2XP7A

Discovery of cell-active phenyl-imidazole pin1 inhibitors by structure-guided fragment evolution
Total Genus 45
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
45
sequence length
157
structure length
145
Chain Sequence
LPPGWEKAMSRSSGRVYYFNHITNASQWERPSEPARVRCSHLLVKHSQSRRPSSWRQEKITRTKEEALELINGYIQKIKSGEEDFESLASQFSDCSSAKARGDLGAFSRGQMQKPFEDASFALRTGEMSGPVFTDSGIHIILRTE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PEPTIDYL-PROLYL CIS-TRANS ISOMERASE NIMA-INTERACTING 1
publication title Discovery of Cell-Active Phenyl-Imidazole Pin1 Inhibitors by Structure-Guided Fragment Evolution.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Isomerase
total genus 45
structure length 145
sequence length 157
ec nomenclature ec 5.2.1.8: Peptidylprolyl isomerase.
pdb deposition date 2010-08-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00397 WW WW domain
A PF00639 Rotamase PPIC-type PPIASE domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.20.70.10 Mainly Beta Single Sheet Ubiquitin Ligase Nedd4; Chain: W; Ubiquitin Ligase Nedd4; Chain: W; 2xp7A01
3.10.50.40 Alpha Beta Roll Chitinase A; domain 3 Chitinase A; domain 3 2xp7A02
4LAVA 2XP4A 3IHZA 4BF8A 3O5PA 2XP3A 4R0XA 1YW5A 4JYSA 3KAIA 4DH0A 4U84A 3UI4A 4GIVA 2L4JA 3H9RB 2ZQTA 2DMVA 3VAWA 2JXWA 1B6CA 3TC5A 2RUDA 4IQ2A 2KGJA 2YSGA 4NNRA 1Q6UA 2PPOA 3KAHA 1FKSA 2PBCA 1P5QA 2EZ5W 4DRJA 5B8IC 2YSIA 1ROUA 3MDYB 4JFIA 2M08A 1JMQA 1J4RA 2DG4A 1FKFA 4N19A 4DRQA 4W9QA 1ZCNA 2RE3A 3O5OA 1EG4A 1FD9A 1JNTA 2PV1A 3PRDA 2FKEA 2M8IA 1PBKA 3RFWA 3JXVA 1FKIA 4ODMA 2DK1A 1JVWA 4ODOA 2YSBA 1FKGA 4DIPA 3LE4A 4QIBA 4TYOA 3PRBA 1T11A 2YSFA 2VN1A 4G2PA 3B7XA 1HXVA 1EYMA 4FN2A 1K9RA 1A7XA 2MPHA 2Y78A 5HT1A 3UF8A 4E5RA 5HWCA 1FKJA 3KZ7A 2DG3A 3KAFA 1PINA 2JV4A 2F21A 2RQSA 4QT3A 1QPLA 2XP6A 3IKDA 2F4EA 1JNSA 2RUQA 4DT4A 4DRMA 4G50A 2BA1A 4ODKA 4DRKA 1NSGA 1YATA 4DRIA 3UI6A 1C9HA 1U79A 2XP9A 3RGCA 1FKBA 1FKDA 4O2TA 2DJYA 1D7IA 3O5QA 2MNTA 1Q1CA 2ZAJA 1WR7A 1J4IA 4LAYA 1FKKA 2M1IA 2KXQA 4ODPA 2LGOA 3O5LA 2KFWA 4IPXA 2JZVA 1FAPA 2RUCA 3O5DA 1O6WA 4W9OA 5BXJA 2ITKA 2MLYA 2E45A 4GGQA 4ITZA 1FKLA 1J6YA 2RSEA 2DK7A 4REXA 4ODRA 2XP7A 3I6CA 3O5EA 5AHTA 2OFNA 2MF9A 1BKFA 5HKGA 2LJ4A 2IF4A 2K8IA 1D7JA 3JYJA 5GPGA 1F8AB 1D6OA 4MGVA 2ZR5A 2M8JA 4W9PA 1TCOC 3IK8A 2ZQSA 1BL4A 2AWGA 2JMFA 1KT1A 2FAPA 3L4HA 4JFJA 2ZQUA 2VCDA 1FJDA 1Q6HA 4TNSA 1FKRA 4ODLA 4TW7A 3NI6A 5HW6A 3M7NA 2LKNA 4DZ3A 1R9HA 3FAPA 1ZK6A 2MLZA 3KABA 2L2SA 1EG3A 4DRNA 4TW8A 1TK7A 1W26A 4IQCA 1NMWA 2M3OW 3TCZA 2KI3A 3PA7A 4J4OA 4TW6A 2DWVA 5HW7A 3TDBA 2PV3A 3JYMA 2KO7A 1F40A 2N87A 2PV2A 5DIUA 1J4HA 3O5JA 2KR7A 1FKHA 4DRPA 2MDIA 1WMVA 3M85A 2DG9A 3NRKA 3CGNA 3CNGA 4U86A 3KCEA 3UQBA 4C02B 1ROTA 5I98A 4J4NA 2PPNA 1QPFA 4DZ2A 4ODQA 3KACA 1K9QA 3ODKA 5HWBA 5DIVA 4DROA 1FKTA 2UZ5A 4LAXA 4ODNA 4FAPA 2M2AA 2XPAA 3UI5A 3O5GA 3IKGA 5HW8A 2Q5AA 5HTGA 4DRHA 4U85A 3O5KA 1I5HW 2ZR4A 2F2DA 3O5IA 2YSHA 1D7HA 1L1PA 2LPVA 5D75A 3O5FA 2MLXA 3GPKA 3KADA 5DITA 1Y0OA 2LAJA 3EY6A 2ZR6A 3UQAA 3OOBA 5CQ2A 4QT2A 2D9FA 5J6EA 3WH0A 1NMVA 1M5YA 1EQ3A 1N1AA 4MSPA 2RURA 3NTPA 1KT0A 2XP5A 4JFLA 3CGMA 1QZ2A 4TX0A 2XP8A 2ZQVA 2PPPA 5HUAA 4LAWA 2KE0A 3KAGA 2XPBA 1Q6IA 3O5MA 4JFKA 3UQIA 4JFMA 3LUOA 2JX8A 3O5RA
chains in the Genus database with same CATH superfamily
4LAVA 1E6PA 4QZVB 2XP4A 4Z2GA 3IHZA 2ETNA 4P8XA 4BF8A 3O5PA 2XP3A 4R0XA 4XAKA 1YW5A 4JYSA 1E6RA 3KAIA 5JH8A 2DT1A 4DH0A 4U84A 3UI4A 4GIVA 2L4JA 3H9RB 2ZQTA 3FY1A 2DMVA 3VAWA 2JXWA 1B6CA 1NWRA 2WK2A 3TC5A 1ZL1A 2RUDA 3ARTA 4IQ2A 4ZS6A 2KGJA 2YSGA 4NNRA 1Q6UA 2PPOA 1KFWA 1EHNA 3KAHA 1FKSA 3RM8A 2PBCA 3CHCA 4IT6A 3WQWA 1P5QA 3LKXB 2EZ5W 4DRJA 5B8IC 2YSIA 1ROUA 2OLHA 3MDYB 4JFIA 1VF8A 2M08A 1JMQA 4DWSB 2YBTA 1J4RA 2DG4A 1FKFA 4HBOA 1W1PA 4N19A 3AS2A 4DRQA 4W9QA 1LG1A 1ZCNA 2RE3A 3O5OA 1EG4A 1K9TA 1NWUA 1FD9A 1JNTA 2PV1A 3PRDA 3RM9A 2FKEA 2M8IA 4Z2KA 1ZU8A 1PBKA 4LGXA 3ARSA 3CHEA 3WQVA 3RFWA 1E44A 3ARXA 3JXVA 1FKIA 4ODMA 2DK1A 1JVWA 4ODOA 3W4RA 2YSBA 4DWSD 1FKGA 4DIPA 3LE4A 4QIBA 4TYOA 1E6NA 3PRBA 3G6LA 1HKJA 1T11A 2WAEA 2YSFA 4WIWA 2VN1A 3B9DA 1GUVA 4G2PA 3B7XA 1HXVA 1EYMA 1GPFA 4FN2A 4L72B 1K9RA 1A7XA 2MPHA 4KQZA 2DT0A 3MCBB 2Y78A 1HKMA 3CHDA 5HT1A 3UF8A 4E5RA 5HWCA 3B9AA 1OWQA 4NZCA 1FKJA 4ZPVR 3KZ7A 2DG3A 3KAFA 3WD3A 3B8SA 4UDMA 3ARUA 1PINA 2DSVA 2JV4A 2F21A 1UR8A 4WKHA 4L3NA 2RQSA 1HKIA 3ARPA 1SYTA 4QT3A 1QPLA 2XP6A 3QOKA 5GQBA 3IKDA 1TR8A 2EULA 2F4EA 3ARZA 3CZ8A 1JNSA 2WLZA 2RUQA 4DT4A 2WADA 4DRMA 4G50A 2DT2A 1O6IA 2BA1A 4ODKA 4DRKA 1LJYA 1NSGA 1YATA 4DRIA 3ARVA 3AROA 3UI6A 1C9HA 4Q7NA 1U79A 2XP9A 5DF0A 4R5EA 3RGCA 1FKBA 5U47A 1FKDA 4O2TA 2DJYA 1D7IA 3O5QA 2MNTA 1Q1CA 3ALFA 4Z2HA 4MNLA 2ZAJA 1WR7A 3ALGA 1J4IA 1XHGA 2YAJB 3PRAA 4LAYA 1X6NA 1FKKA 2M1IA 2KXQA 4ODPA 2LGOA 4DWSC 3O5LA 5E66A 1NH6A 1W1YA 1NWSA 1E9LA 4GLXA 2KFWA 4IPXA 2JZVA 2QF8A 5E5WA 4ML4A 1W9PA 5HBFA 1ZBWA 1FAPA 2PN0A 2RUCA 3O5DA 2A3AA 1O6WA 3MCBA 4W9OA 5BXJA 4NSBA 2ITKA 1W9VA 2MLYA 2O92A 2E45A 1RP5A 4GGQA 1GOIA 3AS0A 4A0TA 1CTNA 4S3JA 3ARWA 4ITZA 1ZBCA 1FKLA 1J6YA 3G6MA 2QRVA 2RSEA 2DK7A 5DEZA 3WL0A 4REXA 4ODRA 2XP7A 3I6CA 3O5EA 1W1TA 5AHTA 2OFNA 1FFRA 1LL7A 4WK9A 2MF9A 4MNMA 1BKFA 5HKGA 1WNOA 3EIPA 2LJ4A 1X6LA 2IF4A 2K8IA 4Z2JA 1D7JA 4KR0B 3JYJA 5GPGA 1F8AB 3RMEA 1HJVA 1D6OA 4MGVA 2ZR5A 1JCHB 2M8JA 4W9PA 2DPEA 1TCOC 3IK8A 2ZQSA 1BL4A 2AWGA 2JMFA 1ITXA 1KT1A 4URIA 2FAPA 3L4HA 4JFJA 2ZQUA 2VCDA 1FJDA 1Q6HA 4HBEA 1UR9A 2YBUA 4TNSA 4ZPTR 4WJXA 1FKRA 4ODLA 4TW7A 3NI6A 5HW6A 3M7NA 1RD6A 2LKNA 4DZ3A 1R9HA 3FAPA 1D2KA 1ZK6A 3CHFA 2MLZA 3KABA 2L2SA 1EDQA 1OGBA 1EG3A 4DRNA 4TW8A 1TK7A 1W26A 4IQCA 1NMWA 2M3OW 3TCZA 2KI3A 3PA7A 4J4OA 4Z2LA 4MAVA 5DO2A 3B9EA 4ZPWR 1FLCA 3LKXA 1HJWA 4TW6A 2DWVA 4IT4A 3MQHA 3GTYX 1W1VA 5HW7A 3TDBA 1EIBA 1TFVA 4DWSA 2PV3A 4WKAA 3BMBA 3JYMA 2KO7A 2DT3A 1F40A 1H0GA 3WD2A 2N87A 1OGGA 2PV2A 5DIUA 1J4HA 2A3EA 3ARRA 3O5JA 1IX5A 2KR7A 1FKHA 2B31A 4DRPA 2MDIA 1GRJA 3FS8A 1WMVA 3WKZA 3RM4A 3MQGA 3M85A 2OWOA 4P8UA 5E64A 2DG9A 1HJXA 2AOSA 2DSUA 2IUZA 3NRKA 3WL1A 3CGNA 3CNGA 2Y8NB 1H0IA 4U86A 3KCEA 1E6ZA 2F23A 3UQBA 2FDMA 4C02B 1ROTA 5I98A 4J4NA 2PPNA 4P8WA 4AY1A 1QPFA 4DZ2A 3ARQA 4ODQA 2WM0A 2PI6A 3ARYA 3KACA 1K9QA 3WD4A 2ESCA 3AQUA 3ODKA 5E62A 1JNEA 5HWBA 5DIVA 4DROA 1FKTA 2UZ5A 3CH9A 4LAXA 1FFQA 4P8VA 4ODNA 1LL6A 3PR9A 4FAPA 2B5UB 2M2AA 1ZB5A 2XPAA 3UI5A 4Z2IA 1E15A 3O5GA 3IKGA 2G41A 4MNJA 1W9UA 4MNKA 5HW8A 2G8ZA 4MTVA 2Q5AA 3WD0A 5HTGA 4DRHA 3FXYA 2P4VA 4U85A 1LQ0A 5GPRA 3O5KA 1I5HW 2ZR4A 2F2DA 3O5IA 2YSHA 2WLYA 1JNDA 1D7HA 1L1PA 2LPVA 5D75A 4WKFA 3O5FA 2MLXA 3GPKA 3KADA 2DSWA 5DITA 3WIJA 1Y0OA 1ZBVA 3GU0A 2LAJA 3EY6A 4W5UA 2ZR6A 4PTMA 3FSCA 3UQAA 3OOBA 5CQ2A 4QT2A 2D9FA 1LL4A 5J6EA 4MPKA 3FSBA 3WH0A 1NMVA 1M5YA 1EQ3A 2DSZA 1N1AA 4MSPA 2O9OA 4S3KA 1LG2A 1HKKA 2RURA 3WD1A 1SR0A 4A0UA 1WB0A 3NTPA 1KT0A 2XP5A 5E65A 3CGMA 4JFLA 1QZ2A 3AS1A 4TX0A 2XP8A 2A3CA 1ZBKA 3BXWA 2ZQVA 2PPPA 3AS3A 2A3BA 5HUAA 1XRVA 3PQHA 1WAWA 4Q22A 1NWTA 4LAWA 2KE0A 3KAGA 2XPBA 1Q6IA 3O5MA 4JFKA 3UQIA 3OA5A 4HARA 4JFMA 3LUOA 2JX8A 3O5RA
chains in the Genus database with same CATH topology
4LAVA 1E6PA 4QZVB 2XP4A 4Z2GA 3IHZA 4P8XA 4BF8A 3O5PA 2XP3A 4R0XA 4XAKA 1YW5A 4JYSA 1E6RA 3KAIA 5JH8A 2DT1A 4DH0A 4U84A 3UI4A 4GIVA 2L4JA 3H9RB 2ZQTA 3FY1A 2DMVA 3VAWA 2JXWA 1B6CA 1NWRA 2WK2A 3TC5A 1ZL1A 2RUDA 3ARTA 4IQ2A 4ZS6A 2KGJA 2YSGA 4NNRA 1Q6UA 2PPOA 1KFWA 1EHNA 3KAHA 1FKSA 3RM8A 2PBCA 3CHCA 4IT6A 3WQWA 1P5QA 3LKXB 2EZ5W 4DRJA 5B8IC 2YSIA 1ROUA 2OLHA 3MDYB 4JFIA 1VF8A 2M08A 1JMQA 4DWSB 2YBTA 1J4RA 2DG4A 1FKFA 4HBOA 1W1PA 4N19A 3AS2A 4DRQA 4W9QA 1LG1A 1ZCNA 2RE3A 3O5OA 1EG4A 1K9TA 1NWUA 1FD9A 1JNTA 2PV1A 3PRDA 3RM9A 2FKEA 2M8IA 4Z2KA 1ZU8A 1PBKA 4LGXA 3ARSA 3CHEA 3WQVA 3RFWA 3ARXA 3JXVA 1FKIA 4ODMA 2DK1A 1JVWA 4ODOA 3W4RA 2YSBA 4DWSD 1FKGA 4DIPA 3LE4A 4QIBA 4TYOA 1E6NA 3PRBA 3G6LA 1HKJA 1T11A 2WAEA 2YSFA 4WIWA 2VN1A 3B9DA 1GUVA 4G2PA 3B7XA 1HXVA 1EYMA 1GPFA 4FN2A 4L72B 1K9RA 1A7XA 2MPHA 4KQZA 2DT0A 3MCBB 2Y78A 1HKMA 3CHDA 5HT1A 3UF8A 4E5RA 5HWCA 3B9AA 1OWQA 4NZCA 1FKJA 4ZPVR 3KZ7A 2DG3A 3KAFA 3WD3A 3B8SA 3ARUA 1PINA 2DSVA 2JV4A 2F21A 1UR8A 4WKHA 4L3NA 2RQSA 1HKIA 3ARPA 1SYTA 4QT3A 1QPLA 2XP6A 3QOKA 5GQBA 3IKDA 1TR8A 2F4EA 3ARZA 3CZ8A 1JNSA 2WLZA 2RUQA 4DT4A 2WADA 4DRMA 4G50A 2DT2A 1O6IA 2BA1A 4ODKA 4DRKA 1LJYA 1NSGA 1YATA 4DRIA 3ARVA 3AROA 3UI6A 1C9HA 4Q7NA 1U79A 2XP9A 5DF0A 4R5EA 3RGCA 1FKBA 5U47A 1FKDA 4O2TA 2DJYA 1D7IA 3O5QA 2MNTA 1Q1CA 3ALFA 4Z2HA 4MNLA 2ZAJA 1WR7A 3ALGA 1J4IA 1XHGA 2YAJB 3PRAA 4LAYA 1X6NA 1FKKA 2M1IA 2KXQA 4ODPA 2LGOA 4DWSC 3O5LA 5E66A 1NH6A 1W1YA 1NWSA 1E9LA 4GLXA 2KFWA 4IPXA 2JZVA 2QF8A 5E5WA 4ML4A 1W9PA 5HBFA 1ZBWA 1FAPA 2RUCA 3O5DA 2A3AA 1O6WA 3MCBA 4W9OA 5BXJA 4NSBA 2ITKA 1W9VA 2MLYA 2O92A 2E45A 1RP5A 4GGQA 1GOIA 3AS0A 4A0TA 1CTNA 4S3JA 3ARWA 4ITZA 1ZBCA 1FKLA 1J6YA 3G6MA 2QRVA 2RSEA 2DK7A 5DEZA 3WL0A 4REXA 4ODRA 2XP7A 3I6CA 3O5EA 1W1TA 5AHTA 2OFNA 1FFRA 1LL7A 4WK9A 2MF9A 4MNMA 1BKFA 5HKGA 1WNOA 2LJ4A 1X6LA 2IF4A 2K8IA 4Z2JA 1D7JA 4KR0B 3JYJA 5GPGA 1F8AB 3RMEA 1HJVA 1D6OA 4MGVA 2ZR5A 2M8JA 4W9PA 2DPEA 1TCOC 3IK8A 2ZQSA 1BL4A 2AWGA 2JMFA 1ITXA 1KT1A 4URIA 2FAPA 3L4HA 4JFJA 2ZQUA 2VCDA 1FJDA 1Q6HA 4HBEA 1UR9A 2YBUA 4TNSA 4ZPTR 4WJXA 1FKRA 4ODLA 4TW7A 3NI6A 5HW6A 3M7NA 1RD6A 2LKNA 4DZ3A 1R9HA 3FAPA 1D2KA 1ZK6A 3CHFA 2MLZA 3KABA 2L2SA 1EDQA 1OGBA 1EG3A 4DRNA 4TW8A 1TK7A 1W26A 4IQCA 1NMWA 2M3OW 3TCZA 2KI3A 3PA7A 4J4OA 4Z2LA 4MAVA 5DO2A 3B9EA 4ZPWR 1FLCA 3LKXA 1HJWA 4TW6A 2DWVA 4IT4A 3MQHA 5HW7A 1W1VA 3TDBA 1EIBA 1TFVA 4DWSA 2PV3A 4WKAA 3JYMA 2KO7A 2DT3A 1F40A 1H0GA 3WD2A 2N87A 1OGGA 2PV2A 5DIUA 1J4HA 2A3EA 3ARRA 3O5JA 1IX5A 2KR7A 1FKHA 2B31A 4DRPA 2MDIA 3FS8A 1WMVA 3WKZA 3RM4A 3MQGA 3M85A 2OWOA 4P8UA 5E64A 2DG9A 1HJXA 2AOSA 2DSUA 2IUZA 3NRKA 3WL1A 3CGNA 3CNGA 2Y8NB 1H0IA 4U86A 3KCEA 1E6ZA 3UQBA 2FDMA 4C02B 1ROTA 5I98A 4J4NA 2PPNA 4P8WA 4AY1A 1QPFA 4DZ2A 3ARQA 4ODQA 2WM0A 2PI6A 3ARYA 3KACA 1K9QA 3WD4A 2ESCA 3AQUA 3ODKA 5E62A 1JNEA 5HWBA 5DIVA 4DROA 1FKTA 2UZ5A 3CH9A 4LAXA 1FFQA 4P8VA 4ODNA 1LL6A 3PR9A 4FAPA 2M2AA 1ZB5A 2XPAA 3UI5A 4Z2IA 1E15A 3O5GA 3IKGA 2G41A 4MNJA 1W9UA 4MNKA 5HW8A 2G8ZA 4MTVA 2Q5AA 3WD0A 5HTGA 4DRHA 3FXYA 5GPRA 4U85A 1LQ0A 3O5KA 1I5HW 2ZR4A 2F2DA 3O5IA 2YSHA 2WLYA 1JNDA 1D7HA 1L1PA 2LPVA 5D75A 4WKFA 3O5FA 2MLXA 3GPKA 3KADA 2DSWA 5DITA 3WIJA 1Y0OA 1ZBVA 2LAJA 3EY6A 4W5UA 2ZR6A 4PTMA 3FSCA 3UQAA 3OOBA 5CQ2A 4QT2A 2D9FA 1LL4A 5J6EA 4MPKA 3FSBA 3WH0A 1NMVA 1M5YA 1EQ3A 2DSZA 1N1AA 4MSPA 2O9OA 4S3KA 1LG2A 1HKKA 2RURA 3WD1A 1SR0A 4A0UA 1WB0A 3NTPA 1KT0A 2XP5A 5E65A 3CGMA 4JFLA 1QZ2A 3AS1A 4TX0A 2XP8A 2A3CA 1ZBKA 3BXWA 2ZQVA 2PPPA 3AS3A 2A3BA 5HUAA 1XRVA 3PQHA 1WAWA 4Q22A 1NWTA 4LAWA 2KE0A 3KAGA 2XPBA 1Q6IA 3O5MA 4JFKA 3UQIA 3OA5A 4HARA 4JFMA 3LUOA 2JX8A 3O5RA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4LAV A;  2XP4 A;  3IHZ A;  4BF8 A;  3O5P A;  2XP3 A;  4R0X A;  1YW5 A;  4JYS A;  3KAI A;  4DH0 A;  4U84 A;  3UI4 A;  4GIV A;  2L4J A;  3H9R B;  2ZQT A;  2DMV A;  3VAW A;  2JXW A;  1B6C A;  3TC5 A;  2RUD A;  4IQ2 A;  2KGJ A;  2YSG A;  4NNR A;  1Q6U A;  2PPO A;  3KAH A;  1FKS A;  2PBC A;  1P5Q A;  2EZ5 W;  4DRJ A;  5B8I C;  2YSI A;  1ROU A;  3MDY B;  4JFI A;  2M08 A;  1JMQ A;  1J4R A;  2DG4 A;  1FKF A;  4N19 A;  4DRQ A;  4W9Q A;  1ZCN A;  2RE3 A;  3O5O A;  1EG4 A;  1FD9 A;  1JNT A;  2PV1 A;  3PRD A;  2FKE A;  2M8I A;  1PBK A;  3RFW A;  3JXV A;  1FKI A;  4ODM A;  2DK1 A;  1JVW A;  4ODO A;  2YSB A;  1FKG A;  4DIP A;  3LE4 A;  4QIB A;  4TYO A;  3PRB A;  1T11 A;  2YSF A;  2VN1 A;  4G2P A;  3B7X A;  1HXV A;  1EYM A;  4FN2 A;  1K9R A;  1A7X A;  2MPH A;  2Y78 A;  5HT1 A;  3UF8 A;  4E5R A;  5HWC A;  1FKJ A;  3KZ7 A;  2DG3 A;  3KAF A;  1PIN A;  2JV4 A;  2F21 A;  2RQS A;  4QT3 A;  1QPL A;  2XP6 A;  3IKD A;  2F4E A;  1JNS A;  2RUQ A;  4DT4 A;  4DRM A;  4G50 A;  2BA1 A;  4ODK A;  4DRK A;  1NSG A;  1YAT A;  4DRI A;  3UI6 A;  1C9H A;  1U79 A;  2XP9 A;  3RGC A;  1FKB A;  1FKD A;  4O2T A;  2DJY A;  1D7I A;  3O5Q A;  2MNT A;  1Q1C A;  2ZAJ A;  1WR7 A;  1J4I A;  4LAY A;  1FKK A;  2M1I A;  2KXQ A;  4ODP A;  2LGO A;  3O5L A;  2KFW A;  4IPX A;  2JZV A;  1FAP A;  2RUC A;  3O5D A;  1O6W A;  4W9O A;  5BXJ A;  2ITK A;  2MLY A;  2E45 A;  4GGQ A;  4ITZ A;  1FKL A;  1J6Y A;  2RSE A;  2DK7 A;  4REX A;  4ODR A;  2XP7 A;  3I6C A;  3O5E A;  5AHT A;  2OFN A;  2MF9 A;  1BKF A;  5HKG A;  2LJ4 A;  2IF4 A;  2K8I A;  1D7J A;  3JYJ A;  5GPG A;  1F8A B;  1D6O A;  4MGV A;  2ZR5 A;  2M8J A;  4W9P A;  1TCO C;  3IK8 A;  2ZQS A;  1BL4 A;  2AWG A;  2JMF A;  1KT1 A;  2FAP A;  3L4H A;  4JFJ A;  2ZQU A;  2VCD A;  1FJD A;  1Q6H A;  4TNS A;  1FKR A;  4ODL A;  4TW7 A;  3NI6 A;  5HW6 A;  3M7N A;  2LKN A;  4DZ3 A;  1R9H A;  3FAP A;  1ZK6 A;  2MLZ A;  3KAB A;  2L2S A;  1EG3 A;  4DRN A;  4TW8 A;  1TK7 A;  1W26 A;  4IQC A;  1NMW A;  2M3O W;  3TCZ A;  2KI3 A;  3PA7 A;  4J4O A;  4TW6 A;  2DWV A;  5HW7 A;  3TDB A;  2PV3 A;  3JYM A;  2KO7 A;  1F40 A;  2N87 A;  2PV2 A;  5DIU A;  1J4H A;  3O5J A;  2KR7 A;  1FKH A;  4DRP A;  2MDI A;  1WMV A;  3M85 A;  2DG9 A;  3NRK A;  3CGN A;  3CNG A;  4U86 A;  3KCE A;  3UQB A;  4C02 B;  1ROT A;  5I98 A;  4J4N A;  2PPN A;  1QPF A;  4DZ2 A;  4ODQ A;  3KAC A;  1K9Q A;  3ODK A;  5HWB A;  5DIV A;  4DRO A;  1FKT A;  2UZ5 A;  4LAX A;  4ODN A;  4FAP A;  2M2A A;  2XPA A;  3UI5 A;  3O5G A;  3IKG A;  5HW8 A;  2Q5A A;  5HTG A;  4DRH A;  4U85 A;  3O5K A;  1I5H W;  2ZR4 A;  2F2D A;  3O5I A;  2YSH A;  1D7H A;  1L1P A;  2LPV A;  5D75 A;  3O5F A;  2MLX A;  3GPK A;  3KAD A;  5DIT A;  1Y0O A;  2LAJ A;  3EY6 A;  2ZR6 A;  3UQA A;  3OOB A;  5CQ2 A;  4QT2 A;  2D9F A;  5J6E A;  3WH0 A;  1NMV A;  1M5Y A;  1EQ3 A;  1N1A A;  4MSP A;  2RUR A;  3NTP A;  1KT0 A;  2XP5 A;  4JFL A;  3CGM A;  1QZ2 A;  4TX0 A;  2XP8 A;  2ZQV A;  2PPP A;  5HUA A;  4LAW A;  2KE0 A;  3KAG A;  2XPB A;  1Q6I A;  3O5M A;  4JFK A;  3UQI A;  4JFM A;  3LUO A;  2JX8 A;  3O5R A; 
#chains in the Genus database with same CATH topology
 4LAV A;  1E6P A;  4QZV B;  2XP4 A;  4Z2G A;  3IHZ A;  2ETN A;  4P8X A;  4BF8 A;  3O5P A;  2XP3 A;  4R0X A;  4XAK A;  1YW5 A;  4JYS A;  1E6R A;  3KAI A;  5JH8 A;  2DT1 A;  4DH0 A;  4U84 A;  3UI4 A;  4GIV A;  2L4J A;  3H9R B;  2ZQT A;  3FY1 A;  2DMV A;  3VAW A;  2JXW A;  1B6C A;  1NWR A;  2WK2 A;  3TC5 A;  1ZL1 A;  2RUD A;  3ART A;  4IQ2 A;  4ZS6 A;  2KGJ A;  2YSG A;  4NNR A;  1Q6U A;  2PPO A;  1KFW A;  1EHN A;  3KAH A;  1FKS A;  3RM8 A;  2PBC A;  3CHC A;  4IT6 A;  3WQW A;  1P5Q A;  3LKX B;  2EZ5 W;  4DRJ A;  5B8I C;  2YSI A;  1ROU A;  2OLH A;  3MDY B;  4JFI A;  1VF8 A;  2M08 A;  1JMQ A;  4DWS B;  2YBT A;  1J4R A;  2DG4 A;  1FKF A;  4HBO A;  1W1P A;  4N19 A;  3AS2 A;  4DRQ A;  4W9Q A;  1LG1 A;  1ZCN A;  2RE3 A;  3O5O A;  1EG4 A;  1K9T A;  1NWU A;  1FD9 A;  1JNT A;  2PV1 A;  3PRD A;  3RM9 A;  2FKE A;  2M8I A;  4Z2K A;  1ZU8 A;  1PBK A;  4LGX A;  3ARS A;  3CHE A;  3WQV A;  3RFW A;  1E44 A;  3ARX A;  3JXV A;  1FKI A;  4ODM A;  2DK1 A;  1JVW A;  4ODO A;  3W4R A;  2YSB A;  4DWS D;  1FKG A;  4DIP A;  3LE4 A;  4QIB A;  4TYO A;  1E6N A;  3PRB A;  3G6L A;  1HKJ A;  1T11 A;  2WAE A;  2YSF A;  4WIW A;  2VN1 A;  3B9D A;  1GUV A;  4G2P A;  3B7X A;  1HXV A;  1EYM A;  1GPF A;  4FN2 A;  4L72 B;  1K9R A;  1A7X A;  2MPH A;  4KQZ A;  2DT0 A;  3MCB B;  2Y78 A;  1HKM A;  3CHD A;  5HT1 A;  3UF8 A;  4E5R A;  5HWC A;  3B9A A;  1OWQ A;  4NZC A;  1FKJ A;  4ZPV R;  3KZ7 A;  2DG3 A;  3KAF A;  3WD3 A;  3B8S A;  4UDM A;  3ARU A;  1PIN A;  2DSV A;  2JV4 A;  2F21 A;  1UR8 A;  4WKH A;  4L3N A;  2RQS A;  1HKI A;  3ARP A;  1SYT A;  4QT3 A;  1QPL A;  2XP6 A;  3QOK A;  5GQB A;  3IKD A;  1TR8 A;  2EUL A;  2F4E A;  3ARZ A;  3CZ8 A;  1JNS A;  2WLZ A;  2RUQ A;  4DT4 A;  2WAD A;  4DRM A;  4G50 A;  2DT2 A;  1O6I A;  2BA1 A;  4ODK A;  4DRK A;  1LJY A;  1NSG A;  1YAT A;  4DRI A;  3ARV A;  3ARO A;  3UI6 A;  1C9H A;  4Q7N A;  1U79 A;  2XP9 A;  5DF0 A;  4R5E A;  3RGC A;  1FKB A;  5U47 A;  1FKD A;  4O2T A;  2DJY A;  1D7I A;  3O5Q A;  2MNT A;  1Q1C A;  3ALF A;  4Z2H A;  4MNL A;  2ZAJ A;  1WR7 A;  3ALG A;  1J4I A;  1XHG A;  2YAJ B;  3PRA A;  4LAY A;  1X6N A;  1FKK A;  2M1I A;  2KXQ A;  4ODP A;  2LGO A;  4DWS C;  3O5L A;  5E66 A;  1NH6 A;  1W1Y A;  1NWS A;  1E9L A;  4GLX A;  2KFW A;  4IPX A;  2JZV A;  2QF8 A;  5E5W A;  4ML4 A;  1W9P A;  5HBF A;  1ZBW A;  1FAP A;  2PN0 A;  2RUC A;  3O5D A;  2A3A A;  1O6W A;  3MCB A;  4W9O A;  5BXJ A;  4NSB A;  2ITK A;  1W9V A;  2MLY A;  2O92 A;  2E45 A;  1RP5 A;  4GGQ A;  1GOI A;  3AS0 A;  4A0T A;  1CTN A;  4S3J A;  3ARW A;  4ITZ A;  1ZBC A;  1FKL A;  1J6Y A;  3G6M A;  2QRV A;  2RSE A;  2DK7 A;  5DEZ A;  3WL0 A;  4REX A;  4ODR A;  2XP7 A;  3I6C A;  3O5E A;  1W1T A;  5AHT A;  2OFN A;  1FFR A;  1LL7 A;  4WK9 A;  2MF9 A;  4MNM A;  1BKF A;  5HKG A;  1WNO A;  3EIP A;  2LJ4 A;  1X6L A;  2IF4 A;  2K8I A;  4Z2J A;  1D7J A;  4KR0 B;  3JYJ A;  5GPG A;  1F8A B;  3RME A;  1HJV A;  1D6O A;  4MGV A;  2ZR5 A;  1JCH B;  2M8J A;  4W9P A;  2DPE A;  1TCO C;  3IK8 A;  2ZQS A;  1BL4 A;  2AWG A;  2JMF A;  1ITX A;  1KT1 A;  4URI A;  2FAP A;  3L4H A;  4JFJ A;  2ZQU A;  2VCD A;  1FJD A;  1Q6H A;  4HBE A;  1UR9 A;  2YBU A;  4TNS A;  4ZPT R;  4WJX A;  1FKR A;  4ODL A;  4TW7 A;  3NI6 A;  5HW6 A;  3M7N A;  1RD6 A;  2LKN A;  4DZ3 A;  1R9H A;  3FAP A;  1D2K A;  1ZK6 A;  3CHF A;  2MLZ A;  3KAB A;  2L2S A;  1EDQ A;  1OGB A;  1EG3 A;  4DRN A;  4TW8 A;  1TK7 A;  1W26 A;  4IQC A;  1NMW A;  2M3O W;  3TCZ A;  2KI3 A;  3PA7 A;  4J4O A;  4Z2L A;  4MAV A;  5DO2 A;  3B9E A;  4ZPW R;  1FLC A;  3LKX A;  1HJW A;  4TW6 A;  2DWV A;  4IT4 A;  3MQH A;  3GTY X;  1W1V A;  5HW7 A;  3TDB A;  1EIB A;  1TFV A;  4DWS A;  2PV3 A;  4WKA A;  3BMB A;  3JYM A;  2KO7 A;  2DT3 A;  1F40 A;  1H0G A;  3WD2 A;  2N87 A;  1OGG A;  2PV2 A;  5DIU A;  1J4H A;  2A3E A;  3ARR A;  3O5J A;  1IX5 A;  2KR7 A;  1FKH A;  2B31 A;  4DRP A;  2MDI A;  1GRJ A;  3FS8 A;  1WMV A;  3WKZ A;  3RM4 A;  3MQG A;  3M85 A;  2OWO A;  4P8U A;  5E64 A;  2DG9 A;  1HJX A;  2AOS A;  2DSU A;  2IUZ A;  3NRK A;  3WL1 A;  3CGN A;  3CNG A;  2Y8N B;  1H0I A;  4U86 A;  3KCE A;  1E6Z A;  2F23 A;  3UQB A;  2FDM A;  4C02 B;  1ROT A;  5I98 A;  4J4N A;  2PPN A;  4P8W A;  4AY1 A;  1QPF A;  4DZ2 A;  3ARQ A;  4ODQ A;  2WM0 A;  2PI6 A;  3ARY A;  3KAC A;  1K9Q A;  3WD4 A;  2ESC A;  3AQU A;  3ODK A;  5E62 A;  1JNE A;  5HWB A;  5DIV A;  4DRO A;  1FKT A;  2UZ5 A;  3CH9 A;  4LAX A;  1FFQ A;  4P8V A;  4ODN A;  1LL6 A;  3PR9 A;  4FAP A;  2B5U B;  2M2A A;  1ZB5 A;  2XPA A;  3UI5 A;  4Z2I A;  1E15 A;  3O5G A;  3IKG A;  2G41 A;  4MNJ A;  1W9U A;  4MNK A;  5HW8 A;  2G8Z A;  4MTV A;  2Q5A A;  3WD0 A;  5HTG A;  4DRH A;  3FXY A;  2P4V A;  4U85 A;  1LQ0 A;  5GPR A;  3O5K A;  1I5H W;  2ZR4 A;  2F2D A;  3O5I A;  2YSH A;  2WLY A;  1JND A;  1D7H A;  1L1P A;  2LPV A;  5D75 A;  4WKF A;  3O5F A;  2MLX A;  3GPK A;  3KAD A;  2DSW A;  5DIT A;  3WIJ A;  1Y0O A;  1ZBV A;  3GU0 A;  2LAJ A;  3EY6 A;  4W5U A;  2ZR6 A;  4PTM A;  3FSC A;  3UQA A;  3OOB A;  5CQ2 A;  4QT2 A;  2D9F A;  1LL4 A;  5J6E A;  4MPK A;  3FSB A;  3WH0 A;  1NMV A;  1M5Y A;  1EQ3 A;  2DSZ A;  1N1A A;  4MSP A;  2O9O A;  4S3K A;  1LG2 A;  1HKK A;  2RUR A;  3WD1 A;  1SR0 A;  4A0U A;  1WB0 A;  3NTP A;  1KT0 A;  2XP5 A;  5E65 A;  3CGM A;  4JFL A;  1QZ2 A;  3AS1 A;  4TX0 A;  2XP8 A;  2A3C A;  1ZBK A;  3BXW A;  2ZQV A;  2PPP A;  3AS3 A;  2A3B A;  5HUA A;  1XRV A;  3PQH A;  1WAW A;  4Q22 A;  1NWT A;  4LAW A;  2KE0 A;  3KAG A;  2XPB A;  1Q6I A;  3O5M A;  4JFK A;  3UQI A;  3OA5 A;  4HAR A;  4JFM A;  3LUO A;  2JX8 A;  3O5R A; 
#chains in the Genus database with same CATH homology
 4LAV A;  1E6P A;  4QZV B;  2XP4 A;  4Z2G A;  3IHZ A;  4P8X A;  4BF8 A;  3O5P A;  2XP3 A;  4R0X A;  4XAK A;  1YW5 A;  4JYS A;  1E6R A;  3KAI A;  5JH8 A;  2DT1 A;  4DH0 A;  4U84 A;  3UI4 A;  4GIV A;  2L4J A;  3H9R B;  2ZQT A;  3FY1 A;  2DMV A;  3VAW A;  2JXW A;  1B6C A;  1NWR A;  2WK2 A;  3TC5 A;  1ZL1 A;  2RUD A;  3ART A;  4IQ2 A;  4ZS6 A;  2KGJ A;  2YSG A;  4NNR A;  1Q6U A;  2PPO A;  1KFW A;  1EHN A;  3KAH A;  1FKS A;  3RM8 A;  2PBC A;  3CHC A;  4IT6 A;  3WQW A;  1P5Q A;  3LKX B;  2EZ5 W;  4DRJ A;  5B8I C;  2YSI A;  1ROU A;  2OLH A;  3MDY B;  4JFI A;  1VF8 A;  2M08 A;  1JMQ A;  4DWS B;  2YBT A;  1J4R A;  2DG4 A;  1FKF A;  4HBO A;  1W1P A;  4N19 A;  3AS2 A;  4DRQ A;  4W9Q A;  1LG1 A;  1ZCN A;  2RE3 A;  3O5O A;  1EG4 A;  1K9T A;  1NWU A;  1FD9 A;  1JNT A;  2PV1 A;  3PRD A;  3RM9 A;  2FKE A;  2M8I A;  4Z2K A;  1ZU8 A;  1PBK A;  4LGX A;  3ARS A;  3CHE A;  3WQV A;  3RFW A;  3ARX A;  3JXV A;  1FKI A;  4ODM A;  2DK1 A;  1JVW A;  4ODO A;  3W4R A;  2YSB A;  4DWS D;  1FKG A;  4DIP A;  3LE4 A;  4QIB A;  4TYO A;  1E6N A;  3PRB A;  3G6L A;  1HKJ A;  1T11 A;  2WAE A;  2YSF A;  4WIW A;  2VN1 A;  3B9D A;  1GUV A;  4G2P A;  3B7X A;  1HXV A;  1EYM A;  1GPF A;  4FN2 A;  4L72 B;  1K9R A;  1A7X A;  2MPH A;  4KQZ A;  2DT0 A;  3MCB B;  2Y78 A;  1HKM A;  3CHD A;  5HT1 A;  3UF8 A;  4E5R A;  5HWC A;  3B9A A;  1OWQ A;  4NZC A;  1FKJ A;  4ZPV R;  3KZ7 A;  2DG3 A;  3KAF A;  3WD3 A;  3B8S A;  3ARU A;  1PIN A;  2DSV A;  2JV4 A;  2F21 A;  1UR8 A;  4WKH A;  4L3N A;  2RQS A;  1HKI A;  3ARP A;  1SYT A;  4QT3 A;  1QPL A;  2XP6 A;  3QOK A;  5GQB A;  3IKD A;  1TR8 A;  2F4E A;  3ARZ A;  3CZ8 A;  1JNS A;  2WLZ A;  2RUQ A;  4DT4 A;  2WAD A;  4DRM A;  4G50 A;  2DT2 A;  1O6I A;  2BA1 A;  4ODK A;  4DRK A;  1LJY A;  1NSG A;  1YAT A;  4DRI A;  3ARV A;  3ARO A;  3UI6 A;  1C9H A;  4Q7N A;  1U79 A;  2XP9 A;  5DF0 A;  4R5E A;  3RGC A;  1FKB A;  5U47 A;  1FKD A;  4O2T A;  2DJY A;  1D7I A;  3O5Q A;  2MNT A;  1Q1C A;  3ALF A;  4Z2H A;  4MNL A;  2ZAJ A;  1WR7 A;  3ALG A;  1J4I A;  1XHG A;  2YAJ B;  3PRA A;  4LAY A;  1X6N A;  1FKK A;  2M1I A;  2KXQ A;  4ODP A;  2LGO A;  4DWS C;  3O5L A;  5E66 A;  1NH6 A;  1W1Y A;  1NWS A;  1E9L A;  4GLX A;  2KFW A;  4IPX A;  2JZV A;  2QF8 A;  5E5W A;  4ML4 A;  1W9P A;  5HBF A;  1ZBW A;  1FAP A;  2RUC A;  3O5D A;  2A3A A;  1O6W A;  3MCB A;  4W9O A;  5BXJ A;  4NSB A;  2ITK A;  1W9V A;  2MLY A;  2O92 A;  2E45 A;  1RP5 A;  4GGQ A;  1GOI A;  3AS0 A;  4A0T A;  1CTN A;  4S3J A;  3ARW A;  4ITZ A;  1ZBC A;  1FKL A;  1J6Y A;  3G6M A;  2QRV A;  2RSE A;  2DK7 A;  5DEZ A;  3WL0 A;  4REX A;  4ODR A;  2XP7 A;  3I6C A;  3O5E A;  1W1T A;  5AHT A;  2OFN A;  1FFR A;  1LL7 A;  4WK9 A;  2MF9 A;  4MNM A;  1BKF A;  5HKG A;  1WNO A;  2LJ4 A;  1X6L A;  2IF4 A;  2K8I A;  4Z2J A;  1D7J A;  4KR0 B;  3JYJ A;  5GPG A;  1F8A B;  3RME A;  1HJV A;  1D6O A;  4MGV A;  2ZR5 A;  2M8J A;  4W9P A;  2DPE A;  1TCO C;  3IK8 A;  2ZQS A;  1BL4 A;  2AWG A;  2JMF A;  1ITX A;  1KT1 A;  4URI A;  2FAP A;  3L4H A;  4JFJ A;  2ZQU A;  2VCD A;  1FJD A;  1Q6H A;  4HBE A;  1UR9 A;  2YBU A;  4TNS A;  4ZPT R;  4WJX A;  1FKR A;  4ODL A;  4TW7 A;  3NI6 A;  5HW6 A;  3M7N A;  1RD6 A;  2LKN A;  4DZ3 A;  1R9H A;  3FAP A;  1D2K A;  1ZK6 A;  3CHF A;  2MLZ A;  3KAB A;  2L2S A;  1EDQ A;  1OGB A;  1EG3 A;  4DRN A;  4TW8 A;  1TK7 A;  1W26 A;  4IQC A;  1NMW A;  2M3O W;  3TCZ A;  2KI3 A;  3PA7 A;  4J4O A;  4Z2L A;  4MAV A;  5DO2 A;  3B9E A;  4ZPW R;  1FLC A;  3LKX A;  1HJW A;  4TW6 A;  2DWV A;  4IT4 A;  3MQH A;  5HW7 A;  1W1V A;  3TDB A;  1EIB A;  1TFV A;  4DWS A;  2PV3 A;  4WKA A;  3JYM A;  2KO7 A;  2DT3 A;  1F40 A;  1H0G A;  3WD2 A;  2N87 A;  1OGG A;  2PV2 A;  5DIU A;  1J4H A;  2A3E A;  3ARR A;  3O5J A;  1IX5 A;  2KR7 A;  1FKH A;  2B31 A;  4DRP A;  2MDI A;  3FS8 A;  1WMV A;  3WKZ A;  3RM4 A;  3MQG A;  3M85 A;  2OWO A;  4P8U A;  5E64 A;  2DG9 A;  1HJX A;  2AOS A;  2DSU A;  2IUZ A;  3NRK A;  3WL1 A;  3CGN A;  3CNG A;  2Y8N B;  1H0I A;  4U86 A;  3KCE A;  1E6Z A;  3UQB A;  2FDM A;  4C02 B;  1ROT A;  5I98 A;  4J4N A;  2PPN A;  4P8W A;  4AY1 A;  1QPF A;  4DZ2 A;  3ARQ A;  4ODQ A;  2WM0 A;  2PI6 A;  3ARY A;  3KAC A;  1K9Q A;  3WD4 A;  2ESC A;  3AQU A;  3ODK A;  5E62 A;  1JNE A;  5HWB A;  5DIV A;  4DRO A;  1FKT A;  2UZ5 A;  3CH9 A;  4LAX A;  1FFQ A;  4P8V A;  4ODN A;  1LL6 A;  3PR9 A;  4FAP A;  2M2A A;  1ZB5 A;  2XPA A;  3UI5 A;  4Z2I A;  1E15 A;  3O5G A;  3IKG A;  2G41 A;  4MNJ A;  1W9U A;  4MNK A;  5HW8 A;  2G8Z A;  4MTV A;  2Q5A A;  3WD0 A;  5HTG A;  4DRH A;  3FXY A;  5GPR A;  4U85 A;  1LQ0 A;  3O5K A;  1I5H W;  2ZR4 A;  2F2D A;  3O5I A;  2YSH A;  2WLY A;  1JND A;  1D7H A;  1L1P A;  2LPV A;  5D75 A;  4WKF A;  3O5F A;  2MLX A;  3GPK A;  3KAD A;  2DSW A;  5DIT A;  3WIJ A;  1Y0O A;  1ZBV A;  2LAJ A;  3EY6 A;  4W5U A;  2ZR6 A;  4PTM A;  3FSC A;  3UQA A;  3OOB A;  5CQ2 A;  4QT2 A;  2D9F A;  1LL4 A;  5J6E A;  4MPK A;  3FSB A;  3WH0 A;  1NMV A;  1M5Y A;  1EQ3 A;  2DSZ A;  1N1A A;  4MSP A;  2O9O A;  4S3K A;  1LG2 A;  1HKK A;  2RUR A;  3WD1 A;  1SR0 A;  4A0U A;  1WB0 A;  3NTP A;  1KT0 A;  2XP5 A;  5E65 A;  3CGM A;  4JFL A;  1QZ2 A;  3AS1 A;  4TX0 A;  2XP8 A;  2A3C A;  1ZBK A;  3BXW A;  2ZQV A;  2PPP A;  3AS3 A;  2A3B A;  5HUA A;  1XRV A;  3PQH A;  1WAW A;  4Q22 A;  1NWT A;  4LAW A;  2KE0 A;  3KAG A;  2XPB A;  1Q6I A;  3O5M A;  4JFK A;  3UQI A;  3OA5 A;  4HAR A;  4JFM A;  3LUO A;  2JX8 A;  3O5R A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...