRB A;  5GPG A;  2RUQ A;  2PV1 A;  2YSB A;  4ODP A;  3MDY B;  1C9H A;  4E5R A;  4W9Q A;  3CNG A;  2XP8 A;  2XP7 A;  5AHT A;  5DIT A;  4ODQ A;  4GGQ A;  2KI3 A;  4JFM A;  4DRI A;  1F8A B;  4U84 A;  4G2P A;  4DRN A;  2XPB A;  4DRJ A;  5D75 A;  3JYJ A;  1JMQ A;  3B7X A;  1EQ3 A;  3O5G A;  4LAV A;  4C02 B;  2LJ4 A;  2PPP A;  4QT2 A;  1QZ2 A;  2XP5 A;  4DH0 A;  4DT4 A;  2MDI A;  1NMV A;  2OFN A;  2JXW A;  2DWV A;  2VCD A;  4JFK A;  4QIB A;  3UI4 A;  2KFW A;  3JYM A;  2DG4 A;  4JFJ A;  5DIV A;  1PIN A;  3O5I A;  2DG9 A;  2MLZ A;  3NRK A;  2MLY A;  2ZAJ A;  3M85 A;  3UI5 A;  3PA7 A;  1FKK A;  2MPH A;  3O5E A;  2UZ5 A;  3CGM A;  2M08 A;  4BF8 A;  1WMV A;  2RUC A;  4LAW A;  4MGV A;  2L2S A;  3UQA A;  2LKN A;  2YSG A;  3I6C A;  4ODN A;  4DRO A;  2K8I A;  1FKG A;  1HXV A;  1BL4 A;  1D7J A;  3UF8 A;  1FKJ A;  3O5R A;  1J4H A;  2LGO A;  2ZR6 A;  4JYS A;  2XP3 A;  3IHZ A;  3UI6 A;  4TYO A;  5HWB A;  2F2D A;  2RE3 A;  1U79 A;  3UQB A;  2ZR4 A;  4W9P A;  1EG4 A;  4LAX A;  1ZCN A;  2F21 A;  3O5F A;  1KT0 A;  2ZQV A;  1TCO C;  4ODO A;  3KAI A;  5HW8 A;  1J4I A;  3IKD A;  1WR7 A;  2KE0 A;  4GIV A;  1JVW A;  2EZ5 W;  3KZ7 A;  4IQ2 A;  4DRQ A;  3IKG A;  1FKH A;  1FAP A;  1B6C A;  4DIP A;  1EYM A;  1NSG A;  4REX A;  1YAT A;  2ZR5 A;  3LE4 A;  3O5O A;  3KAF A;  5HW6 A;  1Q1C A;  2RUR A;  4G50 A;  2KO7 A;  1TK7 A;  1FKB A;  2LAJ A;  2XPA A;  2PV3 A;  4DZ3 A;  2ZQT A;  1P5Q A;  2Q5A A;  1T11 A;  4TW6 A;  2KR7 A;  4U85 A;  2L4J A;  2PBC A;  4TX0 A;  2M2A A;  1FKT A;  3JXV A;  3KAH A;  3O5J A;  4NNR A;  4JFL A;  1N1A A;  4DRH A;  3OOB A;  1EG3 A;  3CGN A;  5HW7 A;  1W26 A;  5HUA A;  4IQC A;  3NI6 A;  5CQ2 A;  3PRD A;  2DK1 A;  3FAP A;  1BKF A;  5HTG A;  1M5Y A;  1Q6H A;  4DZ2 A;  3RGC A;  2FAP A;  2MF9 A;  1A7X A; 
#chains in the Genus database with same CATH topology
 2ITK A;  2DT0 A;  1FKL A;  5E64 A;  2OLH A;  3O5P A;  4Q7N A;  4W9O A;  3WD4 A;  2M8J A;  1LG2 A;  3TDB A;  1J4R A;  1D7I A;  1Q6U A;  3ARZ A;  2ESC A;  1FJD A;  5DEZ A;  1W1V A;  2PN0 A;  4URI A;  4IPX A;  3H9R B;  5B8I C;  3ARY A;  2KGJ A;  3EY6 A;  4Z2G A;  4GLX A;  1I5H W;  4Q22 A;  2AOS A;  1UR8 A;  4L3N A;  4Z2L A;  1WB0 A;  3TCZ A;  3G6L A;  3WIJ A;  4FN2 A;  4O2T A;  4FAP A;  1XRV A;  2VN1 A;  3W4R A;  3WD2 A;  4HBO A;  4ITZ A;  1OGG A;  4ODL A;  2YSF A;  2PI6 A;  1NMW A;  2RQS A;  1F40 A;  3O5Q A;  2ZQU A;  2P4V A;  2XP9 A;  1NWU A;  2PV2 A;  4MNL A;  2A3A A;  4DRP A;  4ODR A;  2JMF A;  5E66 A;  5HBF A;  2M8I A;  3KAG A;  1FKS A;  2IF4 A;  2M3O W;  4DRK A;  1L1P A;  3ODK A;  1ROT A;  1UR9 A;  1J6Y A;  1HKJ A;  2JX8 A;  3EIP A;  3FY1 A;  4TW8 A;  1R9H A;  1OGB A;  2OWO A;  1Q6I A;  5I98 A;  1FKR A;  3VAW A;  1ZK6 A;  1D6O A;  2XP4 A;  2B31 A;  4J4O A;  4R0X A;  3FSC A;  3NTP A;  1W9U A;  4WKH A;  2ZQS A;  1W9V A;  4NSB A;  2DMV A;  1FD9 A;  2ETN A;  4UDM A;  3KAD A;  1K9Q A;  5HWC A;  2RSE A;  4HBE A;  4U86 A;  2DT1 A;  2QRV A;  2JZV A;  1JNS A;  2KXQ A;  1X6N A;  1YW5 A;  4LAY A;  3UQI A;  1JNT A;  1W9P A;  1QPL A;  3ARV A;  1FKF A;  1KT1 A;  1FKI A;  3TC5 A;  1ZBV A;  2BA1 A;  5JH8 A;  3AS0 A;  4ZPV R;  2EUL A;  1O6W A;  3ARU A;  1TFV A;  2MLX A;  5HT1 A;  2DJY A;  1NWS A;  1ROU A;  3QOK A;  5E65 A;  2LPV A;  4WKF A;  4IT4 A;  5DIU A;  3KAC A;  1JNE A;  3M7N A;  2DG3 A;  1FFQ A;  3GU0 A;  1FKD A;  3O5L A;  2JV4 A;  4AY1 A;  1LG1 A;  2E45 A;  1D7H A;  5HKG A;  2YSH A;  3PQH A;  3KAB A;  1ZB5 A;  3LUO A;  5J6E A;  3O5M A;  2DSZ A;  3AS1 A;  2M1I A;  2PPO A;  3O5D A;  2YBU A;  3L4H A;  4ODK A;  4TW7 A;  2RUD A;  3LKX B;  2DT2 A;  3B9E A;  3WH0 A;  2F4E A;  1NWT A;  5DF0 A;  5E62 A;  1ZBC A;  2PPN A;  1K9R A;  4J4N A;  3WL1 A;  2N87 A;  3CHF A;  4JFI A;  4W5U A;  2Y78 A;  3OA5 A;  4NZC A;  2IUZ A;  3RME A;  4N19 A;  1EDQ A;  1JCH B;  4XAK A;  2MNT A;  3RFW A;  1KFW A;  4MSP A;  2FKE A;  3GPK A;  3IK8 A;  5BXJ A;  1Y0O A;  2D9F A;  3O5K A;  1QPF A;  4QT3 A;  3MQG A;  3WKZ A;  3ARX A;  4ODM A;  4TNS A;  2A3B A;  2DK7 A;  2YSI A;  3ALF A;  4ZS6 A;  2XP6 A;  3MCB B;  1HJV A;  4MTV A;  2AWG A;  3KCE A;  4DRM A;  1WAW A;  1PBK A;  3PRB A;  3FSB A;  5GPG A;  2RUQ A;  2PV1 A;  2YSB A;  4ODP A;  3MDY B;  1C9H A;  4E5R A;  4W9Q A;  1O6I A;  3CNG A;  2XP8 A;  1E15 A;  4MAV A;  2XP7 A;  4IT6 A;  3WD0 A;  3CHD A;  1E6R A;  5AHT A;  5DIT A;  4ODQ A;  4GGQ A;  1IX5 A;  2KI3 A;  4JFM A;  1EIB A;  1HKM A;  4MPK A;  2B5U B;  4DRI A;  4Z2J A;  1F8A B;  1E9L A;  1NH6 A;  1H0G A;  1H0I A;  4U84 A;  4G2P A;  4DRN A;  2XPB A;  4DRJ A;  3ARR A;  1W1T A;  5D75 A;  3WQW A;  3AQU A;  3JYJ A;  1JMQ A;  3B7X A;  3AS2 A;  1EQ3 A;  3MQH A;  3O5G A;  3RM8 A;  4HAR A;  4LAV A;  4C02 B;  4MNJ A;  1LL4 A;  2LJ4 A;  2PPP A;  2WM0 A;  4QT2 A;  1QZ2 A;  3FS8 A;  2XP5 A;  4DH0 A;  4DT4 A;  2MDI A;  1GPF A;  1NMV A;  2WLZ A;  3ART A;  2OFN A;  2JXW A;  3WL0 A;  2DWV A;  2VCD A;  4JFK A;  4QIB A;  3UI4 A;  2YAJ B;  2KFW A;  3JYM A;  2DG4 A;  4JFJ A;  5DIV A;  1FLC A;  3ARP A;  1PIN A;  3O5I A;  2DG9 A;  4P8W A;  2MLZ A;  3NRK A;  2MLY A;  1HKI A;  2WLY A;  2ZAJ A;  3M85 A;  3FXY A;  2QF8 A;  3UI5 A;  2Y8N B;  3WQV A;  3PA7 A;  1FKK A;  2MPH A;  3O5E A;  2UZ5 A;  3CGM A;  4DWS B;  1RP5 A;  3G6M A;  1FFR A;  2M08 A;  4BF8 A;  4QZV B;  3CZ8 A;  1WMV A;  2RUC A;  1SR0 A;  2DSV A;  3BMB A;  1NWR A;  4LAW A;  3B8S A;  4MGV A;  2L2S A;  3RM9 A;  3UQA A;  1D2K A;  1VF8 A;  1HJX A;  2LKN A;  2YSG A;  1EHN A;  3ARS A;  3I6C A;  4ODN A;  4DRO A;  1W1P A;  2K8I A;  4A0T A;  1FKG A;  1HXV A;  1BL4 A;  2O9O A;  3PR9 A;  1D7J A;  3UF8 A;  1FKJ A;  3O5R A;  5DO2 A;  1J4H A;  2LGO A;  2ZR6 A;  2WAD A;  3GTY X;  4Z2I A;  2FDM A;  4JYS A;  2DT3 A;  2XP3 A;  3IHZ A;  4P8U A;  1LL7 A;  3UI6 A;  4TYO A;  3B9D A;  5HWB A;  4L72 B;  3ARQ A;  2F2D A;  1SYT A;  1ZL1 A;  2RE3 A;  1U79 A;  3UQB A;  3ARO A;  2ZR4 A;  4W9P A;  1EG4 A;  3CHC A;  1ZBW A;  4LAX A;  1ZCN A;  2F21 A;  1CTN A;  4ZPT R;  3O5F A;  1KT0 A;  2ZQV A;  4WKA A;  1HJW A;  4DWS A;  1TCO C;  4ODO A;  4DWS D;  3AS3 A;  3KAI A;  1LQ0 A;  4KQZ A;  5HW8 A;  1J4I A;  3IKD A;  1WR7 A;  4MNK A;  2KE0 A;  1K9T A;  1GUV A;  4GIV A;  4P8X A;  3LKX A;  1JVW A;  1HKK A;  3CHE A;  3RM4 A;  2EZ5 W;  1WNO A;  3KZ7 A;  2O92 A;  1E6P A;  4Z2K A;  4IQ2 A;  4DRQ A;  1E6N A;  3IKG A;  4PTM A;  1FKH A;  1OWQ A;  1E6Z A;  1FAP A;  1B6C A;  5E5W A;  4DIP A;  5U47 A;  1EYM A;  1NSG A;  4REX A;  2WAE A;  1YAT A;  5GQB A;  2ZR5 A;  1GOI A;  3LE4 A;  2WK2 A;  4DWS C;  3B9A A;  3O5O A;  3KAF A;  5HW6 A;  1Q1C A;  2RUR A;  4Z2H A;  2G8Z A;  3MCB A;  2YBT A;  4G50 A;  2KO7 A;  1TK7 A;  1ZU8 A;  1FKB A;  2LAJ A;  1ZBK A;  2XPA A;  2PV3 A;  1GRJ A;  4DZ3 A;  4LGX A;  1TR8 A;  3CH9 A;  2ZQT A;  1P5Q A;  1LJY A;  4P8V A;  4A0U A;  4S3J A;  2Q5A A;  1T11 A;  4TW6 A;  2KR7 A;  4WK9 A;  4U85 A;  2L4J A;  1JND A;  1W1Y A;  2G41 A;  1XHG A;  2PBC A;  4TX0 A;  2DPE A;  2DSU A;  2M2A A;  1FKT A;  3JXV A;  4S3K A;  3KAH A;  1RD6 A;  3O5J A;  3BXW A;  4NNR A;  1LL6 A;  4JFL A;  1X6L A;  1N1A A;  4DRH A;  3OOB A;  2A3E A;  1EG3 A;  3WD1 A;  3CGN A;  3WD3 A;  5HW7 A;  1E44 A;  1W26 A;  5HUA A;  4KR0 B;  4WJX A;  4IQC A;  2DSW A;  3NI6 A;  3ALG A;  5CQ2 A;  4R5E A;  3PRA A;  4ZPW R;  3PRD A;  2F23 A;  2DK1 A;  3FAP A;  2A3C A;  4WIW A;  1BKF A;  4ML4 A;  5HTG A;  1M5Y A;  1Q6H A;  4MNM A;  5GPR A;  3ARW A;  4DZ2 A;  3RGC A;  1ITX A;  2FAP A;  2MF9 A;  1A7X A; 
#chains in the Genus database with same CATH homology
 2ITK A;  2DT0 A;  1FKL A;  5E64 A;  2OLH A;  3O5P A;  4Q7N A;  4W9O A;  3WD4 A;  2M8J A;  1LG2 A;  3TDB A;  1J4R A;  1D7I A;  1Q6U A;  3ARZ A;  2ESC A;  1FJD A;  5DEZ A;  1W1V A;  4URI A;  4IPX A;  3H9R B;  5B8I C;  3ARY A;  2KGJ A;  3EY6 A;  4Z2G A;  4GLX A;  1I5H W;  4Q22 A;  2AOS A;  1UR8 A;  4L3N A;  4Z2L A;  1WB0 A;  3TCZ A;  3G6L A;  3WIJ A;  4FN2 A;  4O2T A;  4FAP A;  1XRV A;  2VN1 A;  3W4R A;  3WD2 A;  4HBO A;  4ITZ A;  1OGG A;  4ODL A;  2YSF A;  2PI6 A;  1NMW A;  2RQS A;  1F40 A;  3O5Q A;  2ZQU A;  2XP9 A;  1NWU A;  2PV2 A;  4MNL A;  2A3A A;  4DRP A;  4ODR A;  2JMF A;  5E66 A;  5HBF A;  2M8I A;  3KAG A;  1FKS A;  2IF4 A;  2M3O W;  4DRK A;  1L1P A;  3ODK A;  1ROT A;  1UR9 A;  1J6Y A;  1HKJ A;  2JX8 A;  3FY1 A;  4TW8 A;  1R9H A;  1OGB A;  2OWO A;  1Q6I A;  5I98 A;  1FKR A;  3VAW A;  1ZK6 A;  1D6O A;  2XP4 A;  2B31 A;  4J4O A;  4R0X A;  3FSC A;  3NTP A;  1W9U A;  4WKH A;  2ZQS A;  1W9V A;  4NSB A;  2DMV A;  1FD9 A;  3KAD A;  1K9Q A;  5HWC A;  2RSE A;  4HBE A;  4U86 A;  2DT1 A;  2QRV A;  2JZV A;  1JNS A;  2KXQ A;  1X6N A;  1YW5 A;  4LAY A;  3UQI A;  1JNT A;  1W9P A;  1QPL A;  3ARV A;  1FKF A;  1KT1 A;  1FKI A;  3TC5 A;  1ZBV A;  2BA1 A;  5JH8 A;  3AS0 A;  4ZPV R;  1O6W A;  3ARU A;  1TFV A;  2MLX A;  5HT1 A;  2DJY A;  1NWS A;  1ROU A;  3QOK A;  5E65 A;  2LPV A;  4WKF A;  4IT4 A;  5DIU A;  3KAC A;  1JNE A;  3M7N A;  2DG3 A;  1FFQ A;  1FKD A;  3O5L A;  2JV4 A;  4AY1 A;  1LG1 A;  2E45 A;  1D7H A;  5HKG A;  2YSH A;  3PQH A;  3KAB A;  1ZB5 A;  3LUO A;  5J6E A;  3O5M A;  2DSZ A;  3AS1 A;  2M1I A;  2PPO A;  3O5D A;  2YBU A;  3L4H A;  4ODK A;  4TW7 A;  2RUD A;  3LKX B;  2DT2 A;  3B9E A;  3WH0 A;  2F4E A;  1NWT A;  5DF0 A;  5E62 A;  1ZBC A;  2PPN A;  1K9R A;  4J4N A;  3WL1 A;  2N87 A;  3CHF A;  4JFI A;  4W5U A;  2Y78 A;  3OA5 A;  4NZC A;  2IUZ A;  3RME A;  4N19 A;  1EDQ A;  4XAK A;  2MNT A;  3RFW A;  1KFW A;  4MSP A;  2FKE A;  3GPK A;  3IK8 A;  5BXJ A;  1Y0O A;  2D9F A;  3O5K A;  1QPF A;  4QT3 A;  3MQG A;  3WKZ A;  3ARX A;  4ODM A;  4TNS A;  2A3B A;  2DK7 A;  2YSI A;  3ALF A;  4ZS6 A;  2XP6 A;  3MCB B;  1HJV A;  4MTV A;  2AWG A;  3KCE A;  4DRM A;  1WAW A;  1PBK A;  3PRB A;  3FSB A;  5GPG A;  2RUQ A;  2PV1 A;  2YSB A;  4ODP A;  3MDY B;  1C9H A;  4E5R A;  4W9Q A;  1O6I A;  3CNG A;  2XP8 A;  1E15 A;  4MAV A;  2XP7 A;  4IT6 A;  3WD0 A;  3CHD A;  1E6R A;  5AHT A;  5DIT A;  4ODQ A;  4GGQ A;  1IX5 A;  2KI3 A;  4JFM A;  1EIB A;  1HKM A;  4MPK A;  4DRI A;  4Z2J A;  1F8A B;  1E9L A;  1NH6 A;  1H0G A;  1H0I A;  4U84 A;  4G2P A;  4DRN A;  2XPB A;  4DRJ A;  3ARR A;  1W1T A;  5D75 A;  3WQW A;  3AQU A;  3JYJ A;  1JMQ A;  3B7X A;  3AS2 A;  1EQ3 A;  3MQH A;  3O5G A;  3RM8 A;  4HAR A;  4LAV A;  4C02 B;  4MNJ A;  1LL4 A;  2LJ4 A;  2PPP A;  2WM0 A;  4QT2 A;  1QZ2 A;  3FS8 A;  2XP5 A;  4DH0 A;  4DT4 A;  2MDI A;  1GPF A;  1NMV A;  2WLZ A;  3ART A;  2OFN A;  2JXW A;  3WL0 A;  2DWV A;  2VCD A;  4JFK A;  4QIB A;  3UI4 A;  2YAJ B;  2KFW A;  3JYM A;  2DG4 A;  4JFJ A;  5DIV A;  1FLC A;  3ARP A;  1PIN A;  3O5I A;  2DG9 A;  4P8W A;  2MLZ A;  3NRK A;  2MLY A;  1HKI A;  2WLY A;  2ZAJ A;  3M85 A;  3FXY A;  2QF8 A;  3UI5 A;  2Y8N B;  3WQV A;  3PA7 A;  1FKK A;  2MPH A;  3O5E A;  2UZ5 A;  3CGM A;  4DWS B;  1RP5 A;  3G6M A;  1FFR A;  2M08 A;  4BF8 A;  4QZV B;  3CZ8 A;  1WMV A;  2RUC A;  1SR0 A;  2DSV A;  1NWR A;  4LAW A;  3B8S A;  4MGV A;  2L2S A;  3RM9 A;  3UQA A;  1D2K A;  1VF8 A;  1HJX A;  2LKN A;  2YSG A;  1EHN A;  3ARS A;  3I6C A;  4ODN A;  4DRO A;  1W1P A;  2K8I A;  4A0T A;  1FKG A;  1HXV A;  1BL4 A;  2O9O A;  3PR9 A;  1D7J A;  3UF8 A;  1FKJ A;  3O5R A;  5DO2 A;  1J4H A;  2LGO A;  2ZR6 A;  2WAD A;  4Z2I A;  2FDM A;  4JYS A;  2DT3 A;  2XP3 A;  3IHZ A;  4P8U A;  1LL7 A;  3UI6 A;  4TYO A;  3B9D A;  5HWB A;  4L72 B;  3ARQ A;  2F2D A;  1SYT A;  1ZL1 A;  2RE3 A;  1U79 A;  3UQB A;  3ARO A;  2ZR4 A;  4W9P A;  1EG4 A;  3CHC A;  1ZBW A;  4LAX A;  1ZCN A;  2F21 A;  1CTN A;  4ZPT R;  3O5F A;  1KT0 A;  2ZQV A;  4WKA A;  1HJW A;  4DWS A;  1TCO C;  4ODO A;  4DWS D;  3AS3 A;  3KAI A;  1LQ0 A;  4KQZ A;  5HW8 A;  1J4I A;  3IKD A;  1WR7 A;  4MNK A;  2KE0 A;  1K9T A;  1GUV A;  4GIV A;  4P8X A;  3LKX A;  1JVW A;  1HKK A;  3CHE A;  3RM4 A;  2EZ5 W;  1WNO A;  3KZ7 A;  2O92 A;  1E6P A;  4Z2K A;  4IQ2 A;  4DRQ A;  1E6N A;  3IKG A;  4PTM A;  1FKH A;  1OWQ A;  1E6Z A;  1FAP A;  1B6C A;  5E5W A;  4DIP A;  5U47 A;  1EYM A;  1NSG A;  4REX A;  2WAE A;  1YAT A;  5GQB A;  2ZR5 A;  1GOI A;  3LE4 A;  2WK2 A;  4DWS C;  3B9A A;  3O5O A;  3KAF A;  5HW6 A;  1Q1C A;  2RUR A;  4Z2H A;  2G8Z A;  3MCB A;  2YBT A;  4G50 A;  2KO7 A;  1TK7 A;  1ZU8 A;  1FKB A;  2LAJ A;  1ZBK A;  2XPA A;  2PV3 A;  4DZ3 A;  4LGX A;  1TR8 A;  3CH9 A;  2ZQT A;  1P5Q A;  1LJY A;  4P8V A;  4A0U A;  4S3J A;  2Q5A A;  1T11 A;  4TW6 A;  2KR7 A;  4WK9 A;  4U85 A;  2L4J A;  1JND A;  1W1Y A;  2G41 A;  1XHG A;  2PBC A;  4TX0 A;  2DPE A;  2DSU A;  2M2A A;  1FKT A;  3JXV A;  4S3K A;  3KAH A;  1RD6 A;  3O5J A;  3BXW A;  4NNR A;  1LL6 A;  4JFL A;  1X6L A;  1N1A A;  4DRH A;  3OOB A;  2A3E A;  1EG3 A;  3WD1 A;  3CGN A;  3WD3 A;  5HW7 A;  1W26 A;  5HUA A;  4KR0 B;  4WJX A;  4IQC A;  2DSW A;  3NI6 A;  3ALG A;  5CQ2 A;  4R5E A;  3PRA A;  4ZPW R;  3PRD A;  2DK1 A;  3FAP A;  2A3C A;  4WIW A;  1BKF A;  4ML4 A;  5HTG A;  1M5Y A;  1Q6H A;  4MNM A;  5GPR A;  3ARW A;  4DZ2 A;  3RGC A;  1ITX A;  2FAP A;  2MF9 A;  1A7X A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...