2XP7A

Discovery of cell-active phenyl-imidazole pin1 inhibitors by structure-guided fragment evolution
Total Genus 45
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
45
sequence length
157
structure length
145
Chain Sequence
LPPGWEKAMSRSSGRVYYFNHITNASQWERPSEPARVRCSHLLVKHSQSRRPSSWRQEKITRTKEEALELINGYIQKIKSGEEDFESLASQFSDCSSAKARGDLGAFSRGQMQKPFEDASFALRTGEMSGPVFTDSGIHIILRTE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Isomerase
molecule keywords PEPTIDYL-PROLYL CIS-TRANS ISOMERASE NIMA-INTERACTING 1
publication title Discovery of Cell-Active Phenyl-Imidazole Pin1 Inhibitors by Structure-Guided Fragment Evolution.
pubmed doi rcsb
source organism Homo sapiens
total genus 45
structure length 145
sequence length 157
ec nomenclature ec 5.2.1.8: Peptidylprolyl isomerase.
pdb deposition date 2010-08-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00397 WW WW domain
A PF00639 Rotamase PPIC-type PPIASE domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.20.70.10 Mainly Beta Single Sheet Ubiquitin Ligase Nedd4; Chain: W; Ubiquitin Ligase Nedd4; Chain: W; 2xp7A01
3.10.50.40 Alpha Beta Roll Chitinase A; domain 3 Chitinase A; domain 3 2xp7A02
1EG4A 2L2SA 3O5KA 5DIVA 2XP4A 2UZ5A 4E5RA 4TX0A 5HTGA 1FKIA 3M7NA 3JXVA 2FKEA 2KI3A 3H9RB 4C02B 4FN2A 4JFKA 4QIBA 1J4RA 2PPPA 2L4JA 3O5IA 5HW6A 1O6WA 2MF9A 1T11A 2VCDA 1FKDA 2DK7A 1ROTA 1NMVA 1D7HA 1FKLA 3O5OA 2LGOA 2XP6A 1FKBA 1L1PA 4DRKA 3UI5A 3I6CA 3UQIA 4W9QA 2F21A 1B6CA 2FAPA 4GIVA 4TW8A 1ZCNA 1M5YA 2YSBA 2MNTA 2M08A 3NI6A 2XPBA 2E45A 5HW8A 3O5GA 3UI6A 1TCOC 3UF8A 2BA1A 1YATA 4REXA 4R0XA 3KAGA 4JFIA 2LPVA 1JMQA 2M3OW 1FD9A 3CGNA 2YSHA 2JZVA 2M1IA 2RSEA 3UI4A 2KO7A 2YSFA 1J4IA 5HWCA 4DIPA 4DRIA 4LAVA 4IPXA 1KT1A 2ZAJA 1C9HA 1F8AB 2PV3A 4ODOA 4U85A 1F40A 1EQ3A 1JNTA 3IKGA 2OFNA 2RQSA 1QPLA 4JFLA 2AWGA 4GGQA 2XPAA 3MDYB 5DITA 4BF8A 2MLZA 1YW5A 3VAWA 4LAXA 4TNSA 1JVWA 4DZ2A 4O2TA 1FKGA 4JFJA 3KAFA 2XP5A 2PV1A 3B7XA 2DMVA 3CGMA 4JYSA 1K9RA 2DG3A 2PV2A 2XP3A 2D9FA 2MLYA 1J4HA 4NNRA 5J6EA 4ODMA 3UQAA 2M8IA 2DJYA 2K8IA 1JNSA 1PBKA 1Q1CA 1Q6UA 2EZ5W 5DIUA 2DWVA 4DH0A 4QT2A 2ZR4A 4TW6A 3RFWA 2RURA 2LKNA 2N87A 2KR7A 3PA7A 1QPFA 2XP7A 2DG4A 2ZQSA 2MPHA 1ROUA 2M8JA 1FKRA 2LAJA 5HUAA 3O5EA 2MLXA 1D7JA 5HT1A 2KE0A 4DRQA 3O5JA 4ODNA 5HKGA 4DRPA 1Q6IA 5I98A 4ODQA 2KXQA 3RGCA 5BXJA 3UQBA 4LAWA 2YSIA 2ZQUA 1P5QA 2KFWA 2ZR5A 4W9PA 4U86A 4ODLA 4DZ3A 1PINA 4IQCA 4J4OA 2ITKA 3KAIA 1U79A 2Q5AA 1NMWA 2DK1A 5B8IC 1Q6HA 3NRKA 3KAHA 2PBCA 4N19A 2VN1A 3KABA 4ODKA 2RUDA 1HXVA 1FKKA 3IHZA 3LUOA 1NSGA 4TYOA 2XP8A 4IQ2A 2RE3A 3M85A 1WR7A 2YSGA 1FJDA 4TW7A 1D7IA 5GPGA 1FAPA 2ZQTA 4DRMA 2ZR6A 2F4EA 1TK7A 4G50A 4MGVA 4ODPA 1FKTA 2XP9A 3GPKA 2IF4A 3KACA 3OOBA 3TCZA 1FKJA 3CNGA 3PRDA 2JMFA 2JX8A 1ZK6A 4ODRA 4QT3A 3O5FA 3TDBA 5HW7A 3LE4A 3O5LA 3IKDA 2JV4A 3FAPA 3KZ7A 4G2PA 3ODKA 3JYMA 3KADA 4ITZA 4W9OA 1WMVA 2Y78A 1EG3A 2RUQA 4DRHA 3TC5A 2KGJA 1R9HA 1D6OA 5D75A 2MDIA 3O5PA 1QZ2A 3KCEA 5CQ2A 1FKSA 4DRNA 2ZQVA 3O5MA 3WH0A 4FAPA 3PRBA 3L4HA 1BKFA 1BL4A 1J6YA 1EYMA 3O5RA 5AHTA 1Y0OA 2M2AA 2PPNA 4LAYA 2JXWA 3NTPA 2PPOA 5HWBA 3EY6A 2DG9A 1FKHA 3O5DA 1K9QA 1I5HW 4DRJA 1N1AA 1FKFA 4J4NA 2RUCA 4JFMA 1W26A 4MSPA 1A7XA 4DROA 2LJ4A 2F2DA 3IK8A 1KT0A 3JYJA 4U84A 4DT4A 3O5QA
chains in the Genus database with same CATH superfamily
1EG4A 2L2SA 4WKHA 3O5KA 5DIVA 2XP4A 1LL4A 4IT4A 3ARTA 2UZ5A 2EULA 4E5RA 4TX0A 1ZL1A 5HTGA 1FKIA 3M7NA 3JXVA 2FKEA 4MNKA 1LG2A 2KI3A 3H9RB 4C02B 4FN2A 4HBOA 4JFKA 4QIBA 3LKXB 1J4RA 2B5UB 3WQWA 2PPPA 2L4JA 3O5IA 1UR8A 5HW6A 1K9TA 1O6WA 1RP5A 2PN0A 2MF9A 1T11A 2VCDA 3AQUA 4Q7NA 1JNEA 4QZVB 1FKDA 4DWSD 4WKFA 3BXWA 1WB0A 2DK7A 1ROTA 1NMVA 1D7HA 1FKLA 3O5OA 1SYTA 2LGOA 2YBUA 2XP6A 2DSUA 1UR9A 1FKBA 1JNDA 1L1PA 4DRKA 3UI5A 1NWTA 3I6CA 1NWUA 3MQHA 2IUZA 3UQIA 4A0UA 4W9QA 2F21A 1E6ZA 1B6CA 2FAPA 2O9OA 4GIVA 4L72B 1HJWA 4TW8A 3OA5A 1ZCNA 1M5YA 2DSZA 1W9VA 2YSBA 2MNTA 2M08A 3NI6A 2XPBA 2E45A 1HJVA 5HW8A 3O5GA 4ML4A 3UI6A 1TCOC 3UF8A 2BA1A 1X6LA 1YATA 4REXA 4R0XA 3WQVA 1HKJA 1H0IA 3KAGA 4JFIA 3AS0A 3EIPA 2LPVA 4A0TA 1JMQA 4HBEA 1XHGA 2O92A 2M3OW 3B9EA 1FD9A 3AS3A 3CGNA 5HBFA 2YSHA 2DT3A 2JZVA 2WLZA 2M1IA 3CHDA 2RSEA 3UI4A 1E6NA 2KO7A 2YSFA 3ARSA 1J4IA 5HWCA 1WNOA 4MPKA 4DIPA 3ARVA 4DRIA 4LAVA 4IPXA 1WAWA 1KT1A 2ZAJA 1C9HA 3BMBA 1F8AB 1JCHB 3ALFA 2G41A 1D2KA 2QF8A 2PV3A 1OWQA 4ODOA 4U85A 1LL7A 5JH8A 3AS1A 3LKXA 1F40A 4MNMA 1EQ3A 1JNTA 2A3AA 3IKGA 5DF0A 2OFNA 2RQSA 3ARZA 1QPLA 4JFLA 1E6RA 1LL6A 1HKKA 4P8WA 2AWGA 4GGQA 2WM0A 1EDQA 2XPAA 3MDYB 4KQZA 3RM8A 3PQHA 5DITA 5DEZA 4Z2GA 4BF8A 2MLZA 1YW5A 3VAWA 4LAXA 2AOSA 2Y8NB 3ARUA 3WKZA 4TNSA 2F23A 1W9UA 1JVWA 4DZ2A 3FS8A 5E66A 4O2TA 1FKGA 5E62A 3MQGA 4JFJA 3KAFA 1SR0A 1ZB5A 3B8SA 4DWSB 4LGXA 2P4VA 1LJYA 5U47A 1LQ0A 2XP5A 1HJXA 2G8ZA 2PV1A 3B7XA 2DMVA 1GUVA 2A3CA 3CGMA 4JYSA 1K9RA 5E64A 2DG3A 3B9DA 4WJXA 1W1PA 2PV2A 2XP3A 2D9FA 4W5UA 4Z2HA 2A3EA 2MLYA 1J4HA 4NNRA 2DT2A 4Z2IA 4R5EA 5J6EA 3CHCA 4ODMA 3UQAA 2B31A 2M8IA 2DSWA 1H0GA 2DJYA 2K8IA 1JNSA 1PBKA 4HARA 4MNJA 1Q1CA 1Q6UA 3WIJA 2EZ5W 5DIUA 4GLXA 2DWVA 1W9PA 4MAVA 3B9AA 4DH0A 2QRVA 4QT2A 2ZR4A 4TW6A 3RFWA 4P8UA 4PTMA 4Z2LA 2RURA 1X6NA 2LKNA 2N87A 4UDMA 2KR7A 3PA7A 1QPFA 2XP7A 4NSBA 2DG4A 2ZQSA 2MPHA 1ROUA 3RM4A 2M8JA 1FKRA 2LAJA 5HUAA 3O5EA 3QOKA 2MLXA 1D7JA 5HT1A 1ITXA 2KE0A 4DRQA 2OWOA 1ZBKA 3WD3A 3O5JA 4ZS6A 4DWSC 4ODNA 2YAJB 1W1TA 5DO2A 5HKGA 4DRPA 2A3BA 1HKIA 1Q6IA 1LG1A 5I98A 4ODQA 2KXQA 3RGCA 3ARQA 1GOIA 1OGGA 3AROA 3FXYA 3MCBB 5BXJA 3UQBA 4LAWA 2WADA 4DWSA 1ZU8A 5GPRA 2YSIA 2ZQUA 1GRJA 1P5QA 2KFWA 1NH6A 4URIA 1OGBA 2ZR5A 5GQBA 4W9PA 4U86A 1NWSA 4Q22A 3WL0A 1FLCA 4ODLA 4XAKA 3ARPA 4DZ3A 1PINA 1HKMA 4P8XA 4IQCA 4J4OA 4WK9A 2ITKA 1W1VA 2WK2A 3KAIA 1U79A 4KR0B 1VF8A 2Q5AA 1NMWA 4Z2JA 3CZ8A 3ARXA 1FFQA 2DK1A 5B8IC 1Q6HA 2ETNA 4ZPTR 3NRKA 3PR9A 5E65A 3FSCA 1RD6A 3G6LA 3KAHA 4S3JA 3GU0A 2PBCA 3G6MA 4N19A 4ZPWR 3AS2A 1GPFA 2VN1A 3KABA 4ODKA 2RUDA 1KFWA 1HXVA 1FKKA 2DT0A 3IHZA 3LUOA 3WD0A 1NSGA 1XRVA 3WL1A 4TYOA 2XP8A 2DT1A 3W4RA 1EIBA 4IQ2A 1NWRA 2RE3A 3M85A 1WR7A 2YSGA 1FJDA 3GTYX 3FSBA 1D7IA 4TW7A 3WD4A 5GPGA 1FAPA 2ZQTA 4WIWA 4DRMA 2ZR6A 2OLHA 2F4EA 1TK7A 4G50A 4MGVA 4ODPA 1FKTA 4MNLA 2XP9A 3GPKA 3MCBA 2IF4A 3FY1A 1O6IA 3KACA 3OOBA 1ZBCA 3TCZA 4WKAA 1FKJA 3CNGA 3PRDA 2JMFA 2JX8A 1ZK6A 4ODRA 4S3KA 4QT3A 3CHEA 1E9LA 3O5FA 3TDBA 5HW7A 2ESCA 4NZCA 3LE4A 3O5LA 3IKDA 1E44A 3ARYA 2JV4A 3FAPA 1CTNA 3KZ7A 4G2PA 3ODKA 3JYMA 3KADA 4ITZA 4W9OA 2PI6A 1WMVA 3PRAA 2Y78A 1E6PA 1EG3A 4ZPVR 2RUQA 1W1YA 4DRHA 1TFVA 3TC5A 2KGJA 1R9HA 1D6OA 2WAEA 5D75A 2MDIA 1EHNA 3O5PA 1FFRA 1QZ2A 3KCEA 5CQ2A 1FKSA 4DRNA 2ZQVA 3O5MA 3WH0A 4FAPA 3PRBA 3RM9A 3WD2A 3RMEA 3L4HA 1BKFA 1BL4A 1J6YA 1EYMA 3O5RA 5AHTA 1Y0OA 2M2AA 2FDMA 2PPNA 2YBTA 4LAYA 1E15A 2JXWA 2WLYA 4IT6A 3NTPA 4L3NA 2DSVA 2PPOA 5HWBA 3EY6A 5E5WA 1IX5A 1ZBVA 3WD1A 1ZBWA 2DG9A 1FKHA 3ALGA 1K9QA 1I5HW 3O5DA 4DRJA 1N1AA 1FKFA 4J4NA 2RUCA 2DPEA 3CH9A 3CHFA 4Z2KA 1TR8A 4MTVA 4JFMA 1W26A 4MSPA 1A7XA 4DROA 3ARWA 4P8VA 3ARRA 2LJ4A 2F2DA 3IK8A 1KT0A 3JYJA 4U84A 4DT4A 4AY1A 3O5QA
chains in the Genus database with same CATH topology
1EG4A 2L2SA 4WKHA 3O5KA 5DIVA 2XP4A 1LL4A 4IT4A 3ARTA 2UZ5A 4E5RA 4TX0A 1ZL1A 5HTGA 1FKIA 3M7NA 3JXVA 2FKEA 4MNKA 1LG2A 2KI3A 3H9RB 4C02B 4FN2A 4HBOA 4JFKA 4QIBA 3LKXB 1J4RA 3WQWA 2PPPA 2L4JA 3O5IA 1UR8A 5HW6A 1K9TA 1O6WA 1RP5A 2MF9A 1T11A 2VCDA 3AQUA 4Q7NA 1JNEA 4QZVB 1FKDA 4DWSD 4WKFA 3BXWA 1WB0A 2DK7A 1ROTA 1NMVA 1D7HA 1FKLA 3O5OA 1SYTA 2LGOA 2YBUA 2XP6A 2DSUA 1UR9A 1FKBA 1JNDA 1L1PA 4DRKA 3UI5A 1NWTA 3I6CA 1NWUA 3MQHA 2IUZA 3UQIA 4A0UA 4W9QA 2F21A 1E6ZA 1B6CA 2FAPA 2O9OA 4GIVA 4L72B 1HJWA 4TW8A 3OA5A 1ZCNA 1M5YA 2DSZA 1W9VA 2YSBA 2MNTA 2M08A 3NI6A 2XPBA 2E45A 1HJVA 5HW8A 3O5GA 4ML4A 3UI6A 1TCOC 3UF8A 2BA1A 1X6LA 1YATA 4REXA 4R0XA 3WQVA 1HKJA 1H0IA 3KAGA 4JFIA 3AS0A 2LPVA 4A0TA 1JMQA 4HBEA 1XHGA 2O92A 2M3OW 3B9EA 1FD9A 3AS3A 3CGNA 5HBFA 2YSHA 2DT3A 2JZVA 2WLZA 2M1IA 3CHDA 2RSEA 3UI4A 1E6NA 2KO7A 2YSFA 3ARSA 1J4IA 5HWCA 1WNOA 4MPKA 4DIPA 3ARVA 4DRIA 4LAVA 4IPXA 1WAWA 1KT1A 2ZAJA 1C9HA 1F8AB 3ALFA 2G41A 1D2KA 2QF8A 2PV3A 1OWQA 4ODOA 4U85A 1LL7A 5JH8A 3AS1A 3LKXA 1F40A 4MNMA 1EQ3A 1JNTA 2A3AA 3IKGA 5DF0A 2OFNA 2RQSA 3ARZA 1QPLA 4JFLA 1E6RA 1LL6A 1HKKA 4P8WA 2AWGA 4GGQA 2WM0A 1EDQA 2XPAA 3MDYB 4KQZA 3RM8A 3PQHA 5DITA 5DEZA 4Z2GA 4BF8A 2MLZA 1YW5A 3VAWA 4LAXA 2AOSA 2Y8NB 3ARUA 3WKZA 4TNSA 1W9UA 1JVWA 4DZ2A 3FS8A 5E66A 4O2TA 1FKGA 5E62A 3MQGA 4JFJA 3KAFA 1SR0A 1ZB5A 3B8SA 4DWSB 4LGXA 1LJYA 5U47A 1LQ0A 2XP5A 1HJXA 2G8ZA 2PV1A 3B7XA 2DMVA 1GUVA 2A3CA 3CGMA 4JYSA 1K9RA 5E64A 2DG3A 3B9DA 4WJXA 1W1PA 2PV2A 2XP3A 2D9FA 4W5UA 4Z2HA 2A3EA 2MLYA 1J4HA 4NNRA 2DT2A 4Z2IA 4R5EA 5J6EA 3CHCA 4ODMA 3UQAA 2B31A 2M8IA 2DSWA 1H0GA 2DJYA 2K8IA 1JNSA 1PBKA 4HARA 4MNJA 1Q1CA 1Q6UA 3WIJA 2EZ5W 5DIUA 4GLXA 2DWVA 1W9PA 4MAVA 3B9AA 4DH0A 2QRVA 4QT2A 2ZR4A 4TW6A 3RFWA 4P8UA 4PTMA 4Z2LA 2RURA 1X6NA 2LKNA 2N87A 2KR7A 3PA7A 1QPFA 2XP7A 4NSBA 2DG4A 2ZQSA 2MPHA 1ROUA 3RM4A 2M8JA 1FKRA 2LAJA 5HUAA 3O5EA 3QOKA 2MLXA 1D7JA 5HT1A 1ITXA 2KE0A 4DRQA 2OWOA 1ZBKA 3WD3A 3O5JA 4ZS6A 4DWSC 4ODNA 2YAJB 1W1TA 5DO2A 5HKGA 4DRPA 2A3BA 1HKIA 1Q6IA 1LG1A 5I98A 4ODQA 2KXQA 3RGCA 3ARQA 1GOIA 1OGGA 3AROA 3FXYA 3MCBB 5BXJA 3UQBA 4LAWA 2WADA 4DWSA 1ZU8A 5GPRA 2YSIA 2ZQUA 1P5QA 2KFWA 1NH6A 4URIA 1OGBA 2ZR5A 5GQBA 4W9PA 4U86A 1NWSA 4Q22A 3WL0A 1FLCA 4ODLA 4XAKA 3ARPA 4DZ3A 1PINA 1HKMA 4P8XA 4IQCA 4J4OA 4WK9A 2ITKA 1W1VA 2WK2A 3KAIA 1U79A 4KR0B 1VF8A 2Q5AA 1NMWA 4Z2JA 3CZ8A 3ARXA 1FFQA 2DK1A 5B8IC 1Q6HA 4ZPTR 3NRKA 3PR9A 5E65A 3FSCA 1RD6A 3G6LA 3KAHA 4S3JA 2PBCA 3G6MA 4N19A 4ZPWR 3AS2A 1GPFA 2VN1A 3KABA 4ODKA 2RUDA 1KFWA 1HXVA 1FKKA 2DT0A 3IHZA 3LUOA 3WD0A 1NSGA 1XRVA 3WL1A 4TYOA 2XP8A 2DT1A 3W4RA 1EIBA 4IQ2A 1NWRA 2RE3A 3M85A 1WR7A 2YSGA 1FJDA 3FSBA 1D7IA 4TW7A 3WD4A 5GPGA 1FAPA 2ZQTA 4WIWA 4DRMA 2ZR6A 2OLHA 2F4EA 1TK7A 4G50A 4MGVA 4ODPA 1FKTA 4MNLA 2XP9A 3GPKA 3MCBA 2IF4A 3FY1A 1O6IA 3KACA 3OOBA 1ZBCA 3TCZA 4WKAA 1FKJA 3CNGA 3PRDA 2JMFA 2JX8A 1ZK6A 4ODRA 4S3KA 4QT3A 3CHEA 1E9LA 3O5FA 3TDBA 5HW7A 2ESCA 4NZCA 3LE4A 3O5LA 3IKDA 3ARYA 2JV4A 3FAPA 1CTNA 3KZ7A 4G2PA 3ODKA 3JYMA 3KADA 4ITZA 4W9OA 2PI6A 1WMVA 3PRAA 2Y78A 1E6PA 1EG3A 4ZPVR 2RUQA 1W1YA 4DRHA 1TFVA 3TC5A 2KGJA 1R9HA 1D6OA 2WAEA 5D75A 2MDIA 1EHNA 3O5PA 1FFRA 1QZ2A 3KCEA 5CQ2A 1FKSA 4DRNA 2ZQVA 3O5MA 3WH0A 4FAPA 3PRBA 3RM9A 3WD2A 3RMEA 3L4HA 1BKFA 1BL4A 1J6YA 1EYMA 3O5RA 5AHTA 1Y0OA 2M2AA 2FDMA 2PPNA 2YBTA 4LAYA 1E15A 2JXWA 2WLYA 4IT6A 3NTPA 4L3NA 2DSVA 2PPOA 5HWBA 3EY6A 5E5WA 1IX5A 1ZBVA 3WD1A 1ZBWA 2DG9A 1FKHA 3ALGA 1K9QA 1I5HW 3O5DA 4DRJA 1N1AA 1FKFA 4J4NA 2RUCA 2DPEA 3CH9A 3CHFA 4Z2KA 1TR8A 4MTVA 4JFMA 1W26A 4MSPA 1A7XA 4DROA 3ARWA 4P8VA 3ARRA 2LJ4A 2F2DA 3IK8A 1KT0A 3JYJA 4U84A 4DT4A 4AY1A 3O5QA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1EG4 A;  2L2S A;  3O5K A;  5DIV A;  2XP4 A;  2UZ5 A;  4E5R A;  4TX0 A;  5HTG A;  1FKI A;  3M7N A;  3JXV A;  2FKE A;  2KI3 A;  3H9R B;  4C02 B;  4FN2 A;  4JFK A;  4QIB A;  1J4R A;  2PPP A;  2L4J A;  3O5I A;  5HW6 A;  1O6W A;  2MF9 A;  1T11 A;  2VCD A;  1FKD A;  2DK7 A;  1ROT A;  1NMV A;  1D7H A;  1FKL A;  3O5O A;  2LGO A;  2XP6 A;  1FKB A;  1L1P A;  4DRK A;  3UI5 A;  3I6C A;  3UQI A;  4W9Q A;  2F21 A;  1B6C A;  2FAP A;  4GIV A;  4TW8 A;  1ZCN A;  1M5Y A;  2YSB A;  2MNT A;  2M08 A;  3NI6 A;  2XPB A;  2E45 A;  5HW8 A;  3O5G A;  3UI6 A;  1TCO C;  3UF8 A;  2BA1 A;  1YAT A;  4REX A;  4R0X A;  3KAG A;  4JFI A;  2LPV A;  1JMQ A;  2M3O W;  1FD9 A;  3CGN A;  2YSH A;  2JZV A;  2M1I A;  2RSE A;  3UI4 A;  2KO7 A;  2YSF A;  1J4I A;  5HWC A;  4DIP A;  4DRI A;  4LAV A;  4IPX A;  1KT1 A;  2ZAJ A;  1C9H A;  1F8A B;  2PV3 A;  4ODO A;  4U85 A;  1F40 A;  1EQ3 A;  1JNT A;  3IKG A;  2OFN A;  2RQS A;  1QPL A;  4JFL A;  2AWG A;  4GGQ A;  2XPA A;  3MDY B;  5DIT A;  4BF8 A;  2MLZ A;  1YW5 A;  3VAW A;  4LAX A;  4TNS A;  1JVW A;  4DZ2 A;  4O2T A;  1FKG A;  4JFJ A;  3KAF A;  2XP5 A;  2PV1 A;  3B7X A;  2DMV A;  3CGM A;  4JYS A;  1K9R A;  2DG3 A;  2PV2 A;  2XP3 A;  2D9F A;  2MLY A;  1J4H A;  4NNR A;  5J6E A;  4ODM A;  3UQA A;  2M8I A;  2DJY A;  2K8I A;  1JNS A;  1PBK A;  1Q1C A;  1Q6U A;  2EZ5 W;  5DIU A;  2DWV A;  4DH0 A;  4QT2 A;  2ZR4 A;  4TW6 A;  3RFW A;  2RUR A;  2LKN A;  2N87 A;  2KR7 A;  3PA7 A;  1QPF A;  2XP7 A;  2DG4 A;  2ZQS A;  2MPH A;  1ROU A;  2M8J A;  1FKR A;  2LAJ A;  5HUA A;  3O5E A;  2MLX A;  1D7J A;  5HT1 A;  2KE0 A;  4DRQ A;  3O5J A;  4ODN A;  5HKG A;  4DRP A;  1Q6I A;  5I98 A;  4ODQ A;  2KXQ A;  3RGC A;  5BXJ A;  3UQB A;  4LAW A;  2YSI A;  2ZQU A;  1P5Q A;  2KFW A;  2ZR5 A;  4W9P A;  4U86 A;  4ODL A;  4DZ3 A;  1PIN A;  4IQC A;  4J4O A;  2ITK A;  3KAI A;  1U79 A;  2Q5A A;  1NMW A;  2DK1 A;  5B8I C;  1Q6H A;  3NRK A;  3KAH A;  2PBC A;  4N19 A;  2VN1 A;  3KAB A;  4ODK A;  2RUD A;  1HXV A;  1FKK A;  3IHZ A;  3LUO A;  1NSG A;  4TYO A;  2XP8 A;  4IQ2 A;  2RE3 A;  3M85 A;  1WR7 A;  2YSG A;  1FJD A;  4TW7 A;  1D7I A;  5GPG A;  1FAP A;  2ZQT A;  4DRM A;  2ZR6 A;  2F4E A;  1TK7 A;  4G50 A;  4MGV A;  4ODP A;  1FKT A;  2XP9 A;  3GPK A;  2IF4 A;  3KAC A;  3OOB A;  3TCZ A;  1FKJ A;  3CNG A;  3PRD A;  2JMF A;  2JX8 A;  1ZK6 A;  4ODR A;  4QT3 A;  3O5F A;  3TDB A;  5HW7 A;  3LE4 A;  3O5L A;  3IKD A;  2JV4 A;  3FAP A;  3KZ7 A;  4G2P A;  3ODK A;  3JYM A;  3KAD A;  4ITZ A;  4W9O A;  1WMV A;  2Y78 A;  1EG3 A;  2RUQ A;  4DRH A;  3TC5 A;  2KGJ A;  1R9H A;  1D6O A;  5D75 A;  2MDI A;  3O5P A;  1QZ2 A;  3KCE A;  5CQ2 A;  1FKS A;  4DRN A;  2ZQV A;  3O5M A;  3WH0 A;  4FAP A;  3PRB A;  3L4H A;  1BKF A;  1BL4 A;  1J6Y A;  1EYM A;  3O5R A;  5AHT A;  1Y0O A;  2M2A A;  2PPN A;  4LAY A;  2JXW A;  3NTP A;  2PPO A;  5HWB A;  3EY6 A;  2DG9 A;  1FKH A;  3O5D A;  1K9Q A;  1I5H W;  4DRJ A;  1N1A A;  1FKF A;  4J4N A;  2RUC A;  4JFM A;  1W26 A;  4MSP A;  1A7X A;  4DRO A;  2LJ4 A;  2F2D A;  3IK8 A;  1KT0 A;  3JYJ A;  4U84 A;  4DT4 A;  3O5Q A; 
#chains in the Genus database with same CATH topology
 1EG4 A;  2L2S A;  4WKH A;  3O5K A;  5DIV A;  2XP4 A;  1LL4 A;  4IT4 A;  3ART A;  2UZ5 A;  2EUL A;  4E5R A;  4TX0 A;  1ZL1 A;  5HTG A;  1FKI A;  3M7N A;  3JXV A;  2FKE A;  4MNK A;  1LG2 A;  2KI3 A;  3H9R B;  4C02 B;  4FN2 A;  4HBO A;  4JFK A;  4QIB A;  3LKX B;  1J4R A;  2B5U B;  3WQW A;  2PPP A;  2L4J A;  3O5I A;  1UR8 A;  5HW6 A;  1K9T A;  1O6W A;  1RP5 A;  2PN0 A;  2MF9 A;  1T11 A;  2VCD A;  3AQU A;  4Q7N A;  1JNE A;  4QZV B;  1FKD A;  4DWS D;  4WKF A;  3BXW A;  1WB0 A;  2DK7 A;  1ROT A;  1NMV A;  1D7H A;  1FKL A;  3O5O A;  1SYT A;  2LGO A;  2YBU A;  2XP6 A;  2DSU A;  1UR9 A;  1FKB A;  1JND A;  1L1P A;  4DRK A;  3UI5 A;  1NWT A;  3I6C A;  1NWU A;  3MQH A;  2IUZ A;  3UQI A;  4A0U A;  4W9Q A;  2F21 A;  1E6Z A;  1B6C A;  2FAP A;  2O9O A;  4GIV A;  4L72 B;  1HJW A;  4TW8 A;  3OA5 A;  1ZCN A;  1M5Y A;  2DSZ A;  1W9V A;  2YSB A;  2MNT A;  2M08 A;  3NI6 A;  2XPB A;  2E45 A;  1HJV A;  5HW8 A;  3O5G A;  4ML4 A;  3UI6 A;  1TCO C;  3UF8 A;  2BA1 A;  1X6L A;  1YAT A;  4REX A;  4R0X A;  3WQV A;  1HKJ A;  1H0I A;  3KAG A;  4JFI A;  3AS0 A;  3EIP A;  2LPV A;  4A0T A;  1JMQ A;  4HBE A;  1XHG A;  2O92 A;  2M3O W;  3B9E A;  1FD9 A;  3AS3 A;  3CGN A;  5HBF A;  2YSH A;  2DT3 A;  2JZV A;  2WLZ A;  2M1I A;  3CHD A;  2RSE A;  3UI4 A;  1E6N A;  2KO7 A;  2YSF A;  3ARS A;  1J4I A;  5HWC A;  1WNO A;  4MPK A;  4DIP A;  3ARV A;  4DRI A;  4LAV A;  4IPX A;  1WAW A;  1KT1 A;  2ZAJ A;  1C9H A;  3BMB A;  1F8A B;  1JCH B;  3ALF A;  2G41 A;  1D2K A;  2QF8 A;  2PV3 A;  1OWQ A;  4ODO A;  4U85 A;  1LL7 A;  5JH8 A;  3AS1 A;  3LKX A;  1F40 A;  4MNM A;  1EQ3 A;  1JNT A;  2A3A A;  3IKG A;  5DF0 A;  2OFN A;  2RQS A;  3ARZ A;  1QPL A;  4JFL A;  1E6R A;  1LL6 A;  1HKK A;  4P8W A;  2AWG A;  4GGQ A;  2WM0 A;  1EDQ A;  2XPA A;  3MDY B;  4KQZ A;  3RM8 A;  3PQH A;  5DIT A;  5DEZ A;  4Z2G A;  4BF8 A;  2MLZ A;  1YW5 A;  3VAW A;  4LAX A;  2AOS A;  2Y8N B;  3ARU A;  3WKZ A;  4TNS A;  2F23 A;  1W9U A;  1JVW A;  4DZ2 A;  3FS8 A;  5E66 A;  4O2T A;  1FKG A;  5E62 A;  3MQG A;  4JFJ A;  3KAF A;  1SR0 A;  1ZB5 A;  3B8S A;  4DWS B;  4LGX A;  2P4V A;  1LJY A;  5U47 A;  1LQ0 A;  2XP5 A;  1HJX A;  2G8Z A;  2PV1 A;  3B7X A;  2DMV A;  1GUV A;  2A3C A;  3CGM A;  4JYS A;  1K9R A;  5E64 A;  2DG3 A;  3B9D A;  4WJX A;  1W1P A;  2PV2 A;  2XP3 A;  2D9F A;  4W5U A;  4Z2H A;  2A3E A;  2MLY A;  1J4H A;  4NNR A;  2DT2 A;  4Z2I A;  4R5E A;  5J6E A;  3CHC A;  4ODM A;  3UQA A;  2B31 A;  2M8I A;  2DSW A;  1H0G A;  2DJY A;  2K8I A;  1JNS A;  1PBK A;  4HAR A;  4MNJ A;  1Q1C A;  1Q6U A;  3WIJ A;  2EZ5 W;  5DIU A;  4GLX A;  2DWV A;  1W9P A;  4MAV A;  3B9A A;  4DH0 A;  2QRV A;  4QT2 A;  2ZR4 A;  4TW6 A;  3RFW A;  4P8U A;  4PTM A;  4Z2L A;  2RUR A;  1X6N A;  2LKN A;  2N87 A;  4UDM A;  2KR7 A;  3PA7 A;  1QPF A;  2XP7 A;  4NSB A;  2DG4 A;  2ZQS A;  2MPH A;  1ROU A;  3RM4 A;  2M8J A;  1FKR A;  2LAJ A;  5HUA A;  3O5E A;  3QOK A;  2MLX A;  1D7J A;  5HT1 A;  1ITX A;  2KE0 A;  4DRQ A;  2OWO A;  1ZBK A;  3WD3 A;  3O5J A;  4ZS6 A;  4DWS C;  4ODN A;  2YAJ B;  1W1T A;  5DO2 A;  5HKG A;  4DRP A;  2A3B A;  1HKI A;  1Q6I A;  1LG1 A;  5I98 A;  4ODQ A;  2KXQ A;  3RGC A;  3ARQ A;  1GOI A;  1OGG A;  3ARO A;  3FXY A;  3MCB B;  5BXJ A;  3UQB A;  4LAW A;  2WAD A;  4DWS A;  1ZU8 A;  5GPR A;  2YSI A;  2ZQU A;  1GRJ A;  1P5Q A;  2KFW A;  1NH6 A;  4URI A;  1OGB A;  2ZR5 A;  5GQB A;  4W9P A;  4U86 A;  1NWS A;  4Q22 A;  3WL0 A;  1FLC A;  4ODL A;  4XAK A;  3ARP A;  4DZ3 A;  1PIN A;  1HKM A;  4P8X A;  4IQC A;  4J4O A;  4WK9 A;  2ITK A;  1W1V A;  2WK2 A;  3KAI A;  1U79 A;  4KR0 B;  1VF8 A;  2Q5A A;  1NMW A;  4Z2J A;  3CZ8 A;  3ARX A;  1FFQ A;  2DK1 A;  5B8I C;  1Q6H A;  2ETN A;  4ZPT R;  3NRK A;  3PR9 A;  5E65 A;  3FSC A;  1RD6 A;  3G6L A;  3KAH A;  4S3J A;  3GU0 A;  2PBC A;  3G6M A;  4N19 A;  4ZPW R;  3AS2 A;  1GPF A;  2VN1 A;  3KAB A;  4ODK A;  2RUD A;  1KFW A;  1HXV A;  1FKK A;  2DT0 A;  3IHZ A;  3LUO A;  3WD0 A;  1NSG A;  1XRV A;  3WL1 A;  4TYO A;  2XP8 A;  2DT1 A;  3W4R A;  1EIB A;  4IQ2 A;  1NWR A;  2RE3 A;  3M85 A;  1WR7 A;  2YSG A;  1FJD A;  3GTY X;  3FSB A;  1D7I A;  4TW7 A;  3WD4 A;  5GPG A;  1FAP A;  2ZQT A;  4WIW A;  4DRM A;  2ZR6 A;  2OLH A;  2F4E A;  1TK7 A;  4G50 A;  4MGV A;  4ODP A;  1FKT A;  4MNL A;  2XP9 A;  3GPK A;  3MCB A;  2IF4 A;  3FY1 A;  1O6I A;  3KAC A;  3OOB A;  1ZBC A;  3TCZ A;  4WKA A;  1FKJ A;  3CNG A;  3PRD A;  2JMF A;  2JX8 A;  1ZK6 A;  4ODR A;  4S3K A;  4QT3 A;  3CHE A;  1E9L A;  3O5F A;  3TDB A;  5HW7 A;  2ESC A;  4NZC A;  3LE4 A;  3O5L A;  3IKD A;  1E44 A;  3ARY A;  2JV4 A;  3FAP A;  1CTN A;  3KZ7 A;  4G2P A;  3ODK A;  3JYM A;  3KAD A;  4ITZ A;  4W9O A;  2PI6 A;  1WMV A;  3PRA A;  2Y78 A;  1E6P A;  1EG3 A;  4ZPV R;  2RUQ A;  1W1Y A;  4DRH A;  1TFV A;  3TC5 A;  2KGJ A;  1R9H A;  1D6O A;  2WAE A;  5D75 A;  2MDI A;  1EHN A;  3O5P A;  1FFR A;  1QZ2 A;  3KCE A;  5CQ2 A;  1FKS A;  4DRN A;  2ZQV A;  3O5M A;  3WH0 A;  4FAP A;  3PRB A;  3RM9 A;  3WD2 A;  3RME A;  3L4H A;  1BKF A;  1BL4 A;  1J6Y A;  1EYM A;  3O5R A;  5AHT A;  1Y0O A;  2M2A A;  2FDM A;  2PPN A;  2YBT A;  4LAY A;  1E15 A;  2JXW A;  2WLY A;  4IT6 A;  3NTP A;  4L3N A;  2DSV A;  2PPO A;  5HWB A;  3EY6 A;  5E5W A;  1IX5 A;  1ZBV A;  3WD1 A;  1ZBW A;  2DG9 A;  1FKH A;  3ALG A;  1K9Q A;  1I5H W;  3O5D A;  4DRJ A;  1N1A A;  1FKF A;  4J4N A;  2RUC A;  2DPE A;  3CH9 A;  3CHF A;  4Z2K A;  1TR8 A;  4MTV A;  4JFM A;  1W26 A;  4MSP A;  1A7X A;  4DRO A;  3ARW A;  4P8V A;  3ARR A;  2LJ4 A;  2F2D A;  3IK8 A;  1KT0 A;  3JYJ A;  4U84 A;  4DT4 A;  4AY1 A;  3O5Q A; 
#chains in the Genus database with same CATH homology
 1EG4 A;  2L2S A;  4WKH A;  3O5K A;  5DIV A;  2XP4 A;  1LL4 A;  4IT4 A;  3ART A;  2UZ5 A;  4E5R A;  4TX0 A;  1ZL1 A;  5HTG A;  1FKI A;  3M7N A;  3JXV A;  2FKE A;  4MNK A;  1LG2 A;  2KI3 A;  3H9R B;  4C02 B;  4FN2 A;  4HBO A;  4JFK A;  4QIB A;  3LKX B;  1J4R A;  3WQW A;  2PPP A;  2L4J A;  3O5I A;  1UR8 A;  5HW6 A;  1K9T A;  1O6W A;  1RP5 A;  2MF9 A;  1T11 A;  2VCD A;  3AQU A;  4Q7N A;  1JNE A;  4QZV B;  1FKD A;  4DWS D;  4WKF A;  3BXW A;  1WB0 A;  2DK7 A;  1ROT A;  1NMV A;  1D7H A;  1FKL A;  3O5O A;  1SYT A;  2LGO A;  2YBU A;  2XP6 A;  2DSU A;  1UR9 A;  1FKB A;  1JND A;  1L1P A;  4DRK A;  3UI5 A;  1NWT A;  3I6C A;  1NWU A;  3MQH A;  2IUZ A;  3UQI A;  4A0U A;  4W9Q A;  2F21 A;  1E6Z A;  1B6C A;  2FAP A;  2O9O A;  4GIV A;  4L72 B;  1HJW A;  4TW8 A;  3OA5 A;  1ZCN A;  1M5Y A;  2DSZ A;  1W9V A;  2YSB A;  2MNT A;  2M08 A;  3NI6 A;  2XPB A;  2E45 A;  1HJV A;  5HW8 A;  3O5G A;  4ML4 A;  3UI6 A;  1TCO C;  3UF8 A;  2BA1 A;  1X6L A;  1YAT A;  4REX A;  4R0X A;  3WQV A;  1HKJ A;  1H0I A;  3KAG A;  4JFI A;  3AS0 A;  2LPV A;  4A0T A;  1JMQ A;  4HBE A;  1XHG A;  2O92 A;  2M3O W;  3B9E A;  1FD9 A;  3AS3 A;  3CGN A;  5HBF A;  2YSH A;  2DT3 A;  2JZV A;  2WLZ A;  2M1I A;  3CHD A;  2RSE A;  3UI4 A;  1E6N A;  2KO7 A;  2YSF A;  3ARS A;  1J4I A;  5HWC A;  1WNO A;  4MPK A;  4DIP A;  3ARV A;  4DRI A;  4LAV A;  4IPX A;  1WAW A;  1KT1 A;  2ZAJ A;  1C9H A;  1F8A B;  3ALF A;  2G41 A;  1D2K A;  2QF8 A;  2PV3 A;  1OWQ A;  4ODO A;  4U85 A;  1LL7 A;  5JH8 A;  3AS1 A;  3LKX A;  1F40 A;  4MNM A;  1EQ3 A;  1JNT A;  2A3A A;  3IKG A;  5DF0 A;  2OFN A;  2RQS A;  3ARZ A;  1QPL A;  4JFL A;  1E6R A;  1LL6 A;  1HKK A;  4P8W A;  2AWG A;  4GGQ A;  2WM0 A;  1EDQ A;  2XPA A;  3MDY B;  4KQZ A;  3RM8 A;  3PQH A;  5DIT A;  5DEZ A;  4Z2G A;  4BF8 A;  2MLZ A;  1YW5 A;  3VAW A;  4LAX A;  2AOS A;  2Y8N B;  3ARU A;  3WKZ A;  4TNS A;  1W9U A;  1JVW A;  4DZ2 A;  3FS8 A;  5E66 A;  4O2T A;  1FKG A;  5E62 A;  3MQG A;  4JFJ A;  3KAF A;  1SR0 A;  1ZB5 A;  3B8S A;  4DWS B;  4LGX A;  1LJY A;  5U47 A;  1LQ0 A;  2XP5 A;  1HJX A;  2G8Z A;  2PV1 A;  3B7X A;  2DMV A;  1GUV A;  2A3C A;  3CGM A;  4JYS A;  1K9R A;  5E64 A;  2DG3 A;  3B9D A;  4WJX A;  1W1P A;  2PV2 A;  2XP3 A;  2D9F A;  4W5U A;  4Z2H A;  2A3E A;  2MLY A;  1J4H A;  4NNR A;  2DT2 A;  4Z2I A;  4R5E A;  5J6E A;  3CHC A;  4ODM A;  3UQA A;  2B31 A;  2M8I A;  2DSW A;  1H0G A;  2DJY A;  2K8I A;  1JNS A;  1PBK A;  4HAR A;  4MNJ A;  1Q1C A;  1Q6U A;  3WIJ A;  2EZ5 W;  5DIU A;  4GLX A;  2DWV A;  1W9P A;  4MAV A;  3B9A A;  4DH0 A;  2QRV A;  4QT2 A;  2ZR4 A;  4TW6 A;  3RFW A;  4P8U A;  4PTM A;  4Z2L A;  2RUR A;  1X6N A;  2LKN A;  2N87 A;  2KR7 A;  3PA7 A;  1QPF A;  2XP7 A;  4NSB A;  2DG4 A;  2ZQS A;  2MPH A;  1ROU A;  3RM4 A;  2M8J A;  1FKR A;  2LAJ A;  5HUA A;  3O5E A;  3QOK A;  2MLX A;  1D7J A;  5HT1 A;  1ITX A;  2KE0 A;  4DRQ A;  2OWO A;  1ZBK A;  3WD3 A;  3O5J A;  4ZS6 A;  4DWS C;  4ODN A;  2YAJ B;  1W1T A;  5DO2 A;  5HKG A;  4DRP A;  2A3B A;  1HKI A;  1Q6I A;  1LG1 A;  5I98 A;  4ODQ A;  2KXQ A;  3RGC A;  3ARQ A;  1GOI A;  1OGG A;  3ARO A;  3FXY A;  3MCB B;  5BXJ A;  3UQB A;  4LAW A;  2WAD A;  4DWS A;  1ZU8 A;  5GPR A;  2YSI A;  2ZQU A;  1P5Q A;  2KFW A;  1NH6 A;  4URI A;  1OGB A;  2ZR5 A;  5GQB A;  4W9P A;  4U86 A;  1NWS A;  4Q22 A;  3WL0 A;  1FLC A;  4ODL A;  4XAK A;  3ARP A;  4DZ3 A;  1PIN A;  1HKM A;  4P8X A;  4IQC A;  4J4O A;  4WK9 A;  2ITK A;  1W1V A;  2WK2 A;  3KAI A;  1U79 A;  4KR0 B;  1VF8 A;  2Q5A A;  1NMW A;  4Z2J A;  3CZ8 A;  3ARX A;  1FFQ A;  2DK1 A;  5B8I C;  1Q6H A;  4ZPT R;  3NRK A;  3PR9 A;  5E65 A;  3FSC A;  1RD6 A;  3G6L A;  3KAH A;  4S3J A;  2PBC A;  3G6M A;  4N19 A;  4ZPW R;  3AS2 A;  1GPF A;  2VN1 A;  3KAB A;  4ODK A;  2RUD A;  1KFW A;  1HXV A;  1FKK A;  2DT0 A;  3IHZ A;  3LUO A;  3WD0 A;  1NSG A;  1XRV A;  3WL1 A;  4TYO A;  2XP8 A;  2DT1 A;  3W4R A;  1EIB A;  4IQ2 A;  1NWR A;  2RE3 A;  3M85 A;  1WR7 A;  2YSG A;  1FJD A;  3FSB A;  1D7I A;  4TW7 A;  3WD4 A;  5GPG A;  1FAP A;  2ZQT A;  4WIW A;  4DRM A;  2ZR6 A;  2OLH A;  2F4E A;  1TK7 A;  4G50 A;  4MGV A;  4ODP A;  1FKT A;  4MNL A;  2XP9 A;  3GPK A;  3MCB A;  2IF4 A;  3FY1 A;  1O6I A;  3KAC A;  3OOB A;  1ZBC A;  3TCZ A;  4WKA A;  1FKJ A;  3CNG A;  3PRD A;  2JMF A;  2JX8 A;  1ZK6 A;  4ODR A;  4S3K A;  4QT3 A;  3CHE A;  1E9L A;  3O5F A;  3TDB A;  5HW7 A;  2ESC A;  4NZC A;  3LE4 A;  3O5L A;  3IKD A;  3ARY A;  2JV4 A;  3FAP A;  1CTN A;  3KZ7 A;  4G2P A;  3ODK A;  3JYM A;  3KAD A;  4ITZ A;  4W9O A;  2PI6 A;  1WMV A;  3PRA A;  2Y78 A;  1E6P A;  1EG3 A;  4ZPV R;  2RUQ A;  1W1Y A;  4DRH A;  1TFV A;  3TC5 A;  2KGJ A;  1R9H A;  1D6O A;  2WAE A;  5D75 A;  2MDI A;  1EHN A;  3O5P A;  1FFR A;  1QZ2 A;  3KCE A;  5CQ2 A;  1FKS A;  4DRN A;  2ZQV A;  3O5M A;  3WH0 A;  4FAP A;  3PRB A;  3RM9 A;  3WD2 A;  3RME A;  3L4H A;  1BKF A;  1BL4 A;  1J6Y A;  1EYM A;  3O5R A;  5AHT A;  1Y0O A;  2M2A A;  2FDM A;  2PPN A;  2YBT A;  4LAY A;  1E15 A;  2JXW A;  2WLY A;  4IT6 A;  3NTP A;  4L3N A;  2DSV A;  2PPO A;  5HWB A;  3EY6 A;  5E5W A;  1IX5 A;  1ZBV A;  3WD1 A;  1ZBW A;  2DG9 A;  1FKH A;  3ALG A;  1K9Q A;  1I5H W;  3O5D A;  4DRJ A;  1N1A A;  1FKF A;  4J4N A;  2RUC A;  2DPE A;  3CH9 A;  3CHF A;  4Z2K A;  1TR8 A;  4MTV A;  4JFM A;  1W26 A;  4MSP A;  1A7X A;  4DRO A;  3ARW A;  4P8V A;  3ARR A;  2LJ4 A;  2F2D A;  3IK8 A;  1KT0 A;  3JYJ A;  4U84 A;  4DT4 A;  4AY1 A;  3O5Q A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...