2DMVA

Solution structure of the second ww domain of itchy homolog e3 ubiquitin protein ligase (itch)
Total Genus 3
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
3
sequence length
43
structure length
43
Chain Sequence
GSSGSSGLPPGWEQRVDQHGRVYYVDHVEKRTTWDRPSGPSSG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Ligase
molecule keywords Itchy homolog E3 ubiquitin protein ligase
publication title Solution structure of the second ww domain of Itchy homolog E3 ubiquitin protein ligase (Itch)
rcsb
source organism Homo sapiens
total genus 3
structure length 43
sequence length 43
ec nomenclature ec 2.3.2.26: HECT-type E3 ubiquitin transferase.
pdb deposition date 2006-04-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00397 WW WW domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.20.70.10 Mainly Beta Single Sheet Ubiquitin Ligase Nedd4; Chain: W; Ubiquitin Ligase Nedd4; Chain: W; 2dmvA01
2F21A 2MDIA 2DJYA 2ZR6A 2XP6A 2LAJA 3OOBA 5CQ2A 3NTPA 2YSHA 2M3OW 2DK7A 1WR7A 3M85A 2YSBA 2Q5AA 1EG4A 2ZR4A 3CNGA 3TDBA 3WH0A 4QIBA 2XP8A 3KCEA 1NMVA 2E45A 2XPAA 3L4HA 4U85A 2EZ5W 4REXA 2JXWA 4E5RA 3ODKA 1O6WA 1ZCNA 2JMFA 1K9RA 1EG3A 2XPBA 2M8IA 1PINA 2XP7A 2JX8A 2ZR5A 3KAGA 3KAIA 4U86A 2ZAJA 1F8AB 2YSFA 3KAHA 2ITKA 2XP5A 2KXQA 2YSIA 5AHTA 2ZQVA 1K9QA 3KABA 2DWVA 1WMVA 1TK7A 2L4JA 2ZQTA 2XP9A 4U84A 1I5HW 3TCZA 2BA1A 2DK1A 3KAFA 2M8JA 2ZQSA 2RE3A 2ZQUA 2DMVA 3LE4A 3KADA 3M7NA 3TC5A 2XP4A 1JMQA 1YW5A 2JV4A 2XP3A 2YSGA
chains in the Genus database with same CATH superfamily
5E62A 5E66A 2F21A 2MDIA 2DJYA 2ZR6A 2XP6A 2LAJA 3OOBA 5CQ2A 3NTPA 2YSHA 2M3OW 3MQGA 3PQHA 3MCBA 2DK7A 3LKXB 1WR7A 3M85A 2YSBA 2Q5AA 5E65A 1EG4A 2ZR4A 2Y8NB 3CNGA 3TDBA 3WH0A 4QIBA 2YAJB 2XP8A 3KCEA 1NMVA 2E45A 2XPAA 3L4HA 5E64A 4U85A 2EZ5W 4REXA 2JXWA 4E5RA 3ODKA 1O6WA 1ZCNA 2JMFA 4GLXA 1K9RA 1EG3A 1FLCA 2XPBA 2M8IA 1PINA 2WAEA 2XP7A 2JX8A 2ZR5A 3KAGA 1RP5A 3KAIA 4U86A 2ZAJA 1F8AB 1TR8A 2YSFA 3KAHA 3FS8A 2ITKA 2XP5A 2KXQA 4A0TA 2YSIA 5AHTA 2ZQVA 1K9QA 5U47A 3KABA 2DWVA 1WMVA 1TK7A 2L4JA 2ZQTA 4A0UA 3MQHA 2XP9A 3LKXA 4U84A 1I5HW 3TCZA 2BA1A 2DK1A 3KAFA 2M8JA 2ZQSA 3MCBB 2RE3A 2ZQUA 2OWOA 2WADA 2DMVA 3LE4A 3KADA 5E5WA 3M7NA 3TC5A 3FSBA 2XP4A 3FSCA 1JMQA 1YW5A 2JV4A 2XP3A 2QRVA 2YSGA
chains in the Genus database with same CATH topology
5E62A 5E66A 2F21A 2MDIA 2DJYA 2ZR6A 2XP6A 2LAJA 3OOBA 5CQ2A 3NTPA 2YSHA 2M3OW 3MQGA 3PQHA 3MCBA 2DK7A 3LKXB 1WR7A 3M85A 2YSBA 2Q5AA 5E65A 1EG4A 2ZR4A 2Y8NB 3CNGA 3TDBA 3WH0A 4QIBA 2YAJB 2XP8A 3KCEA 1NMVA 2E45A 2XPAA 3L4HA 5E64A 4U85A 2EZ5W 4REXA 2JXWA 4E5RA 3ODKA 1O6WA 1ZCNA 2JMFA 4GLXA 1K9RA 1EG3A 1FLCA 2XPBA 2M8IA 1PINA 2WAEA 2XP7A 2JX8A 2ZR5A 3KAGA 1RP5A 3KAIA 4U86A 2ZAJA 1F8AB 1TR8A 2YSFA 3KAHA 3FS8A 2ITKA 2XP5A 2KXQA 4A0TA 2YSIA 5AHTA 2ZQVA 1K9QA 5U47A 3KABA 2DWVA 1WMVA 1TK7A 2L4JA 2ZQTA 4A0UA 3MQHA 2XP9A 3LKXA 4U84A 1I5HW 3TCZA 2BA1A 2DK1A 3KAFA 2M8JA 2ZQSA 3MCBB 2RE3A 2ZQUA 2OWOA 2WADA 2DMVA 3LE4A 3KADA 5E5WA 3M7NA 3TC5A 3FSBA 2XP4A 3FSCA 1JMQA 1YW5A 2JV4A 2XP3A 2QRVA 2YSGA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2F21 A;  2MDI A;  2DJY A;  2ZR6 A;  2XP6 A;  2LAJ A;  3OOB A;  5CQ2 A;  3NTP A;  2YSH A;  2M3O W;  2DK7 A;  1WR7 A;  3M85 A;  2YSB A;  2Q5A A;  1EG4 A;  2ZR4 A;  3CNG A;  3TDB A;  3WH0 A;  4QIB A;  2XP8 A;  3KCE A;  1NMV A;  2E45 A;  2XPA A;  3L4H A;  4U85 A;  2EZ5 W;  4REX A;  2JXW A;  4E5R A;  3ODK A;  1O6W A;  1ZCN A;  2JMF A;  1K9R A;  1EG3 A;  2XPB A;  2M8I A;  1PIN A;  2XP7 A;  2JX8 A;  2ZR5 A;  3KAG A;  3KAI A;  4U86 A;  2ZAJ A;  1F8A B;  2YSF A;  3KAH A;  2ITK A;  2XP5 A;  2KXQ A;  2YSI A;  5AHT A;  2ZQV A;  1K9Q A;  3KAB A;  2DWV A;  1WMV A;  1TK7 A;  2L4J A;  2ZQT A;  2XP9 A;  4U84 A;  1I5H W;  3TCZ A;  2BA1 A;  2DK1 A;  3KAF A;  2M8J A;  2ZQS A;  2RE3 A;  2ZQU A;  2DMV A;  3LE4 A;  3KAD A;  3M7N A;  3TC5 A;  2XP4 A;  1JMQ A;  1YW5 A;  2JV4 A;  2XP3 A;  2YSG A; 
#chains in the Genus database with same CATH topology
 5E62 A;  5E66 A;  2F21 A;  2MDI A;  2DJY A;  2ZR6 A;  2XP6 A;  2LAJ A;  3OOB A;  5CQ2 A;  3NTP A;  2YSH A;  2M3O W;  3MQG A;  3PQH A;  3MCB A;  2DK7 A;  3LKX B;  1WR7 A;  3M85 A;  2YSB A;  2Q5A A;  5E65 A;  1EG4 A;  2ZR4 A;  2Y8N B;  3CNG A;  3TDB A;  3WH0 A;  4QIB A;  2YAJ B;  2XP8 A;  3KCE A;  1NMV A;  2E45 A;  2XPA A;  3L4H A;  5E64 A;  4U85 A;  2EZ5 W;  4REX A;  2JXW A;  4E5R A;  3ODK A;  1O6W A;  1ZCN A;  2JMF A;  4GLX A;  1K9R A;  1EG3 A;  1FLC A;  2XPB A;  2M8I A;  1PIN A;  2WAE A;  2XP7 A;  2JX8 A;  2ZR5 A;  3KAG A;  1RP5 A;  3KAI A;  4U86 A;  2ZAJ A;  1F8A B;  1TR8 A;  2YSF A;  3KAH A;  3FS8 A;  2ITK A;  2XP5 A;  2KXQ A;  4A0T A;  2YSI A;  5AHT A;  2ZQV A;  1K9Q A;  5U47 A;  3KAB A;  2DWV A;  1WMV A;  1TK7 A;  2L4J A;  2ZQT A;  4A0U A;  3MQH A;  2XP9 A;  3LKX A;  4U84 A;  1I5H W;  3TCZ A;  2BA1 A;  2DK1 A;  3KAF A;  2M8J A;  2ZQS A;  3MCB B;  2RE3 A;  2ZQU A;  2OWO A;  2WAD A;  2DMV A;  3LE4 A;  3KAD A;  5E5W A;  3M7N A;  3TC5 A;  3FSB A;  2XP4 A;  3FSC A;  1JMQ A;  1YW5 A;  2JV4 A;  2XP3 A;  2QRV A;  2YSG A; 
#chains in the Genus database with same CATH homology
 5E62 A;  5E66 A;  2F21 A;  2MDI A;  2DJY A;  2ZR6 A;  2XP6 A;  2LAJ A;  3OOB A;  5CQ2 A;  3NTP A;  2YSH A;  2M3O W;  3MQG A;  3PQH A;  3MCB A;  2DK7 A;  3LKX B;  1WR7 A;  3M85 A;  2YSB A;  2Q5A A;  5E65 A;  1EG4 A;  2ZR4 A;  2Y8N B;  3CNG A;  3TDB A;  3WH0 A;  4QIB A;  2YAJ B;  2XP8 A;  3KCE A;  1NMV A;  2E45 A;  2XPA A;  3L4H A;  5E64 A;  4U85 A;  2EZ5 W;  4REX A;  2JXW A;  4E5R A;  3ODK A;  1O6W A;  1ZCN A;  2JMF A;  4GLX A;  1K9R A;  1EG3 A;  1FLC A;  2XPB A;  2M8I A;  1PIN A;  2WAE A;  2XP7 A;  2JX8 A;  2ZR5 A;  3KAG A;  1RP5 A;  3KAI A;  4U86 A;  2ZAJ A;  1F8A B;  1TR8 A;  2YSF A;  3KAH A;  3FS8 A;  2ITK A;  2XP5 A;  2KXQ A;  4A0T A;  2YSI A;  5AHT A;  2ZQV A;  1K9Q A;  5U47 A;  3KAB A;  2DWV A;  1WMV A;  1TK7 A;  2L4J A;  2ZQT A;  4A0U A;  3MQH A;  2XP9 A;  3LKX A;  4U84 A;  1I5H W;  3TCZ A;  2BA1 A;  2DK1 A;  3KAF A;  2M8J A;  2ZQS A;  3MCB B;  2RE3 A;  2ZQU A;  2OWO A;  2WAD A;  2DMV A;  3LE4 A;  3KAD A;  5E5W A;  3M7N A;  3TC5 A;  3FSB A;  2XP4 A;  3FSC A;  1JMQ A;  1YW5 A;  2JV4 A;  2XP3 A;  2QRV A;  2YSG A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...