2XP7A

Discovery of cell-active phenyl-imidazole pin1 inhibitors by structure-guided fragment evolution
Total Genus 45
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
45
sequence length
157
structure length
145
Chain Sequence
b'LPPGWEKAMSRSSGRVYYFNHITNASQWERPSEPARVRCSHLLVKHSQSRRPSSWRQEKITRTKEEALELINGYIQKIKSGEEDFESLASQFSDCSSAKARGDLGAFSRGQMQKPFEDASFALRTGEMSGPVFTDSGIHIILRTE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PEPTIDYL-PROLYL CIS-TRANS ISOMERASE NIMA-INTERACTING 1
publication title Discovery of Cell-Active Phenyl-Imidazole Pin1 Inhibitors by Structure-Guided Fragment Evolution.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Isomerase
total genus 45
structure length 145
sequence length 157
ec nomenclature ec 5.2.1.8: Peptidylprolyl isomerase.
pdb deposition date 2010-08-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00397 WW WW domain
A PF00639 Rotamase PPIC-type PPIASE domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.20.70.10 Mainly Beta Single Sheet Ubiquitin Ligase Nedd4; Chain: W; Ubiquitin Ligase Nedd4; Chain: W; 2xp7A01
3.10.50.40 Alpha Beta Roll Chitinase A; domain 3 Chitinase A; domain 3 2xp7A02
3L4HA 4DT4A 3UI5A 3NRKA 1D7IA 4U86A 5CQ2A 1BKFA 2PBCA 2JV4A 2ZQTA 2LJ4A 3LE4A 1FKIA 1FKGA 2PV1A 4U84A 2YSBA 4MSPA 3JYMA 1L1PA 4ODRA 3KZ7A 4QIBA 1K9RA 1FKBA 1JNSA 1ZCNA 4N19A 1J6YA 2XP6A 4IPXA 4TX0A 4O2TA 1ZK6A 2LKNA 2L2SA 2VN1A 1U79A 3CNGA 2DWVA 2EZ5W 3GPKA 1I5HW 1TCOC 1FKDA 1NMVA 1EG4A 5HWBA 1Q1CA 5HUAA 1Y0OA 3H9RB 4JFIA 3UQIA 4J4NA 3KADA 2RUDA 1O6WA 2UZ5A 5HW8A 2YSHA 4JFKA 1KT1A 1WR7A 3PRBA 5HTGA 3B7XA 4JFMA 2DG4A 3PRDA 3RGCA 4DROA 4E5RA 3UI4A 3M7NA 2XP3A 4TW8A 1QPFA 4LAVA 3PA7A 4TW6A 1NMWA 2KXQA 2Y78A 3UF8A 1R9HA 1FKSA 4BF8A 2ZQVA 2AWGA 4G2PA 2ITKA 2YSGA 2K8IA 3I6CA 2PPOA 1FAPA 2PV2A 2F2DA 1WMVA 3KABA 1J4RA 1J4IA 4TYOA 4LAYA 4DRHA 2DG9A 2Q5AA 4DIPA 3O5GA 3KAFA 2M3OW 1ROUA 4MGVA 3MDYB 2MLXA 2IF4A 4JYSA 2M8JA 3OOBA 1B6CA 2KGJA 4DRJA 4G50A 4JFJA 2RQSA 3IK8A 3O5QA 1QZ2A 2BA1A 3O5RA 1PINA 4DRQA 2MDIA 3O5LA 4ODQA 5I98A 1JNTA 3O5OA 3O5JA 2RUCA 1P5QA 2MNTA 3KAIA 5HT1A 5D75A 2N87A 3KACA 1W26A 1FKRA 3KCEA 5BXJA 2D9FA 2DJYA 5DIUA 2RSEA 3UQBA 5DITA 2MPHA 2XP5A 1FJDA 1Q6IA 2F4EA 4LAWA 3CGNA 1KT0A 2KR7A 2JX8A 4DRMA 4DZ2A 2M08A 3O5IA 2RUQA 1FKLA 1BL4A 4W9OA 4QT3A 2RE3A 1FKKA 2F21A 3TCZA 4DRNA 4J4OA 2XP7A 4GGQA 1EG3A 3UQAA 3O5MA 1A7XA 4FAPA 2L4JA 2JMFA 4DRPA 5J6EA 2PV3A 1FKTA 1EYMA 2KE0A 4ODPA 4R0XA 1YW5A 4DH0A 3NI6A 2MLZA 5DIVA 2PPPA 1D7JA 2VCDA 4DRKA 1PBKA 4ODKA 1J4HA 4FN2A 1M5YA 3IKDA 1N1AA 4REXA 2XPBA 2LGOA 2ZR5A 2DK7A 1Q6HA 5AHTA 2XPAA 1JMQA 4TW7A 3O5PA 3VAWA 1D7HA 3IHZA 4ITZA 5GPGA 2JXWA 1YATA 3EY6A 2M2AA 1FKFA 3FAPA 3O5DA 4ODOA 2ZR6A 5HWCA 3O5KA 3LUOA 1F8AB 1EQ3A 2XP8A 2XP4A 1K9QA 2LPVA 5HW6A 4DRIA 2PPNA 4JFLA 2KO7A 2OFNA 2DG3A 4ODLA 1C9HA 2JZVA 3KAHA 4NNRA 4C02B 2ZR4A 2ZAJA 3WH0A 4ODNA 3KAGA 2ZQSA 2ZQUA 2KFWA 1Q6UA 2M1IA 5HKGA 4U85A 2FKEA 4IQCA 2KI3A 3JXVA 4W9QA 4TNSA 2MLYA 4QT2A 4W9PA 3RFWA 5HW7A 4IQ2A 2LAJA 3ODKA 4ODMA 1ROTA 1JVWA 2M8IA 2DMVA 1TK7A 1T11A 1D6OA 2FAPA 5B8IC 3CGMA 2RURA 3IKGA 1QPLA 1FKHA 2XP9A 3M85A 1FKJA 3O5EA 1NSGA 2MF9A 3TDBA 3O5FA 1FD9A 2E45A 1F40A 2DK1A 4DZ3A 3NTPA 1HXVA 4GIVA 2YSFA 3TC5A 3UI6A 2YSIA 3JYJA 4LAXA
chains in the Genus database with same CATH superfamily
3L4HA 4L3NA 3W4RA 1UR9A 4DT4A 3UI5A 1W9VA 3NRKA 1D7IA 4U86A 5DEZA 5CQ2A 1BKFA 3FSCA 2PBCA 3WQWA 1K9TA 3LKXB 3G6LA 2JV4A 2ZQTA 2O9OA 1NH6A 2LJ4A 4LGXA 2ETNA 3ALFA 3WD1A 4NSBA 3LE4A 1FKIA 4WKFA 1FKGA 2PV1A 1E6PA 4U84A 1NWUA 2YSBA 4MSPA 2B31A 3JYMA 2WAEA 1L1PA 4ODRA 3KZ7A 3LKXA 4QIBA 1K9RA 1FKBA 2G8ZA 1ZCNA 1JNSA 4N19A 1J6YA 4DWSA 2XP6A 4IPXA 2A3BA 4TX0A 4O2TA 1ZK6A 2LKNA 1IX5A 2L2SA 2VN1A 4WJXA 3WD0A 1U79A 3WKZA 1RP5A 3CNGA 2DWVA 2EZ5W 3GTYX 3GPKA 1I5HW 1TCOC 1FKDA 1NMVA 1ZL1A 1FFRA 3WD2A 1EG4A 4R5EA 2A3CA 1H0GA 5HWBA 1Q1CA 5HUAA 1Y0OA 4P8WA 4IT6A 3H9RB 4JFIA 3UQIA 2IUZA 1HKMA 4J4NA 3KADA 4PTMA 2PI6A 2RUDA 1O6WA 1E44A 2UZ5A 5HW8A 2ESCA 2YSHA 4JFKA 1KT1A 1WR7A 3PRBA 3CZ8A 3RM9A 5HTGA 4WKAA 3ALGA 2PN0A 3B7XA 4JFMA 3ARRA 2DG4A 3PRDA 3RGCA 4DROA 4E5RA 3UI4A 3M7NA 1RD6A 2XP3A 1W1VA 4TW8A 1LJYA 1QPFA 4LAVA 5E5WA 3PA7A 3WL0A 4TW6A 1NMWA 4A0TA 2WK2A 2KXQA 3ARXA 2Y78A 3UF8A 1R9HA 5U47A 1FKSA 4KR0B 4HARA 3CH9A 4BF8A 2ZQVA 2AWGA 4G2PA 2ITKA 2WADA 2YSGA 2K8IA 3I6CA 1EDQA 1X6LA 2PPOA 3CHDA 1JNDA 1W9PA 1XRVA 1GUVA 5GPRA 1FAPA 2PV2A 2F2DA 1WMVA 3RM8A 3KABA 1JCHB 4P8XA 2YAJB 1LQ0A 4P8UA 1J4RA 1J4IA 2QRVA 3ARTA 1H0IA 4TYOA 4LAYA 4DRHA 1HKIA 2DG9A 2DSVA 4KQZA 2QF8A 3B9DA 2Q5AA 4HBEA 4DIPA 3O5GA 3KAFA 3ARQA 3ARZA 2M3OW 4P8VA 1ROUA 1E6ZA 4MGVA 3FS8A 3MDYB 2MLXA 1ZBWA 2IF4A 1W1YA 2DT3A 4JYSA 3WD4A 1EHNA 2M8JA 3OOBA 3EIPA 1B6CA 2KGJA 3ARYA 4DRJA 4XAKA 4G50A 4JFJA 2RQSA 2Y8NB 1ZBKA 3IK8A 3O5QA 3ARUA 4ZPWR 4Z2KA 1QZ2A 2BA1A 1W9UA 3O5RA 5GQBA 1PINA 4S3JA 5JH8A 4GLXA 4DRQA 1HKJA 2MDIA 2DT1A 3FSBA 3O5LA 4ODQA 3PRAA 5I98A 3B9EA 1JNTA 3O5OA 3O5JA 1TFVA 2F23A 4MNJA 1ITXA 3OA5A 1ZU8A 3WIJA 4Q22A 1OGGA 1JNEA 2DPEA 2FDMA 1UR8A 3MQHA 1P5QA 2RUCA 2MNTA 2DT0A 5E65A 1E6NA 3KAIA 5HT1A 3BXWA 4WIWA 4URIA 5D75A 1ZBVA 3RM4A 2N87A 3KACA 1FLCA 1W26A 1FKRA 3KCEA 1GOIA 3ARSA 4Z2LA 5BXJA 2D9FA 1LL6A 4MPKA 2DJYA 5DIUA 2RSEA 3UQBA 5DITA 2MPHA 2XP5A 1FJDA 5E64A 1Q6IA 2F4EA 2WM0A 4LAWA 3B8SA 3CGNA 1KT0A 1LG1A 2KR7A 4DWSC 2JX8A 4DRMA 4MAVA 4DZ2A 2M08A 3AS1A 3O5IA 2RUQA 1FKLA 1BL4A 1KFWA 2EULA 4W9OA 4W5UA 4QT3A 4S3KA 2RE3A 1FKKA 1ZB5A 2F21A 3TCZA 3MQGA 4DRNA 3CHFA 4J4OA 4NZCA 1LL7A 2XP7A 1W1TA 3WL1A 4GGQA 1HKKA 1EG3A 3UQAA 3O5MA 1A7XA 4Z2JA 2O92A 4FAPA 2L4JA 1GRJA 2JMFA 2YBUA 1WB0A 2A3EA 4DRPA 4Z2GA 5J6EA 2PV3A 1FKTA 3FY1A 1EYMA 2KE0A 3ARWA 4ODPA 4R0XA 1ZBCA 4MNKA 4QZVB 1YW5A 4UDMA 3ARPA 5E62A 4Z2HA 2A3AA 4DH0A 3NI6A 1NWRA 1SR0A 2MLZA 2OWOA 5DIVA 2PPPA 1D7JA 2VCDA 4DRKA 3AROA 1PBKA 3GU0A 4ODKA 4WKHA 1J4HA 4FN2A 4MNMA 1M5YA 3IKDA 1N1AA 4REXA 1VF8A 4ZPVR 2XPBA 2B5UB 3FXYA 1TR8A 2LGOA 4DWSB 1HJWA 2ZR5A 2DK7A 1Q6HA 5AHTA 2DSUA 2XPAA 3G6MA 1JMQA 4TW7A 3PR9A 1CTNA 3O5PA 3AS0A 1O6IA 2WLYA 1W1PA 1D2KA 3VAWA 4A0UA 1D7HA 1E6RA 3WQVA 3IHZA 4Z2IA 3AS3A 4ITZA 3B9AA 3CHCA 4Q7NA 4ZS6A 5GPGA 3AQUA 1E9LA 2JXWA 1X6NA 1YATA 3EY6A 2M2AA 1FKFA 3FAPA 3O5DA 4ODOA 2ZR6A 5HWCA 4ML4A 3O5KA 4AY1A 3LUOA 1OWQA 4MNLA 1F8AB 1NWTA 1OGBA 4WK9A 2XP8A 1EQ3A 2XP4A 1K9QA 2LPVA 5HW6A 4DRIA 2PPNA 4JFLA 2KO7A 3CHEA 2OFNA 4IT4A 2DG3A 4ODLA 1NWSA 1C9HA 2OLHA 1HJVA 1XHGA 2JZVA 5DO2A 3KAHA 4NNRA 4C02B 2ZR4A 2ZAJA 3WH0A 4ODNA 2G41A 3KAGA 2AOSA 2ZQSA 1EIBA 1GPFA 2ZQUA 2KFWA 1HJXA 1Q6UA 1LG2A 2M1IA 3AS2A 2YBTA 5HKGA 3ARVA 3QOKA 4U85A 4ZPTR 2FKEA 4IQCA 2KI3A 3JXVA 5HBFA 4W9QA 4TNSA 1SYTA 2MLYA 3BMBA 2WLZA 1FFQA 4QT2A 4W9PA 3RMEA 3RFWA 5HW7A 4DWSD 4MTVA 4IQ2A 2LAJA 3ODKA 4ODMA 1ROTA 3WD3A 1JVWA 2M8IA 2DMVA 1TK7A 1T11A 1LL4A 1D6OA 2FAPA 5B8IC 3CGMA 2RURA 3IKGA 2P4VA 1QPLA 3MCBB 1FKHA 2XP9A 3M85A 1FKJA 2DT2A 3O5EA 1NSGA 2DSZA 2MF9A 2DSWA 3TDBA 3O5FA 1FD9A 4L72B 3PQHA 1E15A 2E45A 1F40A 2DK1A 4DZ3A 1WAWA 3NTPA 1HXVA 4GIVA 4HBOA 5DF0A 2YSFA 3MCBA 3TC5A 1WNOA 3UI6A 2YSIA 3JYJA 5E66A 4LAXA
chains in the Genus database with same CATH topology
3L4HA 4L3NA 3W4RA 1UR9A 4DT4A 3UI5A 1W9VA 3NRKA 1D7IA 4U86A 5DEZA 5CQ2A 1BKFA 3FSCA 2PBCA 3WQWA 1K9TA 3LKXB 3G6LA 2JV4A 2ZQTA 2O9OA 1NH6A 2LJ4A 4LGXA 3ALFA 3WD1A 4NSBA 3LE4A 1FKIA 4WKFA 1FKGA 2PV1A 1E6PA 4U84A 1NWUA 2YSBA 4MSPA 2B31A 3JYMA 2WAEA 1L1PA 4ODRA 3KZ7A 3LKXA 4QIBA 1K9RA 1FKBA 2G8ZA 1ZCNA 1JNSA 4N19A 1J6YA 4DWSA 2XP6A 4IPXA 2A3BA 4TX0A 4O2TA 1ZK6A 2LKNA 1IX5A 2L2SA 2VN1A 4WJXA 3WD0A 1U79A 3WKZA 1RP5A 3CNGA 2DWVA 2EZ5W 3GPKA 1I5HW 1TCOC 1FKDA 1NMVA 1ZL1A 1FFRA 3WD2A 1EG4A 4R5EA 2A3CA 1H0GA 5HWBA 1Q1CA 5HUAA 1Y0OA 4P8WA 4IT6A 3H9RB 4JFIA 3UQIA 2IUZA 1HKMA 4J4NA 3KADA 4PTMA 2PI6A 2RUDA 1O6WA 2UZ5A 5HW8A 2ESCA 2YSHA 4JFKA 1KT1A 1WR7A 3PRBA 3CZ8A 3RM9A 5HTGA 4WKAA 3ALGA 3B7XA 4JFMA 3ARRA 2DG4A 3PRDA 3RGCA 4DROA 4E5RA 3UI4A 3M7NA 1RD6A 2XP3A 1W1VA 4TW8A 1LJYA 1QPFA 4LAVA 5E5WA 3PA7A 3WL0A 4TW6A 1NMWA 4A0TA 2WK2A 2KXQA 3ARXA 2Y78A 3UF8A 1R9HA 5U47A 1FKSA 4KR0B 4HARA 3CH9A 4BF8A 2ZQVA 2AWGA 4G2PA 2ITKA 2WADA 2YSGA 2K8IA 3I6CA 1EDQA 1X6LA 2PPOA 3CHDA 1JNDA 1W9PA 1XRVA 1GUVA 5GPRA 1FAPA 2PV2A 2F2DA 1WMVA 3RM8A 3KABA 4P8XA 2YAJB 1LQ0A 4P8UA 1J4RA 1J4IA 2QRVA 3ARTA 1H0IA 4TYOA 4LAYA 4DRHA 1HKIA 2DG9A 2DSVA 4KQZA 2QF8A 3B9DA 2Q5AA 4HBEA 4DIPA 3O5GA 3KAFA 3ARQA 3ARZA 2M3OW 4P8VA 1ROUA 1E6ZA 4MGVA 3FS8A 3MDYB 2MLXA 1ZBWA 2IF4A 1W1YA 2DT3A 4JYSA 3WD4A 1EHNA 2M8JA 3OOBA 1B6CA 2KGJA 3ARYA 4DRJA 4XAKA 4G50A 4JFJA 2RQSA 2Y8NB 1ZBKA 3IK8A 3O5QA 3ARUA 4ZPWR 4Z2KA 1QZ2A 2BA1A 1W9UA 3O5RA 5GQBA 1PINA 4S3JA 5JH8A 4GLXA 4DRQA 1HKJA 2MDIA 2DT1A 3FSBA 3O5LA 4ODQA 3PRAA 5I98A 3B9EA 1JNTA 3O5OA 3O5JA 1TFVA 4MNJA 1ITXA 3OA5A 1ZU8A 3WIJA 4Q22A 1OGGA 1JNEA 2DPEA 2FDMA 1UR8A 3MQHA 1P5QA 2RUCA 2MNTA 2DT0A 5E65A 1E6NA 3KAIA 5HT1A 3BXWA 4WIWA 4URIA 5D75A 1ZBVA 3RM4A 2N87A 3KACA 1FLCA 1W26A 1FKRA 3KCEA 1GOIA 3ARSA 4Z2LA 5BXJA 2D9FA 1LL6A 4MPKA 2DJYA 5DIUA 2RSEA 3UQBA 5DITA 2MPHA 2XP5A 1FJDA 5E64A 1Q6IA 2F4EA 2WM0A 4LAWA 3B8SA 3CGNA 1KT0A 1LG1A 2KR7A 4DWSC 2JX8A 4DRMA 4MAVA 4DZ2A 2M08A 3AS1A 3O5IA 2RUQA 1FKLA 1BL4A 1KFWA 4W9OA 4W5UA 4QT3A 4S3KA 2RE3A 1FKKA 1ZB5A 2F21A 3TCZA 3MQGA 4DRNA 3CHFA 4J4OA 4NZCA 1LL7A 2XP7A 1W1TA 3WL1A 4GGQA 1HKKA 1EG3A 3UQAA 3O5MA 1A7XA 4Z2JA 2O92A 4FAPA 2L4JA 2JMFA 2YBUA 1WB0A 2A3EA 4DRPA 4Z2GA 5J6EA 2PV3A 1FKTA 3FY1A 1EYMA 2KE0A 3ARWA 4ODPA 4R0XA 1ZBCA 4MNKA 4QZVB 1YW5A 3ARPA 5E62A 4Z2HA 2A3AA 4DH0A 3NI6A 1NWRA 1SR0A 2MLZA 2OWOA 5DIVA 2PPPA 1D7JA 2VCDA 4DRKA 3AROA 1PBKA 4ODKA 4WKHA 1J4HA 4FN2A 4MNMA 1M5YA 3IKDA 1N1AA 4REXA 1VF8A 4ZPVR 2XPBA 3FXYA 1TR8A 2LGOA 4DWSB 1HJWA 2ZR5A 2DK7A 1Q6HA 5AHTA 2DSUA 2XPAA 3G6MA 1JMQA 4TW7A 3PR9A 1CTNA 3O5PA 3AS0A 1O6IA 2WLYA 1W1PA 1D2KA 3VAWA 4A0UA 1D7HA 1E6RA 3WQVA 3IHZA 4Z2IA 3AS3A 4ITZA 3B9AA 3CHCA 4Q7NA 4ZS6A 5GPGA 3AQUA 1E9LA 2JXWA 1X6NA 1YATA 3EY6A 2M2AA 1FKFA 3FAPA 3O5DA 4ODOA 2ZR6A 5HWCA 4ML4A 3O5KA 4AY1A 3LUOA 1OWQA 4MNLA 1F8AB 1NWTA 1OGBA 4WK9A 2XP8A 1EQ3A 2XP4A 1K9QA 2LPVA 5HW6A 4DRIA 2PPNA 4JFLA 2KO7A 3CHEA 2OFNA 4IT4A 2DG3A 4ODLA 1NWSA 1C9HA 2OLHA 1HJVA 1XHGA 2JZVA 5DO2A 3KAHA 4NNRA 4C02B 2ZR4A 2ZAJA 3WH0A 4ODNA 2G41A 3KAGA 2AOSA 2ZQSA 1EIBA 1GPFA 2ZQUA 2KFWA 1HJXA 1Q6UA 1LG2A 2M1IA 3AS2A 2YBTA 5HKGA 3ARVA 3QOKA 4U85A 4ZPTR 2FKEA 4IQCA 2KI3A 3JXVA 5HBFA 4W9QA 4TNSA 1SYTA 2MLYA 2WLZA 1FFQA 4QT2A 4W9PA 3RMEA 3RFWA 5HW7A 4DWSD 4MTVA 4IQ2A 2LAJA 3ODKA 4ODMA 1ROTA 3WD3A 1JVWA 2M8IA 2DMVA 1TK7A 1T11A 1LL4A 1D6OA 2FAPA 5B8IC 3CGMA 2RURA 3IKGA 1QPLA 3MCBB 1FKHA 2XP9A 3M85A 1FKJA 2DT2A 3O5EA 1NSGA 2DSZA 2MF9A 2DSWA 3TDBA 3O5FA 1FD9A 4L72B 3PQHA 1E15A 2E45A 1F40A 2DK1A 4DZ3A 1WAWA 3NTPA 1HXVA 4GIVA 4HBOA 5DF0A 2YSFA 3MCBA 3TC5A 1WNOA 3UI6A 2YSIA 3JYJA 5E66A 4LAXA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3L4H A;  4DT4 A;  3UI5 A;  3NRK A;  1D7I A;  4U86 A;  5CQ2 A;  1BKF A;  2PBC A;  2JV4 A;  2ZQT A;  2LJ4 A;  3LE4 A;  1FKI A;  1FKG A;  2PV1 A;  4U84 A;  2YSB A;  4MSP A;  3JYM A;  1L1P A;  4ODR A;  3KZ7 A;  4QIB A;  1K9R A;  1FKB A;  1JNS A;  1ZCN A;  4N19 A;  1J6Y A;  2XP6 A;  4IPX A;  4TX0 A;  4O2T A;  1ZK6 A;  2LKN A;  2L2S A;  2VN1 A;  1U79 A;  3CNG A;  2DWV A;  2EZ5 W;  3GPK A;  1I5H W;  1TCO C;  1FKD A;  1NMV A;  1EG4 A;  5HWB A;  1Q1C A;  5HUA A;  1Y0O A;  3H9R B;  4JFI A;  3UQI A;  4J4N A;  3KAD A;  2RUD A;  1O6W A;  2UZ5 A;  5HW8 A;  2YSH A;  4JFK A;  1KT1 A;  1WR7 A;  3PRB A;  5HTG A;  3B7X A;  4JFM A;  2DG4 A;  3PRD A;  3RGC A;  4DRO A;  4E5R A;  3UI4 A;  3M7N A;  2XP3 A;  4TW8 A;  1QPF A;  4LAV A;  3PA7 A;  4TW6 A;  1NMW A;  2KXQ A;  2Y78 A;  3UF8 A;  1R9H A;  1FKS A;  4BF8 A;  2ZQV A;  2AWG A;  4G2P A;  2ITK A;  2YSG A;  2K8I A;  3I6C A;  2PPO A;  1FAP A;  2PV2 A;  2F2D A;  1WMV A;  3KAB A;  1J4R A;  1J4I A;  4TYO A;  4LAY A;  4DRH A;  2DG9 A;  2Q5A A;  4DIP A;  3O5G A;  3KAF A;  2M3O W;  1ROU A;  4MGV A;  3MDY B;  2MLX A;  2IF4 A;  4JYS A;  2M8J A;  3OOB A;  1B6C A;  2KGJ A;  4DRJ A;  4G50 A;  4JFJ A;  2RQS A;  3IK8 A;  3O5Q A;  1QZ2 A;  2BA1 A;  3O5R A;  1PIN A;  4DRQ A;  2MDI A;  3O5L A;  4ODQ A;  5I98 A;  1JNT A;  3O5O A;  3O5J A;  2RUC A;  1P5Q A;  2MNT A;  3KAI A;  5HT1 A;  5D75 A;  2N87 A;  3KAC A;  1W26 A;  1FKR A;  3KCE A;  5BXJ A;  2D9F A;  2DJY A;  5DIU A;  2RSE A;  3UQB A;  5DIT A;  2MPH A;  2XP5 A;  1FJD A;  1Q6I A;  2F4E A;  4LAW A;  3CGN A;  1KT0 A;  2KR7 A;  2JX8 A;  4DRM A;  4DZ2 A;  2M08 A;  3O5I A;  2RUQ A;  1FKL A;  1BL4 A;  4W9O A;  4QT3 A;  2RE3 A;  1FKK A;  2F21 A;  3TCZ A;  4DRN A;  4J4O A;  2XP7 A;  4GGQ A;  1EG3 A;  3UQA A;  3O5M A;  1A7X A;  4FAP A;  2L4J A;  2JMF A;  4DRP A;  5J6E A;  2PV3 A;  1FKT A;  1EYM A;  2KE0 A;  4ODP A;  4R0X A;  1YW5 A;  4DH0 A;  3NI6 A;  2MLZ A;  5DIV A;  2PPP A;  1D7J A;  2VCD A;  4DRK A;  1PBK A;  4ODK A;  1J4H A;  4FN2 A;  1M5Y A;  3IKD A;  1N1A A;  4REX A;  2XPB A;  2LGO A;  2ZR5 A;  2DK7 A;  1Q6H A;  5AHT A;  2XPA A;  1JMQ A;  4TW7 A;  3O5P A;  3VAW A;  1D7H A;  3IHZ A;  4ITZ A;  5GPG A;  2JXW A;  1YAT A;  3EY6 A;  2M2A A;  1FKF A;  3FAP A;  3O5D A;  4ODO A;  2ZR6 A;  5HWC A;  3O5K A;  3LUO A;  1F8A B;  1EQ3 A;  2XP8 A;  2XP4 A;  1K9Q A;  2LPV A;  5HW6 A;  4DRI A;  2PPN A;  4JFL A;  2KO7 A;  2OFN A;  2DG3 A;  4ODL A;  1C9H A;  2JZV A;  3KAH A;  4NNR A;  4C02 B;  2ZR4 A;  2ZAJ A;  3WH0 A;  4ODN A;  3KAG A;  2ZQS A;  2ZQU A;  2KFW A;  1Q6U A;  2M1I A;  5HKG A;  4U85 A;  2FKE A;  4IQC A;  2KI3 A;  3JXV A;  4W9Q A;  4TNS A;  2MLY A;  4QT2 A;  4W9P A;  3RFW A;  5HW7 A;  4IQ2 A;  2LAJ A;  3ODK A;  4ODM A;  1ROT A;  1JVW A;  2M8I A;  2DMV A;  1TK7 A;  1T11 A;  1D6O A;  2FAP A;  5B8I C;  3CGM A;  2RUR A;  3IKG A;  1QPL A;  1FKH A;  2XP9 A;  3M85 A;  1FKJ A;  3O5E A;  1NSG A;  2MF9 A;  3TDB A;  3O5F A;  1FD9 A;  2E45 A;  1F40 A;  2DK1 A;  4DZ3 A;  3NTP A;  1HXV A;  4GIV A;  2YSF A;  3TC5 A;  3UI6 A;  2YSI A;  3JYJ A;  4LAX A; 
#chains in the Genus database with same CATH topology
 3L4H A;  4L3N A;  3W4R A;  1UR9 A;  4DT4 A;  3UI5 A;  1W9V A;  3NRK A;  1D7I A;  4U86 A;  5DEZ A;  5CQ2 A;  1BKF A;  3FSC A;  2PBC A;  3WQW A;  1K9T A;  3LKX B;  3G6L A;  2JV4 A;  2ZQT A;  2O9O A;  1NH6 A;  2LJ4 A;  4LGX A;  2ETN A;  3ALF A;  3WD1 A;  4NSB A;  3LE4 A;  1FKI A;  4WKF A;  1FKG A;  2PV1 A;  1E6P A;  4U84 A;  1NWU A;  2YSB A;  4MSP A;  2B31 A;  3JYM A;  2WAE A;  1L1P A;  4ODR A;  3KZ7 A;  3LKX A;  4QIB A;  1K9R A;  1FKB A;  2G8Z A;  1ZCN A;  1JNS A;  4N19 A;  1J6Y A;  4DWS A;  2XP6 A;  4IPX A;  2A3B A;  4TX0 A;  4O2T A;  1ZK6 A;  2LKN A;  1IX5 A;  2L2S A;  2VN1 A;  4WJX A;  3WD0 A;  1U79 A;  3WKZ A;  1RP5 A;  3CNG A;  2DWV A;  2EZ5 W;  3GTY X;  3GPK A;  1I5H W;  1TCO C;  1FKD A;  1NMV A;  1ZL1 A;  1FFR A;  3WD2 A;  1EG4 A;  4R5E A;  2A3C A;  1H0G A;  5HWB A;  1Q1C A;  5HUA A;  1Y0O A;  4P8W A;  4IT6 A;  3H9R B;  4JFI A;  3UQI A;  2IUZ A;  1HKM A;  4J4N A;  3KAD A;  4PTM A;  2PI6 A;  2RUD A;  1O6W A;  1E44 A;  2UZ5 A;  5HW8 A;  2ESC A;  2YSH A;  4JFK A;  1KT1 A;  1WR7 A;  3PRB A;  3CZ8 A;  3RM9 A;  5HTG A;  4WKA A;  3ALG A;  2PN0 A;  3B7X A;  4JFM A;  3ARR A;  2DG4 A;  3PRD A;  3RGC A;  4DRO A;  4E5R A;  3UI4 A;  3M7N A;  1RD6 A;  2XP3 A;  1W1V A;  4TW8 A;  1LJY A;  1QPF A;  4LAV A;  5E5W A;  3PA7 A;  3WL0 A;  4TW6 A;  1NMW A;  4A0T A;  2WK2 A;  2KXQ A;  3ARX A;  2Y78 A;  3UF8 A;  1R9H A;  5U47 A;  1FKS A;  4KR0 B;  4HAR A;  3CH9 A;  4BF8 A;  2ZQV A;  2AWG A;  4G2P A;  2ITK A;  2WAD A;  2YSG A;  2K8I A;  3I6C A;  1EDQ A;  1X6L A;  2PPO A;  3CHD A;  1JND A;  1W9P A;  1XRV A;  1GUV A;  5GPR A;  1FAP A;  2PV2 A;  2F2D A;  1WMV A;  3RM8 A;  3KAB A;  1JCH B;  4P8X A;  2YAJ B;  1LQ0 A;  4P8U A;  1J4R A;  1J4I A;  2QRV A;  3ART A;  1H0I A;  4TYO A;  4LAY A;  4DRH A;  1HKI A;  2DG9 A;  2DSV A;  4KQZ A;  2QF8 A;  3B9D A;  2Q5A A;  4HBE A;  4DIP A;  3O5G A;  3KAF A;  3ARQ A;  3ARZ A;  2M3O W;  4P8V A;  1ROU A;  1E6Z A;  4MGV A;  3FS8 A;  3MDY B;  2MLX A;  1ZBW A;  2IF4 A;  1W1Y A;  2DT3 A;  4JYS A;  3WD4 A;  1EHN A;  2M8J A;  3OOB A;  3EIP A;  1B6C A;  2KGJ A;  3ARY A;  4DRJ A;  4XAK A;  4G50 A;  4JFJ A;  2RQS A;  2Y8N B;  1ZBK A;  3IK8 A;  3O5Q A;  3ARU A;  4ZPW R;  4Z2K A;  1QZ2 A;  2BA1 A;  1W9U A;  3O5R A;  5GQB A;  1PIN A;  4S3J A;  5JH8 A;  4GLX A;  4DRQ A;  1HKJ A;  2MDI A;  2DT1 A;  3FSB A;  3O5L A;  4ODQ A;  3PRA A;  5I98 A;  3B9E A;  1JNT A;  3O5O A;  3O5J A;  1TFV A;  2F23 A;  4MNJ A;  1ITX A;  3OA5 A;  1ZU8 A;  3WIJ A;  4Q22 A;  1OGG A;  1JNE A;  2DPE A;  2FDM A;  1UR8 A;  3MQH A;  1P5Q A;  2RUC A;  2MNT A;  2DT0 A;  5E65 A;  1E6N A;  3KAI A;  5HT1 A;  3BXW A;  4WIW A;  4URI A;  5D75 A;  1ZBV A;  3RM4 A;  2N87 A;  3KAC A;  1FLC A;  1W26 A;  1FKR A;  3KCE A;  1GOI A;  3ARS A;  4Z2L A;  5BXJ A;  2D9F A;  1LL6 A;  4MPK A;  2DJY A;  5DIU A;  2RSE A;  3UQB A;  5DIT A;  2MPH A;  2XP5 A;  1FJD A;  5E64 A;  1Q6I A;  2F4E A;  2WM0 A;  4LAW A;  3B8S A;  3CGN A;  1KT0 A;  1LG1 A;  2KR7 A;  4DWS C;  2JX8 A;  4DRM A;  4MAV A;  4DZ2 A;  2M08 A;  3AS1 A;  3O5I A;  2RUQ A;  1FKL A;  1BL4 A;  1KFW A;  2EUL A;  4W9O A;  4W5U A;  4QT3 A;  4S3K A;  2RE3 A;  1FKK A;  1ZB5 A;  2F21 A;  3TCZ A;  3MQG A;  4DRN A;  3CHF A;  4J4O A;  4NZC A;  1LL7 A;  2XP7 A;  1W1T A;  3WL1 A;  4GGQ A;  1HKK A;  1EG3 A;  3UQA A;  3O5M A;  1A7X A;  4Z2J A;  2O92 A;  4FAP A;  2L4J A;  1GRJ A;  2JMF A;  2YBU A;  1WB0 A;  2A3E A;  4DRP A;  4Z2G A;  5J6E A;  2PV3 A;  1FKT A;  3FY1 A;  1EYM A;  2KE0 A;  3ARW A;  4ODP A;  4R0X A;  1ZBC A;  4MNK A;  4QZV B;  1YW5 A;  4UDM A;  3ARP A;  5E62 A;  4Z2H A;  2A3A A;  4DH0 A;  3NI6 A;  1NWR A;  1SR0 A;  2MLZ A;  2OWO A;  5DIV A;  2PPP A;  1D7J A;  2VCD A;  4DRK A;  3ARO A;  1PBK A;  3GU0 A;  4ODK A;  4WKH A;  1J4H A;  4FN2 A;  4MNM A;  1M5Y A;  3IKD A;  1N1A A;  4REX A;  1VF8 A;  4ZPV R;  2XPB A;  2B5U B;  3FXY A;  1TR8 A;  2LGO A;  4DWS B;  1HJW A;  2ZR5 A;  2DK7 A;  1Q6H A;  5AHT A;  2DSU A;  2XPA A;  3G6M A;  1JMQ A;  4TW7 A;  3PR9 A;  1CTN A;  3O5P A;  3AS0 A;  1O6I A;  2WLY A;  1W1P A;  1D2K A;  3VAW A;  4A0U A;  1D7H A;  1E6R A;  3WQV A;  3IHZ A;  4Z2I A;  3AS3 A;  4ITZ A;  3B9A A;  3CHC A;  4Q7N A;  4ZS6 A;  5GPG A;  3AQU A;  1E9L A;  2JXW A;  1X6N A;  1YAT A;  3EY6 A;  2M2A A;  1FKF A;  3FAP A;  3O5D A;  4ODO A;  2ZR6 A;  5HWC A;  4ML4 A;  3O5K A;  4AY1 A;  3LUO A;  1OWQ A;  4MNL A;  1F8A B;  1NWT A;  1OGB A;  4WK9 A;  2XP8 A;  1EQ3 A;  2XP4 A;  1K9Q A;  2LPV A;  5HW6 A;  4DRI A;  2PPN A;  4JFL A;  2KO7 A;  3CHE A;  2OFN A;  4IT4 A;  2DG3 A;  4ODL A;  1NWS A;  1C9H A;  2OLH A;  1HJV A;  1XHG A;  2JZV A;  5DO2 A;  3KAH A;  4NNR A;  4C02 B;  2ZR4 A;  2ZAJ A;  3WH0 A;  4ODN A;  2G41 A;  3KAG A;  2AOS A;  2ZQS A;  1EIB A;  1GPF A;  2ZQU A;  2KFW A;  1HJX A;  1Q6U A;  1LG2 A;  2M1I A;  3AS2 A;  2YBT A;  5HKG A;  3ARV A;  3QOK A;  4U85 A;  4ZPT R;  2FKE A;  4IQC A;  2KI3 A;  3JXV A;  5HBF A;  4W9Q A;  4TNS A;  1SYT A;  2MLY A;  3BMB A;  2WLZ A;  1FFQ A;  4QT2 A;  4W9P A;  3RME A;  3RFW A;  5HW7 A;  4DWS D;  4MTV A;  4IQ2 A;  2LAJ A;  3ODK A;  4ODM A;  1ROT A;  3WD3 A;  1JVW A;  2M8I A;  2DMV A;  1TK7 A;  1T11 A;  1LL4 A;  1D6O A;  2FAP A;  5B8I C;  3CGM A;  2RUR A;  3IKG A;  2P4V A;  1QPL A;  3MCB B;  1FKH A;  2XP9 A;  3M85 A;  1FKJ A;  2DT2 A;  3O5E A;  1NSG A;  2DSZ A;  2MF9 A;  2DSW A;  3TDB A;  3O5F A;  1FD9 A;  4L72 B;  3PQH A;  1E15 A;  2E45 A;  1F40 A;  2DK1 A;  4DZ3 A;  1WAW A;  3NTP A;  1HXV A;  4GIV A;  4HBO A;  5DF0 A;  2YSF A;  3MCB A;  3TC5 A;  1WNO A;  3UI6 A;  2YSI A;  3JYJ A;  5E66 A;  4LAX A; 
#chains in the Genus database with same CATH homology
 3L4H A;  4L3N A;  3W4R A;  1UR9 A;  4DT4 A;  3UI5 A;  1W9V A;  3NRK A;  1D7I A;  4U86 A;  5DEZ A;  5CQ2 A;  1BKF A;  3FSC A;  2PBC A;  3WQW A;  1K9T A;  3LKX B;  3G6L A;  2JV4 A;  2ZQT A;  2O9O A;  1NH6 A;  2LJ4 A;  4LGX A;  3ALF A;  3WD1 A;  4NSB A;  3LE4 A;  1FKI A;  4WKF A;  1FKG A;  2PV1 A;  1E6P A;  4U84 A;  1NWU A;  2YSB A;  4MSP A;  2B31 A;  3JYM A;  2WAE A;  1L1P A;  4ODR A;  3KZ7 A;  3LKX A;  4QIB A;  1K9R A;  1FKB A;  2G8Z A;  1ZCN A;  1JNS A;  4N19 A;  1J6Y A;  4DWS A;  2XP6 A;  4IPX A;  2A3B A;  4TX0 A;  4O2T A;  1ZK6 A;  2LKN A;  1IX5 A;  2L2S A;  2VN1 A;  4WJX A;  3WD0 A;  1U79 A;  3WKZ A;  1RP5 A;  3CNG A;  2DWV A;  2EZ5 W;  3GPK A;  1I5H W;  1TCO C;  1FKD A;  1NMV A;  1ZL1 A;  1FFR A;  3WD2 A;  1EG4 A;  4R5E A;  2A3C A;  1H0G A;  5HWB A;  1Q1C A;  5HUA A;  1Y0O A;  4P8W A;  4IT6 A;  3H9R B;  4JFI A;  3UQI A;  2IUZ A;  1HKM A;  4J4N A;  3KAD A;  4PTM A;  2PI6 A;  2RUD A;  1O6W A;  2UZ5 A;  5HW8 A;  2ESC A;  2YSH A;  4JFK A;  1KT1 A;  1WR7 A;  3PRB A;  3CZ8 A;  3RM9 A;  5HTG A;  4WKA A;  3ALG A;  3B7X A;  4JFM A;  3ARR A;  2DG4 A;  3PRD A;  3RGC A;  4DRO A;  4E5R A;  3UI4 A;  3M7N A;  1RD6 A;  2XP3 A;  1W1V A;  4TW8 A;  1LJY A;  1QPF A;  4LAV A;  5E5W A;  3PA7 A;  3WL0 A;  4TW6 A;  1NMW A;  4A0T A;  2WK2 A;  2KXQ A;  3ARX A;  2Y78 A;  3UF8 A;  1R9H A;  5U47 A;  1FKS A;  4KR0 B;  4HAR A;  3CH9 A;  4BF8 A;  2ZQV A;  2AWG A;  4G2P A;  2ITK A;  2WAD A;  2YSG A;  2K8I A;  3I6C A;  1EDQ A;  1X6L A;  2PPO A;  3CHD A;  1JND A;  1W9P A;  1XRV A;  1GUV A;  5GPR A;  1FAP A;  2PV2 A;  2F2D A;  1WMV A;  3RM8 A;  3KAB A;  4P8X A;  2YAJ B;  1LQ0 A;  4P8U A;  1J4R A;  1J4I A;  2QRV A;  3ART A;  1H0I A;  4TYO A;  4LAY A;  4DRH A;  1HKI A;  2DG9 A;  2DSV A;  4KQZ A;  2QF8 A;  3B9D A;  2Q5A A;  4HBE A;  4DIP A;  3O5G A;  3KAF A;  3ARQ A;  3ARZ A;  2M3O W;  4P8V A;  1ROU A;  1E6Z A;  4MGV A;  3FS8 A;  3MDY B;  2MLX A;  1ZBW A;  2IF4 A;  1W1Y A;  2DT3 A;  4JYS A;  3WD4 A;  1EHN A;  2M8J A;  3OOB A;  1B6C A;  2KGJ A;  3ARY A;  4DRJ A;  4XAK A;  4G50 A;  4JFJ A;  2RQS A;  2Y8N B;  1ZBK A;  3IK8 A;  3O5Q A;  3ARU A;  4ZPW R;  4Z2K A;  1QZ2 A;  2BA1 A;  1W9U A;  3O5R A;  5GQB A;  1PIN A;  4S3J A;  5JH8 A;  4GLX A;  4DRQ A;  1HKJ A;  2MDI A;  2DT1 A;  3FSB A;  3O5L A;  4ODQ A;  3PRA A;  5I98 A;  3B9E A;  1JNT A;  3O5O A;  3O5J A;  1TFV A;  4MNJ A;  1ITX A;  3OA5 A;  1ZU8 A;  3WIJ A;  4Q22 A;  1OGG A;  1JNE A;  2DPE A;  2FDM A;  1UR8 A;  3MQH A;  1P5Q A;  2RUC A;  2MNT A;  2DT0 A;  5E65 A;  1E6N A;  3KAI A;  5HT1 A;  3BXW A;  4WIW A;  4URI A;  5D75 A;  1ZBV A;  3RM4 A;  2N87 A;  3KAC A;  1FLC A;  1W26 A;  1FKR A;  3KCE A;  1GOI A;  3ARS A;  4Z2L A;  5BXJ A;  2D9F A;  1LL6 A;  4MPK A;  2DJY A;  5DIU A;  2RSE A;  3UQB A;  5DIT A;  2MPH A;  2XP5 A;  1FJD A;  5E64 A;  1Q6I A;  2F4E A;  2WM0 A;  4LAW A;  3B8S A;  3CGN A;  1KT0 A;  1LG1 A;  2KR7 A;  4DWS C;  2JX8 A;  4DRM A;  4MAV A;  4DZ2 A;  2M08 A;  3AS1 A;  3O5I A;  2RUQ A;  1FKL A;  1BL4 A;  1KFW A;  4W9O A;  4W5U A;  4QT3 A;  4S3K A;  2RE3 A;  1FKK A;  1ZB5 A;  2F21 A;  3TCZ A;  3MQG A;  4DRN A;  3CHF A;  4J4O A;  4NZC A;  1LL7 A;  2XP7 A;  1W1T A;  3WL1 A;  4GGQ A;  1HKK A;  1EG3 A;  3UQA A;  3O5M A;  1A7X A;  4Z2J A;  2O92 A;  4FAP A;  2L4J A;  2JMF A;  2YBU A;  1WB0 A;  2A3E A;  4DRP A;  4Z2G A;  5J6E A;  2PV3 A;  1FKT A;  3FY1 A;  1EYM A;  2KE0 A;  3ARW A;  4ODP A;  4R0X A;  1ZBC A;  4MNK A;  4QZV B;  1YW5 A;  3ARP A;  5E62 A;  4Z2H A;  2A3A A;  4DH0 A;  3NI6 A;  1NWR A;  1SR0 A;  2MLZ A;  2OWO A;  5DIV A;  2PPP A;  1D7J A;  2VCD A;  4DRK A;  3ARO A;  1PBK A;  4ODK A;  4WKH A;  1J4H A;  4FN2 A;  4MNM A;  1M5Y A;  3IKD A;  1N1A A;  4REX A;  1VF8 A;  4ZPV R;  2XPB A;  3FXY A;  1TR8 A;  2LGO A;  4DWS B;  1HJW A;  2ZR5 A;  2DK7 A;  1Q6H A;  5AHT A;  2DSU A;  2XPA A;  3G6M A;  1JMQ A;  4TW7 A;  3PR9 A;  1CTN A;  3O5P A;  3AS0 A;  1O6I A;  2WLY A;  1W1P A;  1D2K A;  3VAW A;  4A0U A;  1D7H A;  1E6R A;  3WQV A;  3IHZ A;  4Z2I A;  3AS3 A;  4ITZ A;  3B9A A;  3CHC A;  4Q7N A;  4ZS6 A;  5GPG A;  3AQU A;  1E9L A;  2JXW A;  1X6N A;  1YAT A;  3EY6 A;  2M2A A;  1FKF A;  3FAP A;  3O5D A;  4ODO A;  2ZR6 A;  5HWC A;  4ML4 A;  3O5K A;  4AY1 A;  3LUO A;  1OWQ A;  4MNL A;  1F8A B;  1NWT A;  1OGB A;  4WK9 A;  2XP8 A;  1EQ3 A;  2XP4 A;  1K9Q A;  2LPV A;  5HW6 A;  4DRI A;  2PPN A;  4JFL A;  2KO7 A;  3CHE A;  2OFN A;  4IT4 A;  2DG3 A;  4ODL A;  1NWS A;  1C9H A;  2OLH A;  1HJV A;  1XHG A;  2JZV A;  5DO2 A;  3KAH A;  4NNR A;  4C02 B;  2ZR4 A;  2ZAJ A;  3WH0 A;  4ODN A;  2G41 A;  3KAG A;  2AOS A;  2ZQS A;  1EIB A;  1GPF A;  2ZQU A;  2KFW A;  1HJX A;  1Q6U A;  1LG2 A;  2M1I A;  3AS2 A;  2YBT A;  5HKG A;  3ARV A;  3QOK A;  4U85 A;  4ZPT R;  2FKE A;  4IQC A;  2KI3 A;  3JXV A;  5HBF A;  4W9Q A;  4TNS A;  1SYT A;  2MLY A;  2WLZ A;  1FFQ A;  4QT2 A;  4W9P A;  3RME A;  3RFW A;  5HW7 A;  4DWS D;  4MTV A;  4IQ2 A;  2LAJ A;  3ODK A;  4ODM A;  1ROT A;  3WD3 A;  1JVW A;  2M8I A;  2DMV A;  1TK7 A;  1T11 A;  1LL4 A;  1D6O A;  2FAP A;  5B8I C;  3CGM A;  2RUR A;  3IKG A;  1QPL A;  3MCB B;  1FKH A;  2XP9 A;  3M85 A;  1FKJ A;  2DT2 A;  3O5E A;  1NSG A;  2DSZ A;  2MF9 A;  2DSW A;  3TDB A;  3O5F A;  1FD9 A;  4L72 B;  3PQH A;  1E15 A;  2E45 A;  1F40 A;  2DK1 A;  4DZ3 A;  1WAW A;  3NTP A;  1HXV A;  4GIV A;  4HBO A;  5DF0 A;  2YSF A;  3MCB A;  3TC5 A;  1WNO A;  3UI6 A;  2YSI A;  3JYJ A;  5E66 A;  4LAX A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...