2XP7A

Discovery of cell-active phenyl-imidazole pin1 inhibitors by structure-guided fragment evolution
Total Genus 45
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
45
sequence length
157
structure length
145
Chain Sequence
LPPGWEKAMSRSSGRVYYFNHITNASQWERPSEPARVRCSHLLVKHSQSRRPSSWRQEKITRTKEEALELINGYIQKIKSGEEDFESLASQFSDCSSAKARGDLGAFSRGQMQKPFEDASFALRTGEMSGPVFTDSGIHIILRTE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Discovery of Cell-Active Phenyl-Imidazole Pin1 Inhibitors by Structure-Guided Fragment Evolution.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Isomerase
molecule keywords PEPTIDYL-PROLYL CIS-TRANS ISOMERASE NIMA-INTERACTING 1
total genus 45
structure length 145
sequence length 157
ec nomenclature ec 5.2.1.8: Peptidylprolyl isomerase.
pdb deposition date 2010-08-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00397 WW WW domain
A PF00639 Rotamase PPIC-type PPIASE domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.20.70.10 Mainly Beta Single Sheet Ubiquitin Ligase Nedd4; Chain: W; Ubiquitin Ligase Nedd4; Chain: W; 2xp7A01
3.10.50.40 Alpha Beta Roll Chitinase A; domain 3 Chitinase A; domain 3 2xp7A02
3GPKA 2IF4A 3PRDA 2OFNA 3LUOA 4LAYA 2L2SA 4TW6A 2JXWA 1L1PA 4MSPA 1JVWA 4DT4A 4REXA 2RE3A 2ZR5A 1I5HW 3O5FA 2DK1A 4ODLA 1W26A 3KCEA 1FKIA 2VCDA 3O5LA 4JYSA 2M2AA 2RURA 2LJ4A 3O5GA 5HWCA 1EG3A 2JMFA 1FKFA 3UQBA 2MF9A 1NMVA 2DMVA 4FN2A 2L4JA 3VAWA 5J6EA 3O5KA 4LAVA 4DRMA 4TW7A 2LPVA 5HWBA 1HXVA 2KO7A 2KI3A 2ZQTA 1T11A 3O5MA 4MGVA 4DRQA 4IPXA 3UQIA 2XP3A 2KGJA 4DIPA 1J4IA 2PPNA 2RUCA 3IHZA 2FAPA 5HW6A 2JV4A 1QPFA 2RUQA 2ZR4A 1FKBA 1FKJA 2D9FA 1R9HA 2F4EA 2KFWA 2XPAA 3IKDA 2ZR6A 4O2TA 1C9HA 3O5RA 2M8IA 1FKTA 4QT3A 2KXQA 2DWVA 4DH0A 4N19A 1BL4A 3L4HA 3FAPA 2VN1A 1Y0OA 1NSGA 3NTPA 3O5IA 4ODPA 1QZ2A 1D7HA 2KE0A 2RQSA 4GIVA 4DRNA 5HUAA 1FKRA 3M7NA 5DITA 1ROTA 3UF8A 3KZ7A 2FKEA 4QIBA 4GGQA 2PV1A 4ITZA 3KAIA 2BA1A 2XP7A 3CNGA 4IQ2A 1FJDA 4ODQA 4DRHA 1KT0A 1FD9A 1D7JA 2MLXA 1B6CA 2Y78A 4W9QA 5HW7A 2DG3A 1N1AA 1D6OA 1TCOC 2M08A 1O6WA 2N87A 3JXVA 3O5PA 1F40A 2MPHA 4ODKA 2ITKA 3O5QA 4TNSA 4DROA 4FAPA 2RSEA 1NMWA 3EY6A 1FKKA 3I6CA 4JFIA 1PINA 3M85A 1FKLA 3PA7A 5CQ2A 4E5RA 1FKDA 2LAJA 3O5JA 2XP5A 4G2PA 2AWGA 4DRKA 1K9RA 1YATA 2RUDA 3JYJA 3JYMA 2XP9A 2MLZA 4R0XA 2LGOA 4LAXA 2XP8A 3RFWA 2F2DA 2PV3A 2F21A 3OOBA 3PRBA 5D75A 2YSHA 1WR7A 3KABA 3KAFA 2PBCA 3O5OA 1PBKA 1F8AB 1EQ3A 4G50A 2DJYA 4JFKA 2M3OW 3B7XA 3UI6A 3IK8A 1ZCNA 2YSFA 1KT1A 3O5DA 1FKHA 2K8IA 4ODNA 2M8JA 3WH0A 1M5YA 4TW8A 1WMVA 3NI6A 3UQAA 4BF8A 3KAHA 5GPGA 4IQCA 5DIVA 1FAPA 4NNRA 4DRJA 2E45A 2PPPA 2ZQSA 4U84A 1D7IA 1Q6HA 4C02B 4DRIA 3KADA 4ODMA 3KAGA 3RGCA 5HT1A 5B8IC 2EZ5W 3NRKA 3UI4A 2YSGA 1J4HA 2LKNA 3CGNA 1TK7A 2Q5AA 4W9OA 2ZQVA 2XP4A 4ODOA 4TX0A 1A7XA 5BXJA 4J4OA 4W9PA 4JFLA 4DRPA 1K9QA 5HTGA 3IKGA 2MDIA 1J6YA 1EG4A 3TC5A 5AHTA 2M1IA 3TCZA 1P5QA 3MDYB 3O5EA 4U86A 1J4RA 3H9RB 5DIUA 4DZ3A 5HW8A 4TYOA 2JZVA 5HKGA 1YW5A 3TDBA 1EYMA 2DG9A 2PV2A 3CGMA 1BKFA 2MLYA 1JNTA 1ZK6A 4LAWA 3KACA 4J4NA 4DZ2A 1Q1CA 2KR7A 2JX8A 4JFJA 3UI5A 2PPOA 1JNSA 4ODRA 5I98A 2YSIA 4U85A 2ZQUA 1QPLA 4JFMA 1Q6UA 1JMQA 1FKGA 2MNTA 2DK7A 2XPBA 2YSBA 2ZAJA 3LE4A 1Q6IA 1U79A 1FKSA 2DG4A 3ODKA 4QT2A 1ROUA 2XP6A 2UZ5A
chains in the Genus database with same CATH superfamily
1CTNA 4DWSB 2DPEA 2B31A 1L1PA 4REXA 4WK9A 2ZR5A 1JNEA 4ODLA 5GPRA 1FKIA 3QOKA 2M2AA 2G41A 2LJ4A 3O5GA 5GQBA 2JMFA 1IX5A 3AS1A 4P8UA 3WKZA 1HXVA 4ML4A 2KO7A 3W4RA 4HBEA 3UQIA 3IHZA 2F4EA 4ODNA 2ESCA 4O2TA 3O5RA 2M8IA 4DH0A 2DWVA 2WM0A 3L4HA 1Y0OA 1NSGA 3NTPA 1LL7A 1NWRA 3ARRA 2RQSA 2DT3A 2DSZA 1ROTA 2FKEA 3B9EA 2BA1A 4ZPVR 3CHDA 2EULA 1GUVA 1LQ0A 4ZPWR 1D2KA 2WLYA 2MLXA 3RM8A 2O92A 1D6OA 2M08A 4NZCA 3WQWA 1GOIA 3O5PA 3FXYA 2QRVA 2MPHA 3WD3A 1NMWA 4JFIA 4P8VA 5CQ2A 4E5RA 3BMBA 2RUDA 2F2DA 4WKHA 4W5UA 4L72B 1OGBA 3KAFA 4A0UA 3ARWA 2G8ZA 3B7XA 1H0GA 3PR9A 2YSFA 2K8IA 3WH0A 1WMVA 1ZBVA 4BF8A 5GPGA 2O9OA 1FAPA 2E45A 2ZQSA 4U84A 3MQHA 4MPKA 4ODMA 4S3JA 2EZ5W 1J4HA 3FSBA 3PQHA 3CGNA 4Q7NA 1NWTA 5BXJA 4DRPA 5HTGA 2MDIA 3TC5A 4U86A 3AQUA 4GLXA 4P8WA 3ARYA 2DT0A 2JZVA 1EYMA 3UI4A 1BKFA 2MLYA 1ZK6A 2KR7A 1JNSA 3RM9A 2YSIA 2ZQUA 1WNOA 1Q6UA 5E5WA 2MNTA 1JMQA 1Q6IA 2DK7A 1HJVA 1NWSA 4R0XA 1JCHB 4C02B 2IF4A 2B5UB 4IT4A 4DT4A 1JVWA 2RE3A 2A3EA 1EDQA 5E65A 3B9DA 1WAWA 3ALFA 3UQBA 2L4JA 3FS8A 1LG1A 2ZQTA 4MGVA 3ARSA 3BXWA 2PPNA 1QPFA 3MCBA 1FKBA 1FKJA 2KFWA 3GTYX 1R9HA 3IKDA 4R5EA 1KFWA 1BL4A 3MQGA 4ODPA 1ITXA 3B9AA 4IT6A 3WIJA 3B8SA 1XRVA 5DITA 4AY1A 3UF8A 3KZ7A 2PV1A 4ITZA 3AS0A 3KAIA 3CHFA 1FJDA 1FD9A 1B6CA 4Z2GA 4W9QA 1N1AA 4ODKA 1XHGA 4ZS6A 4TNSA 3EIPA 4FAPA 2RSEA 3EY6A 1FKKA 1FKLA 3PA7A 1FKDA 2LAJA 4G2PA 2XP5A 2AWGA 1K9RA 1YATA 2DT2A 3ARPA 3CHEA 2MLZA 2LGOA 2DSUA 2F21A 2YBUA 3OOBA 5D75A 2YSHA 1WR7A 1WB0A 1JNDA 3IK8A 4TW8A 2M8JA 2PI6A 3NI6A 4A0TA 4IQCA 5DIVA 4ZPTR 1ROUA 1Q6HA 3RGCA 3WD0A 4MNKA 1TK7A 2YAJB 4TX0A 1A7XA 3RM4A 3IKGA 1EG4A 3TCZA 3MDYB 1J4RA 3H9RB 4WKAA 3AS2A 4TYOA 3G6LA 1YW5A 2PV2A 3WL1A 5HW8A 4P8XA 1E6NA 4JFJA 2JX8A 1ZU8A 4U85A 4Z2LA 4JFMA 2A3CA 1FKGA 3LE4A 2DG4A 3ODKA 2UZ5A 1HKMA 2OFNA 4URIA 4LAYA 2L2SA 4TW6A 4MSPA 2F23A 1I5HW 1FLCA 2DK1A 4HARA 3CHCA 1W26A 3KCEA 5E64A 2RURA 5HWCA 3G6MA 1W1PA 2MF9A 1NMVA 4FN2A 3VAWA 3O5KA 2P4VA 2DSWA 2LPVA 4TW7A 5HWBA 2ETNA 5DF0A 4DRQA 1GRJA 2KGJA 2WADA 1J4IA 1SYTA 2RUCA 3ARXA 2FAPA 4WIWA 2RUQA 5HW6A 2ZR4A 2ZR6A 4QT3A 1FKTA 2KXQA 4N19A 2VN1A 3LKXB 1QZ2A 1HJWA 3M7NA 1SR0A 3ARTA 2XP7A 3CNGA 4Z2KA 4Z2JA 4ODQA 1KT0A 4DWSA 1E6RA 2DG3A 1TCOC 1O6WA 3ARVA 4KR0B 5DEZA 4PTMA 3O5QA 1W1YA 1ZBKA 4DROA 4S3KA 1EIBA 4MTVA 5U47A 3I6CA 1PINA 3M85A 3ALGA 4LGXA 1H0IA 4HBOA 1E6ZA 3RMEA 1EHNA 4LAXA 1FFRA 2PV3A 3OA5A 3PRBA 3KABA 1PBKA 1EQ3A 4G50A 1E15A 1O6IA 4JFKA 2M3OW 2OLHA 3AROA 1KT1A 3O5DA 1FKHA 1M5YA 5JH8A 3UQAA 2Y8NB 4DRJA 4L3NA 1D7IA 1W1TA 1UR9A 2WK2A 1LJYA 3KAGA 1TFVA 2YSGA 2LKNA 3WL0A 4Z2IA 2Q5AA 4WJXA 1ZB5A 2ZQVA 2XP4A 1LG2A 1E9LA 4JFLA 1K9QA 4XAKA 2AOSA 3WD1A 3LKXA 1P5QA 3O5EA 5DIUA 1GPFA 3MCBB 5HKGA 3TDBA 4WKFA 3ARUA 1JNTA 1X6NA 4LAWA 4J4NA 1OWQA 4UDMA 3UI5A 4DWSD 1QPLA 3WD2A 2YSBA 2ZAJA 2D9FA 1FKSA 1TR8A 4QT2A 1RP5A 2XP6A 3GPKA 3PRDA 1HKKA 3LUOA 2JXWA 4NSBA 4MNLA 3WQVA 3O5FA 2QF8A 2IUZA 2VCDA 3O5LA 4JYSA 5E66A 2PN0A 1HKJA 2A3BA 1EG3A 1FKFA 2DMVA 2DSVA 4LAVA 2DT1A 4DRMA 4MAVA 2KI3A 1T11A 3O5MA 4IPXA 2XP3A 4DIPA 2JV4A 2XPAA 1C9HA 1VF8A 3O5IA 3FAPA 1NWUA 1W9PA 1ZBWA 1D7HA 2KE0A 4GIVA 5HUAA 4DRNA 1FKRA 2WAEA 3CH9A 4QIBA 4GGQA 1X6LA 1UR8A 3ARQA 1NH6A 1K9TA 4IQ2A 4Z2HA 1E6PA 1RD6A 1D7JA 2Y78A 5HW7A 5J6EA 3JXVA 2N87A 1F40A 2ITKA 1HJXA 1OGGA 3O5JA 4DRKA 2WLZA 3JYJA 3JYMA 2XP9A 3PRAA 3RFWA 2XP8A 5E62A 1ZL1A 2FDMA 5DO2A 2PBCA 3O5OA 1F8AB 1FFQA 1W9UA 2DJYA 4MNMA 3UI6A 4QZVB 1LL4A 1ZCNA 1LL6A 3KAHA 3ARZA 3CZ8A 4NNRA 4DRIA 3KADA 5HBFA 5HT1A 5B8IC 3NRKA 2A3AA 4KQZA 3GU0A 4W9OA 1W1VA 3AS3A 4ODOA 4J4OA 4W9PA 1J6YA 4DWSC 5AHTA 2M1IA 4DZ3A 1E44A 3FY1A 4DRHA 2DG9A 3CGMA 4DZ2A 3KACA 1Q1CA 3FSCA 1ZBCA 2PPOA 4ODRA 4MNJA 4Q22A 5I98A 2OWOA 1U79A 2YBTA 2XPBA 1HKIA 3WD4A 1W9VA 2PPPA
chains in the Genus database with same CATH topology
1CTNA 4DWSB 2DPEA 2B31A 1L1PA 4REXA 4WK9A 2ZR5A 1JNEA 4ODLA 5GPRA 1FKIA 3QOKA 2M2AA 2G41A 2LJ4A 3O5GA 5GQBA 2JMFA 1IX5A 3AS1A 4P8UA 3WKZA 1HXVA 4ML4A 2KO7A 3W4RA 4HBEA 3UQIA 3IHZA 2F4EA 4ODNA 2ESCA 4O2TA 3O5RA 2M8IA 4DH0A 2DWVA 2WM0A 3L4HA 1Y0OA 1NSGA 3NTPA 1LL7A 3ARRA 1NWRA 2RQSA 2DT3A 2DSZA 1ROTA 2FKEA 3B9EA 2BA1A 4ZPVR 3CHDA 1GUVA 1LQ0A 4ZPWR 1D2KA 2WLYA 2MLXA 3RM8A 2O92A 1D6OA 2M08A 4NZCA 3WQWA 1GOIA 3O5PA 3FXYA 2QRVA 2MPHA 3WD3A 1NMWA 4JFIA 4P8VA 5CQ2A 4E5RA 2RUDA 2F2DA 4WKHA 4W5UA 4L72B 1OGBA 3KAFA 4A0UA 3ARWA 2G8ZA 3B7XA 1H0GA 3PR9A 2YSFA 2K8IA 3WH0A 1WMVA 1ZBVA 4BF8A 5GPGA 2O9OA 1FAPA 2E45A 2ZQSA 4U84A 3MQHA 4MPKA 4ODMA 4S3JA 2EZ5W 1J4HA 3FSBA 3PQHA 3CGNA 4Q7NA 1NWTA 5BXJA 4DRPA 5HTGA 2MDIA 3TC5A 4U86A 3AQUA 4GLXA 4P8WA 3ARYA 2DT0A 2JZVA 1EYMA 3UI4A 1BKFA 2MLYA 1ZK6A 2KR7A 1JNSA 3RM9A 2YSIA 2ZQUA 1WNOA 1Q6UA 5E5WA 2MNTA 1JMQA 1Q6IA 2DK7A 1HJVA 1NWSA 4R0XA 4C02B 2IF4A 4IT4A 4DT4A 1JVWA 2RE3A 2A3EA 1EDQA 5E65A 3B9DA 1WAWA 3ALFA 3UQBA 2L4JA 3FS8A 1LG1A 2ZQTA 4MGVA 3ARSA 3BXWA 2PPNA 1QPFA 3MCBA 1FKBA 1FKJA 2KFWA 1R9HA 3IKDA 4R5EA 1KFWA 1BL4A 3MQGA 4ODPA 1ITXA 3B9AA 4IT6A 3WIJA 3B8SA 1XRVA 5DITA 4AY1A 3UF8A 3KZ7A 2PV1A 4ITZA 3AS0A 3KAIA 3CHFA 1FJDA 1FD9A 1B6CA 4Z2GA 4W9QA 1N1AA 4ODKA 1XHGA 4ZS6A 4TNSA 4FAPA 2RSEA 3EY6A 1FKKA 1FKLA 3PA7A 1FKDA 2LAJA 4G2PA 2XP5A 2AWGA 1K9RA 1YATA 2DT2A 3ARPA 3CHEA 2MLZA 2LGOA 2DSUA 2F21A 2YBUA 3OOBA 5D75A 2YSHA 1WR7A 1WB0A 1JNDA 3IK8A 4TW8A 2M8JA 2PI6A 3NI6A 4A0TA 4IQCA 5DIVA 4ZPTR 1ROUA 1Q6HA 3RGCA 3WD0A 4MNKA 1TK7A 2YAJB 4TX0A 1A7XA 3RM4A 3IKGA 1EG4A 3TCZA 3MDYB 1J4RA 3H9RB 4WKAA 3AS2A 4TYOA 3G6LA 1YW5A 2PV2A 3WL1A 5HW8A 4P8XA 1E6NA 4JFJA 2JX8A 1ZU8A 4U85A 4Z2LA 4JFMA 2A3CA 1FKGA 3LE4A 2DG4A 3ODKA 2UZ5A 1HKMA 2OFNA 4URIA 4LAYA 2L2SA 4TW6A 4MSPA 1I5HW 1FLCA 2DK1A 4HARA 3CHCA 1W26A 3KCEA 5E64A 2RURA 5HWCA 3G6MA 1W1PA 2MF9A 1NMVA 4FN2A 3VAWA 3O5KA 2DSWA 2LPVA 4TW7A 5HWBA 5DF0A 4DRQA 2KGJA 2WADA 1J4IA 1SYTA 2RUCA 3ARXA 2FAPA 4WIWA 2RUQA 5HW6A 2ZR4A 2ZR6A 4QT3A 1FKTA 2KXQA 4N19A 2VN1A 3LKXB 1QZ2A 1HJWA 3M7NA 1SR0A 3ARTA 2XP7A 3CNGA 4Z2KA 4Z2JA 4ODQA 1KT0A 4DWSA 1E6RA 2DG3A 1TCOC 1O6WA 3ARVA 4KR0B 5DEZA 4PTMA 3O5QA 1W1YA 1ZBKA 4DROA 4S3KA 1EIBA 4MTVA 5U47A 3I6CA 1PINA 3M85A 3ALGA 4LGXA 1H0IA 4HBOA 1E6ZA 3RMEA 1EHNA 4LAXA 1FFRA 2PV3A 3OA5A 3PRBA 3KABA 1PBKA 1EQ3A 4G50A 1E15A 1O6IA 4JFKA 2M3OW 2OLHA 3AROA 1KT1A 3O5DA 1FKHA 1M5YA 5JH8A 3UQAA 2Y8NB 4DRJA 4L3NA 1D7IA 1W1TA 1UR9A 2WK2A 1LJYA 3KAGA 1TFVA 2YSGA 2LKNA 3WL0A 4Z2IA 2Q5AA 4WJXA 1ZB5A 2ZQVA 2XP4A 1LG2A 1E9LA 4JFLA 1K9QA 4XAKA 2AOSA 3WD1A 3LKXA 1P5QA 3O5EA 5DIUA 1GPFA 3MCBB 5HKGA 3TDBA 4WKFA 3ARUA 1JNTA 1X6NA 4LAWA 4J4NA 1OWQA 3UI5A 4DWSD 1QPLA 3WD2A 2YSBA 2ZAJA 2D9FA 1FKSA 1TR8A 4QT2A 1RP5A 2XP6A 3GPKA 3PRDA 1HKKA 3LUOA 2JXWA 4NSBA 4MNLA 3WQVA 3O5FA 2QF8A 2IUZA 2VCDA 3O5LA 4JYSA 5E66A 1HKJA 2A3BA 1EG3A 1FKFA 2DMVA 2DSVA 4LAVA 2DT1A 4DRMA 4MAVA 2KI3A 1T11A 3O5MA 4IPXA 2XP3A 4DIPA 2JV4A 2XPAA 1C9HA 1VF8A 3O5IA 3FAPA 1NWUA 1W9PA 1ZBWA 1D7HA 2KE0A 4GIVA 5HUAA 4DRNA 1FKRA 2WAEA 3CH9A 4QIBA 4GGQA 1X6LA 1UR8A 3ARQA 1NH6A 1K9TA 4IQ2A 4Z2HA 1E6PA 1RD6A 1D7JA 2Y78A 5HW7A 5J6EA 3JXVA 2N87A 1F40A 2ITKA 1HJXA 1OGGA 3O5JA 4DRKA 2WLZA 3JYJA 3JYMA 2XP9A 3PRAA 3RFWA 2XP8A 5E62A 1ZL1A 2FDMA 5DO2A 2PBCA 3O5OA 1F8AB 1FFQA 1W9UA 2DJYA 4MNMA 3UI6A 4QZVB 1LL4A 1ZCNA 1LL6A 3KAHA 3ARZA 3CZ8A 4NNRA 4DRIA 3KADA 5HBFA 5HT1A 5B8IC 3NRKA 2A3AA 4KQZA 4W9OA 1W1VA 3AS3A 4ODOA 4J4OA 4W9PA 1J6YA 4DWSC 5AHTA 2M1IA 4DZ3A 3FY1A 4DRHA 2DG9A 3CGMA 4DZ2A 3KACA 1Q1CA 3FSCA 1ZBCA 2PPOA 4ODRA 4MNJA 4Q22A 5I98A 2OWOA 1U79A 2YBTA 2XPBA 1HKIA 3WD4A 1W9VA 2PPPA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3GPK A;  2IF4 A;  3PRD A;  2OFN A;  3LUO A;  4LAY A;  2L2S A;  4TW6 A;  2JXW A;  1L1P A;  4MSP A;  1JVW A;  4DT4 A;  4REX A;  2RE3 A;  2ZR5 A;  1I5H W;  3O5F A;  2DK1 A;  4ODL A;  1W26 A;  3KCE A;  1FKI A;  2VCD A;  3O5L A;  4JYS A;  2M2A A;  2RUR A;  2LJ4 A;  3O5G A;  5HWC A;  1EG3 A;  2JMF A;  1FKF A;  3UQB A;  2MF9 A;  1NMV A;  2DMV A;  4FN2 A;  2L4J A;  3VAW A;  5J6E A;  3O5K A;  4LAV A;  4DRM A;  4TW7 A;  2LPV A;  5HWB A;  1HXV A;  2KO7 A;  2KI3 A;  2ZQT A;  1T11 A;  3O5M A;  4MGV A;  4DRQ A;  4IPX A;  3UQI A;  2XP3 A;  2KGJ A;  4DIP A;  1J4I A;  2PPN A;  2RUC A;  3IHZ A;  2FAP A;  5HW6 A;  2JV4 A;  1QPF A;  2RUQ A;  2ZR4 A;  1FKB A;  1FKJ A;  2D9F A;  1R9H A;  2F4E A;  2KFW A;  2XPA A;  3IKD A;  2ZR6 A;  4O2T A;  1C9H A;  3O5R A;  2M8I A;  1FKT A;  4QT3 A;  2KXQ A;  2DWV A;  4DH0 A;  4N19 A;  1BL4 A;  3L4H A;  3FAP A;  2VN1 A;  1Y0O A;  1NSG A;  3NTP A;  3O5I A;  4ODP A;  1QZ2 A;  1D7H A;  2KE0 A;  2RQS A;  4GIV A;  4DRN A;  5HUA A;  1FKR A;  3M7N A;  5DIT A;  1ROT A;  3UF8 A;  3KZ7 A;  2FKE A;  4QIB A;  4GGQ A;  2PV1 A;  4ITZ A;  3KAI A;  2BA1 A;  2XP7 A;  3CNG A;  4IQ2 A;  1FJD A;  4ODQ A;  4DRH A;  1KT0 A;  1FD9 A;  1D7J A;  2MLX A;  1B6C A;  2Y78 A;  4W9Q A;  5HW7 A;  2DG3 A;  1N1A A;  1D6O A;  1TCO C;  2M08 A;  1O6W A;  2N87 A;  3JXV A;  3O5P A;  1F40 A;  2MPH A;  4ODK A;  2ITK A;  3O5Q A;  4TNS A;  4DRO A;  4FAP A;  2RSE A;  1NMW A;  3EY6 A;  1FKK A;  3I6C A;  4JFI A;  1PIN A;  3M85 A;  1FKL A;  3PA7 A;  5CQ2 A;  4E5R A;  1FKD A;  2LAJ A;  3O5J A;  2XP5 A;  4G2P A;  2AWG A;  4DRK A;  1K9R A;  1YAT A;  2RUD A;  3JYJ A;  3JYM A;  2XP9 A;  2MLZ A;  4R0X A;  2LGO A;  4LAX A;  2XP8 A;  3RFW A;  2F2D A;  2PV3 A;  2F21 A;  3OOB A;  3PRB A;  5D75 A;  2YSH A;  1WR7 A;  3KAB A;  3KAF A;  2PBC A;  3O5O A;  1PBK A;  1F8A B;  1EQ3 A;  4G50 A;  2DJY A;  4JFK A;  2M3O W;  3B7X A;  3UI6 A;  3IK8 A;  1ZCN A;  2YSF A;  1KT1 A;  3O5D A;  1FKH A;  2K8I A;  4ODN A;  2M8J A;  3WH0 A;  1M5Y A;  4TW8 A;  1WMV A;  3NI6 A;  3UQA A;  4BF8 A;  3KAH A;  5GPG A;  4IQC A;  5DIV A;  1FAP A;  4NNR A;  4DRJ A;  2E45 A;  2PPP A;  2ZQS A;  4U84 A;  1D7I A;  1Q6H A;  4C02 B;  4DRI A;  3KAD A;  4ODM A;  3KAG A;  3RGC A;  5HT1 A;  5B8I C;  2EZ5 W;  3NRK A;  3UI4 A;  2YSG A;  1J4H A;  2LKN A;  3CGN A;  1TK7 A;  2Q5A A;  4W9O A;  2ZQV A;  2XP4 A;  4ODO A;  4TX0 A;  1A7X A;  5BXJ A;  4J4O A;  4W9P A;  4JFL A;  4DRP A;  1K9Q A;  5HTG A;  3IKG A;  2MDI A;  1J6Y A;  1EG4 A;  3TC5 A;  5AHT A;  2M1I A;  3TCZ A;  1P5Q A;  3MDY B;  3O5E A;  4U86 A;  1J4R A;  3H9R B;  5DIU A;  4DZ3 A;  5HW8 A;  4TYO A;  2JZV A;  5HKG A;  1YW5 A;  3TDB A;  1EYM A;  2DG9 A;  2PV2 A;  3CGM A;  1BKF A;  2MLY A;  1JNT A;  1ZK6 A;  4LAW A;  3KAC A;  4J4N A;  4DZ2 A;  1Q1C A;  2KR7 A;  2JX8 A;  4JFJ A;  3UI5 A;  2PPO A;  1JNS A;  4ODR A;  5I98 A;  2YSI A;  4U85 A;  2ZQU A;  1QPL A;  4JFM A;  1Q6U A;  1JMQ A;  1FKG A;  2MNT A;  2DK7 A;  2XPB A;  2YSB A;  2ZAJ A;  3LE4 A;  1Q6I A;  1U79 A;  1FKS A;  2DG4 A;  3ODK A;  4QT2 A;  1ROU A;  2XP6 A;  2UZ5 A; 
#chains in the Genus database with same CATH topology
 1CTN A;  4DWS B;  2DPE A;  2B31 A;  1L1P A;  4REX A;  4WK9 A;  2ZR5 A;  1JNE A;  4ODL A;  5GPR A;  1FKI A;  3QOK A;  2M2A A;  2G41 A;  2LJ4 A;  3O5G A;  5GQB A;  2JMF A;  1IX5 A;  3AS1 A;  4P8U A;  3WKZ A;  1HXV A;  4ML4 A;  2KO7 A;  3W4R A;  4HBE A;  3UQI A;  3IHZ A;  2F4E A;  4ODN A;  2ESC A;  4O2T A;  3O5R A;  2M8I A;  4DH0 A;  2DWV A;  2WM0 A;  3L4H A;  1Y0O A;  1NSG A;  3NTP A;  1LL7 A;  1NWR A;  3ARR A;  2RQS A;  2DT3 A;  2DSZ A;  1ROT A;  2FKE A;  3B9E A;  2BA1 A;  4ZPV R;  3CHD A;  2EUL A;  1GUV A;  1LQ0 A;  4ZPW R;  1D2K A;  2WLY A;  2MLX A;  3RM8 A;  2O92 A;  1D6O A;  2M08 A;  4NZC A;  3WQW A;  1GOI A;  3O5P A;  3FXY A;  2QRV A;  2MPH A;  3WD3 A;  1NMW A;  4JFI A;  4P8V A;  5CQ2 A;  4E5R A;  3BMB A;  2RUD A;  2F2D A;  4WKH A;  4W5U A;  4L72 B;  1OGB A;  3KAF A;  4A0U A;  3ARW A;  2G8Z A;  3B7X A;  1H0G A;  3PR9 A;  2YSF A;  2K8I A;  3WH0 A;  1WMV A;  1ZBV A;  4BF8 A;  5GPG A;  2O9O A;  1FAP A;  2E45 A;  2ZQS A;  4U84 A;  3MQH A;  4MPK A;  4ODM A;  4S3J A;  2EZ5 W;  1J4H A;  3FSB A;  3PQH A;  3CGN A;  4Q7N A;  1NWT A;  5BXJ A;  4DRP A;  5HTG A;  2MDI A;  3TC5 A;  4U86 A;  3AQU A;  4GLX A;  4P8W A;  3ARY A;  2DT0 A;  2JZV A;  1EYM A;  3UI4 A;  1BKF A;  2MLY A;  1ZK6 A;  2KR7 A;  1JNS A;  3RM9 A;  2YSI A;  2ZQU A;  1WNO A;  1Q6U A;  5E5W A;  2MNT A;  1JMQ A;  1Q6I A;  2DK7 A;  1HJV A;  1NWS A;  4R0X A;  1JCH B;  4C02 B;  2IF4 A;  2B5U B;  4IT4 A;  4DT4 A;  1JVW A;  2RE3 A;  2A3E A;  1EDQ A;  5E65 A;  3B9D A;  1WAW A;  3ALF A;  3UQB A;  2L4J A;  3FS8 A;  1LG1 A;  2ZQT A;  4MGV A;  3ARS A;  3BXW A;  2PPN A;  1QPF A;  3MCB A;  1FKB A;  1FKJ A;  2KFW A;  3GTY X;  1R9H A;  3IKD A;  4R5E A;  1KFW A;  1BL4 A;  3MQG A;  4ODP A;  1ITX A;  3B9A A;  4IT6 A;  3WIJ A;  3B8S A;  1XRV A;  5DIT A;  4AY1 A;  3UF8 A;  3KZ7 A;  2PV1 A;  4ITZ A;  3AS0 A;  3KAI A;  3CHF A;  1FJD A;  1FD9 A;  1B6C A;  4Z2G A;  4W9Q A;  1N1A A;  4ODK A;  1XHG A;  4ZS6 A;  4TNS A;  3EIP A;  4FAP A;  2RSE A;  3EY6 A;  1FKK A;  1FKL A;  3PA7 A;  1FKD A;  2LAJ A;  4G2P A;  2XP5 A;  2AWG A;  1K9R A;  1YAT A;  2DT2 A;  3ARP A;  3CHE A;  2MLZ A;  2LGO A;  2DSU A;  2F21 A;  2YBU A;  3OOB A;  5D75 A;  2YSH A;  1WR7 A;  1WB0 A;  1JND A;  3IK8 A;  4TW8 A;  2M8J A;  2PI6 A;  3NI6 A;  4A0T A;  4IQC A;  5DIV A;  4ZPT R;  1ROU A;  1Q6H A;  3RGC A;  3WD0 A;  4MNK A;  1TK7 A;  2YAJ B;  4TX0 A;  1A7X A;  3RM4 A;  3IKG A;  1EG4 A;  3TCZ A;  3MDY B;  1J4R A;  3H9R B;  4WKA A;  3AS2 A;  4TYO A;  3G6L A;  1YW5 A;  2PV2 A;  3WL1 A;  5HW8 A;  4P8X A;  1E6N A;  4JFJ A;  2JX8 A;  1ZU8 A;  4U85 A;  4Z2L A;  4JFM A;  2A3C A;  1FKG A;  3LE4 A;  2DG4 A;  3ODK A;  2UZ5 A;  1HKM A;  2OFN A;  4URI A;  4LAY A;  2L2S A;  4TW6 A;  4MSP A;  2F23 A;  1I5H W;  1FLC A;  2DK1 A;  4HAR A;  3CHC A;  1W26 A;  3KCE A;  5E64 A;  2RUR A;  5HWC A;  3G6M A;  1W1P A;  2MF9 A;  1NMV A;  4FN2 A;  3VAW A;  3O5K A;  2P4V A;  2DSW A;  2LPV A;  4TW7 A;  5HWB A;  2ETN A;  5DF0 A;  4DRQ A;  1GRJ A;  2KGJ A;  2WAD A;  1J4I A;  1SYT A;  2RUC A;  3ARX A;  2FAP A;  4WIW A;  2RUQ A;  5HW6 A;  2ZR4 A;  2ZR6 A;  4QT3 A;  1FKT A;  2KXQ A;  4N19 A;  2VN1 A;  3LKX B;  1QZ2 A;  1HJW A;  3M7N A;  1SR0 A;  3ART A;  2XP7 A;  3CNG A;  4Z2K A;  4Z2J A;  4ODQ A;  1KT0 A;  4DWS A;  1E6R A;  2DG3 A;  1TCO C;  1O6W A;  3ARV A;  4KR0 B;  5DEZ A;  4PTM A;  3O5Q A;  1W1Y A;  1ZBK A;  4DRO A;  4S3K A;  1EIB A;  4MTV A;  5U47 A;  3I6C A;  1PIN A;  3M85 A;  3ALG A;  4LGX A;  1H0I A;  4HBO A;  1E6Z A;  3RME A;  1EHN A;  4LAX A;  1FFR A;  2PV3 A;  3OA5 A;  3PRB A;  3KAB A;  1PBK A;  1EQ3 A;  4G50 A;  1E15 A;  1O6I A;  4JFK A;  2M3O W;  2OLH A;  3ARO A;  1KT1 A;  3O5D A;  1FKH A;  1M5Y A;  5JH8 A;  3UQA A;  2Y8N B;  4DRJ A;  4L3N A;  1D7I A;  1W1T A;  1UR9 A;  2WK2 A;  1LJY A;  3KAG A;  1TFV A;  2YSG A;  2LKN A;  3WL0 A;  4Z2I A;  2Q5A A;  4WJX A;  1ZB5 A;  2ZQV A;  2XP4 A;  1LG2 A;  1E9L A;  4JFL A;  1K9Q A;  4XAK A;  2AOS A;  3WD1 A;  3LKX A;  1P5Q A;  3O5E A;  5DIU A;  1GPF A;  3MCB B;  5HKG A;  3TDB A;  4WKF A;  3ARU A;  1JNT A;  1X6N A;  4LAW A;  4J4N A;  1OWQ A;  4UDM A;  3UI5 A;  4DWS D;  1QPL A;  3WD2 A;  2YSB A;  2ZAJ A;  2D9F A;  1FKS A;  1TR8 A;  4QT2 A;  1RP5 A;  2XP6 A;  3GPK A;  3PRD A;  1HKK A;  3LUO A;  2JXW A;  4NSB A;  4MNL A;  3WQV A;  3O5F A;  2QF8 A;  2IUZ A;  2VCD A;  3O5L A;  4JYS A;  5E66 A;  2PN0 A;  1HKJ A;  2A3B A;  1EG3 A;  1FKF A;  2DMV A;  2DSV A;  4LAV A;  2DT1 A;  4DRM A;  4MAV A;  2KI3 A;  1T11 A;  3O5M A;  4IPX A;  2XP3 A;  4DIP A;  2JV4 A;  2XPA A;  1C9H A;  1VF8 A;  3O5I A;  3FAP A;  1NWU A;  1W9P A;  1ZBW A;  1D7H A;  2KE0 A;  4GIV A;  5HUA A;  4DRN A;  1FKR A;  2WAE A;  3CH9 A;  4QIB A;  4GGQ A;  1X6L A;  1UR8 A;  3ARQ A;  1NH6 A;  1K9T A;  4IQ2 A;  4Z2H A;  1E6P A;  1RD6 A;  1D7J A;  2Y78 A;  5HW7 A;  5J6E A;  3JXV A;  2N87 A;  1F40 A;  2ITK A;  1HJX A;  1OGG A;  3O5J A;  4DRK A;  2WLZ A;  3JYJ A;  3JYM A;  2XP9 A;  3PRA A;  3RFW A;  2XP8 A;  5E62 A;  1ZL1 A;  2FDM A;  5DO2 A;  2PBC A;  3O5O A;  1F8A B;  1FFQ A;  1W9U A;  2DJY A;  4MNM A;  3UI6 A;  4QZV B;  1LL4 A;  1ZCN A;  1LL6 A;  3KAH A;  3ARZ A;  3CZ8 A;  4NNR A;  4DRI A;  3KAD A;  5HBF A;  5HT1 A;  5B8I C;  3NRK A;  2A3A A;  4KQZ A;  3GU0 A;  4W9O A;  1W1V A;  3AS3 A;  4ODO A;  4J4O A;  4W9P A;  1J6Y A;  4DWS C;  5AHT A;  2M1I A;  4DZ3 A;  1E44 A;  3FY1 A;  4DRH A;  2DG9 A;  3CGM A;  4DZ2 A;  3KAC A;  1Q1C A;  3FSC A;  1ZBC A;  2PPO A;  4ODR A;  4MNJ A;  4Q22 A;  5I98 A;  2OWO A;  1U79 A;  2YBT A;  2XPB A;  1HKI A;  3WD4 A;  1W9V A;  2PPP A; 
#chains in the Genus database with same CATH homology
 1CTN A;  4DWS B;  2DPE A;  2B31 A;  1L1P A;  4REX A;  4WK9 A;  2ZR5 A;  1JNE A;  4ODL A;  5GPR A;  1FKI A;  3QOK A;  2M2A A;  2G41 A;  2LJ4 A;  3O5G A;  5GQB A;  2JMF A;  1IX5 A;  3AS1 A;  4P8U A;  3WKZ A;  1HXV A;  4ML4 A;  2KO7 A;  3W4R A;  4HBE A;  3UQI A;  3IHZ A;  2F4E A;  4ODN A;  2ESC A;  4O2T A;  3O5R A;  2M8I A;  4DH0 A;  2DWV A;  2WM0 A;  3L4H A;  1Y0O A;  1NSG A;  3NTP A;  1LL7 A;  3ARR A;  1NWR A;  2RQS A;  2DT3 A;  2DSZ A;  1ROT A;  2FKE A;  3B9E A;  2BA1 A;  4ZPV R;  3CHD A;  1GUV A;  1LQ0 A;  4ZPW R;  1D2K A;  2WLY A;  2MLX A;  3RM8 A;  2O92 A;  1D6O A;  2M08 A;  4NZC A;  3WQW A;  1GOI A;  3O5P A;  3FXY A;  2QRV A;  2MPH A;  3WD3 A;  1NMW A;  4JFI A;  4P8V A;  5CQ2 A;  4E5R A;  2RUD A;  2F2D A;  4WKH A;  4W5U A;  4L72 B;  1OGB A;  3KAF A;  4A0U A;  3ARW A;  2G8Z A;  3B7X A;  1H0G A;  3PR9 A;  2YSF A;  2K8I A;  3WH0 A;  1WMV A;  1ZBV A;  4BF8 A;  5GPG A;  2O9O A;  1FAP A;  2E45 A;  2ZQS A;  4U84 A;  3MQH A;  4MPK A;  4ODM A;  4S3J A;  2EZ5 W;  1J4H A;  3FSB A;  3PQH A;  3CGN A;  4Q7N A;  1NWT A;  5BXJ A;  4DRP A;  5HTG A;  2MDI A;  3TC5 A;  4U86 A;  3AQU A;  4GLX A;  4P8W A;  3ARY A;  2DT0 A;  2JZV A;  1EYM A;  3UI4 A;  1BKF A;  2MLY A;  1ZK6 A;  2KR7 A;  1JNS A;  3RM9 A;  2YSI A;  2ZQU A;  1WNO A;  1Q6U A;  5E5W A;  2MNT A;  1JMQ A;  1Q6I A;  2DK7 A;  1HJV A;  1NWS A;  4R0X A;  4C02 B;  2IF4 A;  4IT4 A;  4DT4 A;  1JVW A;  2RE3 A;  2A3E A;  1EDQ A;  5E65 A;  3B9D A;  1WAW A;  3ALF A;  3UQB A;  2L4J A;  3FS8 A;  1LG1 A;  2ZQT A;  4MGV A;  3ARS A;  3BXW A;  2PPN A;  1QPF A;  3MCB A;  1FKB A;  1FKJ A;  2KFW A;  1R9H A;  3IKD A;  4R5E A;  1KFW A;  1BL4 A;  3MQG A;  4ODP A;  1ITX A;  3B9A A;  4IT6 A;  3WIJ A;  3B8S A;  1XRV A;  5DIT A;  4AY1 A;  3UF8 A;  3KZ7 A;  2PV1 A;  4ITZ A;  3AS0 A;  3KAI A;  3CHF A;  1FJD A;  1FD9 A;  1B6C A;  4Z2G A;  4W9Q A;  1N1A A;  4ODK A;  1XHG A;  4ZS6 A;  4TNS A;  4FAP A;  2RSE A;  3EY6 A;  1FKK A;  1FKL A;  3PA7 A;  1FKD A;  2LAJ A;  4G2P A;  2XP5 A;  2AWG A;  1K9R A;  1YAT A;  2DT2 A;  3ARP A;  3CHE A;  2MLZ A;  2LGO A;  2DSU A;  2F21 A;  2YBU A;  3OOB A;  5D75 A;  2YSH A;  1WR7 A;  1WB0 A;  1JND A;  3IK8 A;  4TW8 A;  2M8J A;  2PI6 A;  3NI6 A;  4A0T A;  4IQC A;  5DIV A;  4ZPT R;  1ROU A;  1Q6H A;  3RGC A;  3WD0 A;  4MNK A;  1TK7 A;  2YAJ B;  4TX0 A;  1A7X A;  3RM4 A;  3IKG A;  1EG4 A;  3TCZ A;  3MDY B;  1J4R A;  3H9R B;  4WKA A;  3AS2 A;  4TYO A;  3G6L A;  1YW5 A;  2PV2 A;  3WL1 A;  5HW8 A;  4P8X A;  1E6N A;  4JFJ A;  2JX8 A;  1ZU8 A;  4U85 A;  4Z2L A;  4JFM A;  2A3C A;  1FKG A;  3LE4 A;  2DG4 A;  3ODK A;  2UZ5 A;  1HKM A;  2OFN A;  4URI A;  4LAY A;  2L2S A;  4TW6 A;  4MSP A;  1I5H W;  1FLC A;  2DK1 A;  4HAR A;  3CHC A;  1W26 A;  3KCE A;  5E64 A;  2RUR A;  5HWC A;  3G6M A;  1W1P A;  2MF9 A;  1NMV A;  4FN2 A;  3VAW A;  3O5K A;  2DSW A;  2LPV A;  4TW7 A;  5HWB A;  5DF0 A;  4DRQ A;  2KGJ A;  2WAD A;  1J4I A;  1SYT A;  2RUC A;  3ARX A;  2FAP A;  4WIW A;  2RUQ A;  5HW6 A;  2ZR4 A;  2ZR6 A;  4QT3 A;  1FKT A;  2KXQ A;  4N19 A;  2VN1 A;  3LKX B;  1QZ2 A;  1HJW A;  3M7N A;  1SR0 A;  3ART A;  2XP7 A;  3CNG A;  4Z2K A;  4Z2J A;  4ODQ A;  1KT0 A;  4DWS A;  1E6R A;  2DG3 A;  1TCO C;  1O6W A;  3ARV A;  4KR0 B;  5DEZ A;  4PTM A;  3O5Q A;  1W1Y A;  1ZBK A;  4DRO A;  4S3K A;  1EIB A;  4MTV A;  5U47 A;  3I6C A;  1PIN A;  3M85 A;  3ALG A;  4LGX A;  1H0I A;  4HBO A;  1E6Z A;  3RME A;  1EHN A;  4LAX A;  1FFR A;  2PV3 A;  3OA5 A;  3PRB A;  3KAB A;  1PBK A;  1EQ3 A;  4G50 A;  1E15 A;  1O6I A;  4JFK A;  2M3O W;  2OLH A;  3ARO A;  1KT1 A;  3O5D A;  1FKH A;  1M5Y A;  5JH8 A;  3UQA A;  2Y8N B;  4DRJ A;  4L3N A;  1D7I A;  1W1T A;  1UR9 A;  2WK2 A;  1LJY A;  3KAG A;  1TFV A;  2YSG A;  2LKN A;  3WL0 A;  4Z2I A;  2Q5A A;  4WJX A;  1ZB5 A;  2ZQV A;  2XP4 A;  1LG2 A;  1E9L A;  4JFL A;  1K9Q A;  4XAK A;  2AOS A;  3WD1 A;  3LKX A;  1P5Q A;  3O5E A;  5DIU A;  1GPF A;  3MCB B;  5HKG A;  3TDB A;  4WKF A;  3ARU A;  1JNT A;  1X6N A;  4LAW A;  4J4N A;  1OWQ A;  3UI5 A;  4DWS D;  1QPL A;  3WD2 A;  2YSB A;  2ZAJ A;  2D9F A;  1FKS A;  1TR8 A;  4QT2 A;  1RP5 A;  2XP6 A;  3GPK A;  3PRD A;  1HKK A;  3LUO A;  2JXW A;  4NSB A;  4MNL A;  3WQV A;  3O5F A;  2QF8 A;  2IUZ A;  2VCD A;  3O5L A;  4JYS A;  5E66 A;  1HKJ A;  2A3B A;  1EG3 A;  1FKF A;  2DMV A;  2DSV A;  4LAV A;  2DT1 A;  4DRM A;  4MAV A;  2KI3 A;  1T11 A;  3O5M A;  4IPX A;  2XP3 A;  4DIP A;  2JV4 A;  2XPA A;  1C9H A;  1VF8 A;  3O5I A;  3FAP A;  1NWU A;  1W9P A;  1ZBW A;  1D7H A;  2KE0 A;  4GIV A;  5HUA A;  4DRN A;  1FKR A;  2WAE A;  3CH9 A;  4QIB A;  4GGQ A;  1X6L A;  1UR8 A;  3ARQ A;  1NH6 A;  1K9T A;  4IQ2 A;  4Z2H A;  1E6P A;  1RD6 A;  1D7J A;  2Y78 A;  5HW7 A;  5J6E A;  3JXV A;  2N87 A;  1F40 A;  2ITK A;  1HJX A;  1OGG A;  3O5J A;  4DRK A;  2WLZ A;  3JYJ A;  3JYM A;  2XP9 A;  3PRA A;  3RFW A;  2XP8 A;  5E62 A;  1ZL1 A;  2FDM A;  5DO2 A;  2PBC A;  3O5O A;  1F8A B;  1FFQ A;  1W9U A;  2DJY A;  4MNM A;  3UI6 A;  4QZV B;  1LL4 A;  1ZCN A;  1LL6 A;  3KAH A;  3ARZ A;  3CZ8 A;  4NNR A;  4DRI A;  3KAD A;  5HBF A;  5HT1 A;  5B8I C;  3NRK A;  2A3A A;  4KQZ A;  4W9O A;  1W1V A;  3AS3 A;  4ODO A;  4J4O A;  4W9P A;  1J6Y A;  4DWS C;  5AHT A;  2M1I A;  4DZ3 A;  3FY1 A;  4DRH A;  2DG9 A;  3CGM A;  4DZ2 A;  3KAC A;  1Q1C A;  3FSC A;  1ZBC A;  2PPO A;  4ODR A;  4MNJ A;  4Q22 A;  5I98 A;  2OWO A;  1U79 A;  2YBT A;  2XPB A;  1HKI A;  3WD4 A;  1W9V A;  2PPP A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...