1ZCNA

Human pin1 ng mutant
Total Genus 47
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
47
sequence length
155
structure length
143
Chain Sequence
b'LPPGWEKRMSNGRVYYFNHITNASQWERPSEPARVRCSHLLVKHSQSRRPSSWRQEKITRTKEEALELINGYIQKIKSGEEDFESLASQFSDCSSAKARGDLGAFSRGQMQKPFEDASFALRTGEMSGPVFTDSGIHIILRTE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Peptidyl-prolyl cis-trans isomerase NIMA-interacting 1
publication title Structure-function-folding relationship in a WW domain.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Isomerase
total genus 47
structure length 143
sequence length 155
ec nomenclature ec 5.2.1.8: Peptidylprolyl isomerase.
pdb deposition date 2005-04-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00397 WW WW domain
A PF00639 Rotamase PPIC-type PPIASE domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.20.70.10 Mainly Beta Single Sheet Ubiquitin Ligase Nedd4; Chain: W; Ubiquitin Ligase Nedd4; Chain: W; 1zcnA01
3.10.50.40 Alpha Beta Roll Chitinase A; domain 3 Chitinase A; domain 3 1zcnA02
2VN1A 1KT1A 2M2AA 1D7HA 2ZR6A 3KAHA 2DG9A 3JYJA 2JZVA 2Q5AA 4DRKA 1O6WA 2ZQUA 2KI3A 2XP6A 3FAPA 3RFWA 2ZR4A 2PV3A 3O5OA 4DIPA 4MSPA 5HW8A 2D9FA 4REXA 3PRDA 2JX8A 4DRJA 4E5RA 3KADA 2RQSA 4U86A 2AWGA 2PV2A 3UI4A 3UQIA 3O5MA 3KZ7A 2KXQA 1PBKA 2PBCA 5GPGA 3MDYB 2XP9A 2PPNA 4LAXA 3KACA 1ROTA 1YW5A 3KABA 1A7XA 4DRHA 3B7XA 5HUAA 2ZQVA 4U85A 4DRQA 1QPLA 4ODMA 4LAVA 1FKDA 5HWBA 2M1IA 1M5YA 2ZQTA 2MDIA 2XP7A 4JFJA 2M8JA 2RUDA 3UQAA 2PPPA 3I6CA 2XP8A 2RE3A 5HW6A 2L4JA 4NNRA 2XP5A 4JYSA 1C9HA 1NMVA 4ODLA 2LAJA 1QZ2A 2BA1A 5DIUA 1D7JA 3LE4A 1D7IA 1BKFA 2DG4A 3IK8A 4TYOA 3GPKA 4TW7A 5HKGA 2OFNA 3TCZA 1JVWA 4QIBA 2K8IA 3LUOA 1K9QA 1FKJA 4JFLA 1L1PA 4LAWA 4G2PA 3H9RB 3O5GA 2DMVA 1Y0OA 3O5EA 2FAPA 1EG3A 1FKRA 4TX0A 2RUCA 3TDBA 3O5JA 3O5RA 1WR7A 2MNTA 4ODOA 2XP4A 1FKGA 2YSGA 5HWCA 2JXWA 4TNSA 2YSIA 3IKGA 2KFWA 1Q1CA 4ODKA 4IQ2A 2RSEA 3M85A 3VAWA 3NRKA 4GGQA 1FKBA 5DIVA 5BXJA 3UI5A 3KAFA 2ZR5A 3O5PA 4GIVA 3WH0A 3KAGA 4ITZA 1JMQA 1YATA 2Y78A 2LGOA 4U84A 5DITA 1J4RA 2PV1A 4DRNA 2DWVA 3KCEA 4J4NA 2M08A 2MPHA 1KT0A 1FKIA 2MF9A 2RUQA 2LPVA 3PRBA 4DROA 2EZ5W 1FD9A 5HTGA 4MGVA 1J6YA 1TCOC 1ZCNA 4IQCA 3O5KA 4FAPA 2DJYA 3CGNA 4FN2A 4DRMA 1Q6IA 1Q6HA 4JFIA 2M3OW 3M7NA 3CNGA 2XPBA 4DH0A 2ZQSA 2JV4A 3JYMA 4W9PA 2XPAA 3OOBA 1J4IA 1PINA 1EG4A 3PA7A 3ODKA 3UF8A 1FKLA 1I5HW 4DZ2A 3IKDA 1NSGA 4N19A 5HT1A 3IHZA 1F8AB 1HXVA 2MLYA 3NI6A 2F2DA 3RGCA 2ZAJA 4QT3A 1J4HA 2L2SA 1JNTA 1FKFA 2XP3A 4R0XA 1T11A 4LAYA 2FKEA 2JMFA 2VCDA 1TK7A 3KAIA 4DRIA 3O5DA 1BL4A 4ODRA 4C02B 4ODQA 2M8IA 2RURA 4DT4A 1W26A 1K9RA 1EQ3A 2IF4A 3L4HA 3CGMA 5D75A 4JFKA 5CQ2A 1R9HA 4W9QA 4O2TA 3O5LA 1WMVA 1FAPA 2ITKA 1FJDA 3TC5A 2LKNA 1F40A 5J6EA 4W9OA 1U79A 5AHTA 4JFMA 2UZ5A 2N87A 1FKHA 1FKKA 2DK7A 1D6OA 4IPXA 5I98A 2KO7A 2MLZA 1Q6UA 1ROUA 2F21A 2E45A 4ODPA 4TW8A 1N1AA 3O5FA 2YSFA 5HW7A 4J4OA 2DG3A 1FKSA 1B6CA 4G50A 1JNSA 1P5QA 2YSHA 4TW6A 3NTPA 3UQBA 2LJ4A 1ZK6A 2PPOA 3UI6A 3EY6A 2KR7A 2YSBA 4ODNA 3O5IA 1FKTA 4QT2A 3O5QA 2KE0A 1EYMA 3JXVA 2F4EA 1NMWA 2DK1A 5B8IC 2KGJA 4BF8A 4DRPA 4DZ3A 1QPFA 2MLXA
chains in the Genus database with same CATH superfamily
1ITXA 5JH8A 2VN1A 2A3EA 1KT1A 2O9OA 2M2AA 1RD6A 1D7HA 2ZR6A 3KAHA 3ALGA 2DG9A 1JCHB 3JYJA 2JZVA 4ML4A 1ZBKA 2Q5AA 3B9AA 4DRKA 1O6WA 2ZQUA 2KI3A 2XP6A 3FAPA 3RFWA 2ZR4A 2PV3A 3O5OA 4P8XA 1W1VA 4WIWA 1GUVA 4DIPA 2DT2A 4MPKA 4MSPA 5HW8A 2D9FA 4REXA 3PRDA 2JX8A 4DRJA 4E5RA 1JNEA 1SYTA 3KADA 2RQSA 2FDMA 4U86A 2AWGA 2PV2A 3UI4A 3UQIA 3FS8A 3FXYA 3RM8A 3O5MA 3KZ7A 1LQ0A 2P4VA 3WD4A 2KXQA 5DF0A 1PBKA 4L3NA 2PBCA 5GPGA 3MDYB 4S3JA 5E65A 2XP9A 1W9VA 2PPNA 4LAXA 1HKIA 1ROTA 3KACA 3FSBA 3QOKA 1CTNA 1HJVA 2EULA 3WIJA 1YW5A 3KABA 1A7XA 4DRHA 3B7XA 1TFVA 5DO2A 2ZQVA 2F23A 3AS0A 5HUAA 4U85A 1WNOA 4DRQA 1QPLA 4LAVA 4ODMA 1FKDA 3B9DA 5HWBA 1UR9A 3ARXA 3AROA 4A0TA 1LJYA 1O6IA 2M1IA 4DWSB 1M5YA 2ZQTA 2MDIA 1H0IA 1XRVA 2XP7A 3ARTA 4JFJA 4A0UA 2PN0A 2QF8A 2M8JA 2RUDA 3WQWA 4Z2JA 3UQAA 2PPPA 1LL6A 3I6CA 3GTYX 2XP8A 2AOSA 4PTMA 2RE3A 5HW6A 1HJWA 2L4JA 4NNRA 1E6PA 2XP5A 4JYSA 3LKXB 1C9HA 3WD1A 1JNDA 1NMVA 4ODLA 4MNMA 3ARPA 4HBOA 2LAJA 1QZ2A 2BA1A 5DIUA 1LG1A 1D7JA 3LE4A 1D7IA 4MNKA 1BKFA 2DG4A 4Z2HA 3B9EA 3IK8A 4TYOA 4P8UA 4HARA 3GPKA 1ZBCA 4TW7A 4LGXA 3AS2A 4S3KA 5HKGA 2OFNA 3TCZA 1JVWA 2DT1A 4QIBA 2K8IA 3LUOA 2DSZA 3ALFA 1X6LA 1K9QA 3CZ8A 2A3BA 1W1PA 1W1TA 1NWTA 1FKJA 2DPEA 3AS3A 4JFLA 1L1PA 4LAWA 1NH6A 4KR0B 3OA5A 5E66A 4G2PA 4DWSD 5E62A 3MQGA 4MNJA 2G8ZA 3MCBB 3H9RB 4ZPWR 3O5GA 3MQHA 1E6RA 2DMVA 1Y0OA 1ZB5A 3O5EA 3RM4A 1ZBWA 5E64A 2FAPA 4Z2LA 1EG3A 1FKRA 2WLZA 4P8VA 4TX0A 2RUCA 1E9LA 3TDBA 3O5JA 2OLHA 3O5RA 1WR7A 2MNTA 2XP4A 4ODOA 4DWSA 1FKGA 2YSGA 1LL4A 5HWCA 2JXWA 4TNSA 2YSIA 4NZCA 3IKGA 2KFWA 1Q1CA 1NWRA 1GPFA 1EHNA 3GU0A 1ZU8A 4ODKA 1GOIA 4IQ2A 1E15A 2RSEA 4AY1A 1OGBA 3LKXA 2YAJB 3M85A 4KQZA 4Q7NA 3RM9A 3VAWA 3NRKA 4GGQA 5GQBA 1FKBA 3CHCA 5DIVA 3BXWA 1ZBVA 5BXJA 3UI5A 3KAFA 3ARQA 2ZR5A 3O5PA 4IT6A 4GIVA 3WH0A 3KAGA 4ITZA 1JMQA 2WLYA 1YATA 2Y78A 3G6MA 5GPRA 1EDQA 4HBEA 2IUZA 2LGOA 4U84A 1EIBA 5DITA 4ZS6A 1J4RA 2PV1A 4DRNA 2DWVA 2QRVA 1TR8A 3KCEA 4J4NA 2M08A 1ZL1A 2MPHA 1KT0A 3AQUA 3ARVA 1FKIA 1WAWA 1RP5A 3MCBA 1LG2A 2MF9A 2RUQA 3WKZA 2LPVA 3PRBA 4DROA 3ARRA 3FY1A 2EZ5W 2WK2A 1FD9A 4ZPVR 2DT0A 3ARUA 3EIPA 5HTGA 4MGVA 4DWSC 1OGGA 1E44A 1J6YA 1HKMA 1TCOC 1ZCNA 4IQCA 3O5KA 1LL7A 4FAPA 3WL0A 2DJYA 3CGNA 4FN2A 4DRMA 1Q6IA 2Y8NB 1Q6HA 4Z2IA 4JFIA 1IX5A 4WKAA 3ARSA 2M3OW 3M7NA 1FFQA 3CNGA 1SR0A 1HKJA 3WD2A 2XPBA 5HBFA 4DH0A 2ZQSA 3PR9A 2JV4A 3FSCA 1UR8A 3JYMA 4IT4A 4W9PA 2XPAA 3OOBA 1J4IA 1PINA 1EG4A 5DEZA 1E6ZA 3PA7A 3ODKA 4UDMA 4NSBA 3WQVA 3CHEA 3UF8A 1FKLA 1I5HW 4ZPTR 4DZ2A 3IKDA 4MAVA 5U47A 1FFRA 1NSGA 4WKHA 4N19A 5HT1A 3PRAA 4XAKA 3IHZA 1F8AB 1HXVA 2MLYA 2ESCA 3WD0A 3RMEA 3NI6A 3ARWA 2F2DA 3RGCA 2A3CA 2ZAJA 4QT3A 1J4HA 2L2SA 1JNTA 3W4RA 1FKFA 4WKFA 2A3AA 2XP3A 2PI6A 4R0XA 2DSVA 2O92A 1T11A 4LAYA 2FKEA 4WJXA 2JMFA 2VCDA 1TK7A 1W9PA 3KAIA 4DRIA 3O5DA 1BL4A 4ODRA 4C02B 4ODQA 4R5EA 2M8IA 3WD3A 2RURA 2ETNA 4Q22A 3ARYA 4DT4A 1W26A 1K9RA 1EQ3A 2G41A 2IF4A 3L4HA 3CGMA 1X6NA 5D75A 4JFKA 3B8SA 5CQ2A 1R9HA 4W9QA 4O2TA 3O5LA 4W5UA 1WMVA 1FAPA 2B5UB 2ITKA 2B31A 1FJDA 3BMBA 3TC5A 1WB0A 2LKNA 4Z2KA 1F40A 5J6EA 4W9OA 1U79A 5AHTA 1XHGA 3WL1A 4JFMA 4GLXA 2UZ5A 1HKKA 2WM0A 1VF8A 2N87A 1FKHA 1FKKA 2DK7A 1D6OA 4P8WA 3G6LA 4IPXA 5I98A 2KO7A 1GRJA 2MLZA 1Q6UA 1ROUA 1W9UA 3CH9A 2F21A 2YBUA 4URIA 2E45A 4ODPA 4TW8A 4QZVB 1N1AA 3ARZA 3O5FA 2YSFA 1D2KA 1NWSA 1E6NA 3CHDA 2YBTA 1K9TA 5HW7A 3CHFA 4Z2GA 4J4OA 2DG3A 1OWQA 1FKSA 1B6CA 4G50A 2DSUA 1JNSA 1P5QA 3AS1A 1KFWA 2YSHA 4TW6A 3NTPA 3UQBA 4WK9A 2WADA 2LJ4A 4MNLA 1ZK6A 2PPOA 3UI6A 3EY6A 5E5WA 2KR7A 4MTVA 2YSBA 4ODNA 1HJXA 3O5IA 1FKTA 4QT2A 3O5QA 1H0GA 2DSWA 1W1YA 2KE0A 3PQHA 1EYMA 3JXVA 2F4EA 1NMWA 1NWUA 2DK1A 5B8IC 2KGJA 2DT3A 4L72B 4BF8A 2WAEA 2OWOA 4DRPA 4DZ3A 1QPFA 2MLXA 1FLCA
chains in the Genus database with same CATH topology
1ITXA 5JH8A 2VN1A 2A3EA 1KT1A 2O9OA 2M2AA 1RD6A 1D7HA 2ZR6A 3KAHA 3ALGA 2DG9A 3JYJA 2JZVA 4ML4A 1ZBKA 2Q5AA 3B9AA 4DRKA 1O6WA 2ZQUA 2KI3A 2XP6A 3FAPA 3RFWA 2ZR4A 2PV3A 3O5OA 4P8XA 1W1VA 4WIWA 1GUVA 4DIPA 2DT2A 4MPKA 4MSPA 5HW8A 2D9FA 4REXA 3PRDA 2JX8A 4DRJA 4E5RA 1JNEA 1SYTA 3KADA 2RQSA 2FDMA 4U86A 2AWGA 2PV2A 3UI4A 3UQIA 3FS8A 3FXYA 3RM8A 3O5MA 3KZ7A 1LQ0A 3WD4A 2KXQA 5DF0A 1PBKA 4L3NA 2PBCA 5GPGA 3MDYB 4S3JA 5E65A 2XP9A 2PPNA 1W9VA 4LAXA 1HKIA 1ROTA 3KACA 3FSBA 3QOKA 1CTNA 1HJVA 3WIJA 1YW5A 3KABA 1A7XA 4DRHA 3B7XA 1TFVA 5DO2A 2ZQVA 3AS0A 5HUAA 4U85A 1WNOA 4DRQA 1QPLA 4LAVA 4ODMA 1FKDA 3B9DA 5HWBA 1UR9A 3ARXA 3AROA 4A0TA 1LJYA 1O6IA 2M1IA 4DWSB 1M5YA 2ZQTA 2MDIA 1H0IA 1XRVA 2XP7A 3ARTA 4JFJA 4A0UA 2QF8A 2M8JA 2RUDA 3WQWA 4Z2JA 3UQAA 2PPPA 1LL6A 3I6CA 2XP8A 2AOSA 4PTMA 2RE3A 5HW6A 1HJWA 2L4JA 4NNRA 1E6PA 2XP5A 4JYSA 3LKXB 1C9HA 3WD1A 1JNDA 1NMVA 4ODLA 4MNMA 3ARPA 4HBOA 2LAJA 1QZ2A 2BA1A 5DIUA 1LG1A 1D7JA 3LE4A 1D7IA 4MNKA 1BKFA 2DG4A 4Z2HA 3B9EA 3IK8A 4TYOA 4P8UA 4HARA 3GPKA 1ZBCA 4TW7A 4LGXA 3AS2A 4S3KA 5HKGA 2OFNA 3TCZA 1JVWA 2DT1A 4QIBA 2K8IA 3LUOA 2DSZA 3ALFA 1X6LA 1K9QA 3CZ8A 2A3BA 1W1PA 1W1TA 1NWTA 1FKJA 2DPEA 3AS3A 4JFLA 1L1PA 4LAWA 1NH6A 4KR0B 3OA5A 5E66A 4G2PA 4DWSD 5E62A 3MQGA 4MNJA 2G8ZA 3MCBB 3H9RB 4ZPWR 3O5GA 3MQHA 1E6RA 2DMVA 1Y0OA 1ZB5A 3O5EA 3RM4A 1ZBWA 5E64A 2FAPA 4Z2LA 1EG3A 1FKRA 2WLZA 4P8VA 4TX0A 2RUCA 1E9LA 3TDBA 3O5JA 2OLHA 3O5RA 1WR7A 2MNTA 2XP4A 4ODOA 4DWSA 1FKGA 2YSGA 1LL4A 5HWCA 2JXWA 4TNSA 2YSIA 4NZCA 3IKGA 2KFWA 1Q1CA 1NWRA 1GPFA 1EHNA 1ZU8A 4ODKA 1GOIA 4IQ2A 1E15A 2RSEA 4AY1A 1OGBA 3LKXA 2YAJB 3M85A 4KQZA 4Q7NA 3RM9A 3VAWA 3NRKA 4GGQA 5GQBA 1FKBA 3CHCA 5DIVA 3BXWA 1ZBVA 5BXJA 3UI5A 3KAFA 3ARQA 2ZR5A 3O5PA 4IT6A 4GIVA 3WH0A 3KAGA 4ITZA 1JMQA 2WLYA 1YATA 2Y78A 3G6MA 5GPRA 1EDQA 4HBEA 2IUZA 2LGOA 4U84A 1EIBA 5DITA 4ZS6A 1J4RA 2PV1A 4DRNA 2DWVA 2QRVA 1TR8A 3KCEA 4J4NA 2M08A 1ZL1A 2MPHA 1KT0A 3AQUA 3ARVA 1FKIA 1WAWA 1RP5A 3MCBA 1LG2A 2MF9A 2RUQA 3WKZA 2LPVA 3PRBA 4DROA 3ARRA 3FY1A 2EZ5W 2WK2A 1FD9A 4ZPVR 2DT0A 3ARUA 5HTGA 4MGVA 4DWSC 1OGGA 1J6YA 1HKMA 1TCOC 1ZCNA 4IQCA 3O5KA 1LL7A 4FAPA 3WL0A 2DJYA 3CGNA 4FN2A 4DRMA 1Q6IA 2Y8NB 1Q6HA 4Z2IA 4JFIA 1IX5A 4WKAA 3ARSA 2M3OW 3M7NA 1FFQA 3CNGA 1SR0A 1HKJA 3WD2A 2XPBA 5HBFA 4DH0A 2ZQSA 3PR9A 2JV4A 3FSCA 1UR8A 3JYMA 4IT4A 4W9PA 2XPAA 3OOBA 1J4IA 1PINA 1EG4A 5DEZA 1E6ZA 3PA7A 3ODKA 4NSBA 3WQVA 3CHEA 3UF8A 1FKLA 1I5HW 4ZPTR 4DZ2A 3IKDA 4MAVA 5U47A 1FFRA 1NSGA 4WKHA 4N19A 5HT1A 3PRAA 4XAKA 3IHZA 1F8AB 1HXVA 2MLYA 2ESCA 3WD0A 3RMEA 3NI6A 3ARWA 2F2DA 3RGCA 2A3CA 2ZAJA 4QT3A 1J4HA 2L2SA 1JNTA 3W4RA 1FKFA 4WKFA 2A3AA 2XP3A 2PI6A 4R0XA 2DSVA 2O92A 1T11A 4LAYA 2FKEA 4WJXA 2JMFA 2VCDA 1TK7A 1W9PA 3KAIA 4DRIA 3O5DA 1BL4A 4ODRA 4C02B 4ODQA 4R5EA 2M8IA 3WD3A 2RURA 4Q22A 3ARYA 4DT4A 1W26A 1K9RA 1EQ3A 2G41A 2IF4A 3L4HA 3CGMA 1X6NA 5D75A 4JFKA 3B8SA 5CQ2A 1R9HA 4W9QA 4O2TA 3O5LA 4W5UA 1WMVA 1FAPA 2ITKA 2B31A 1FJDA 3TC5A 1WB0A 2LKNA 4Z2KA 1F40A 5J6EA 4W9OA 1U79A 5AHTA 1XHGA 3WL1A 4JFMA 4GLXA 2UZ5A 1HKKA 2WM0A 1VF8A 2N87A 1FKHA 1FKKA 2DK7A 1D6OA 4P8WA 3G6LA 4IPXA 5I98A 2KO7A 2MLZA 1Q6UA 1ROUA 1W9UA 3CH9A 2F21A 2YBUA 4URIA 2E45A 4ODPA 4TW8A 4QZVB 1N1AA 3ARZA 3O5FA 2YSFA 1D2KA 1NWSA 1E6NA 3CHDA 2YBTA 1K9TA 5HW7A 3CHFA 4Z2GA 4J4OA 2DG3A 1OWQA 1FKSA 1B6CA 4G50A 2DSUA 1JNSA 1P5QA 3AS1A 1KFWA 2YSHA 4TW6A 3NTPA 3UQBA 4WK9A 2WADA 2LJ4A 4MNLA 1ZK6A 2PPOA 3UI6A 3EY6A 5E5WA 2KR7A 4MTVA 2YSBA 4ODNA 1HJXA 3O5IA 1FKTA 4QT2A 3O5QA 1H0GA 2DSWA 1W1YA 2KE0A 3PQHA 1EYMA 3JXVA 2F4EA 1NMWA 1NWUA 2DK1A 5B8IC 2KGJA 2DT3A 4L72B 4BF8A 2WAEA 2OWOA 4DRPA 4DZ3A 1QPFA 2MLXA 1FLCA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2VN1 A;  1KT1 A;  2M2A A;  1D7H A;  2ZR6 A;  3KAH A;  2DG9 A;  3JYJ A;  2JZV A;  2Q5A A;  4DRK A;  1O6W A;  2ZQU A;  2KI3 A;  2XP6 A;  3FAP A;  3RFW A;  2ZR4 A;  2PV3 A;  3O5O A;  4DIP A;  4MSP A;  5HW8 A;  2D9F A;  4REX A;  3PRD A;  2JX8 A;  4DRJ A;  4E5R A;  3KAD A;  2RQS A;  4U86 A;  2AWG A;  2PV2 A;  3UI4 A;  3UQI A;  3O5M A;  3KZ7 A;  2KXQ A;  1PBK A;  2PBC A;  5GPG A;  3MDY B;  2XP9 A;  2PPN A;  4LAX A;  3KAC A;  1ROT A;  1YW5 A;  3KAB A;  1A7X A;  4DRH A;  3B7X A;  5HUA A;  2ZQV A;  4U85 A;  4DRQ A;  1QPL A;  4ODM A;  4LAV A;  1FKD A;  5HWB A;  2M1I A;  1M5Y A;  2ZQT A;  2MDI A;  2XP7 A;  4JFJ A;  2M8J A;  2RUD A;  3UQA A;  2PPP A;  3I6C A;  2XP8 A;  2RE3 A;  5HW6 A;  2L4J A;  4NNR A;  2XP5 A;  4JYS A;  1C9H A;  1NMV A;  4ODL A;  2LAJ A;  1QZ2 A;  2BA1 A;  5DIU A;  1D7J A;  3LE4 A;  1D7I A;  1BKF A;  2DG4 A;  3IK8 A;  4TYO A;  3GPK A;  4TW7 A;  5HKG A;  2OFN A;  3TCZ A;  1JVW A;  4QIB A;  2K8I A;  3LUO A;  1K9Q A;  1FKJ A;  4JFL A;  1L1P A;  4LAW A;  4G2P A;  3H9R B;  3O5G A;  2DMV A;  1Y0O A;  3O5E A;  2FAP A;  1EG3 A;  1FKR A;  4TX0 A;  2RUC A;  3TDB A;  3O5J A;  3O5R A;  1WR7 A;  2MNT A;  4ODO A;  2XP4 A;  1FKG A;  2YSG A;  5HWC A;  2JXW A;  4TNS A;  2YSI A;  3IKG A;  2KFW A;  1Q1C A;  4ODK A;  4IQ2 A;  2RSE A;  3M85 A;  3VAW A;  3NRK A;  4GGQ A;  1FKB A;  5DIV A;  5BXJ A;  3UI5 A;  3KAF A;  2ZR5 A;  3O5P A;  4GIV A;  3WH0 A;  3KAG A;  4ITZ A;  1JMQ A;  1YAT A;  2Y78 A;  2LGO A;  4U84 A;  5DIT A;  1J4R A;  2PV1 A;  4DRN A;  2DWV A;  3KCE A;  4J4N A;  2M08 A;  2MPH A;  1KT0 A;  1FKI A;  2MF9 A;  2RUQ A;  2LPV A;  3PRB A;  4DRO A;  2EZ5 W;  1FD9 A;  5HTG A;  4MGV A;  1J6Y A;  1TCO C;  1ZCN A;  4IQC A;  3O5K A;  4FAP A;  2DJY A;  3CGN A;  4FN2 A;  4DRM A;  1Q6I A;  1Q6H A;  4JFI A;  2M3O W;  3M7N A;  3CNG A;  2XPB A;  4DH0 A;  2ZQS A;  2JV4 A;  3JYM A;  4W9P A;  2XPA A;  3OOB A;  1J4I A;  1PIN A;  1EG4 A;  3PA7 A;  3ODK A;  3UF8 A;  1FKL A;  1I5H W;  4DZ2 A;  3IKD A;  1NSG A;  4N19 A;  5HT1 A;  3IHZ A;  1F8A B;  1HXV A;  2MLY A;  3NI6 A;  2F2D A;  3RGC A;  2ZAJ A;  4QT3 A;  1J4H A;  2L2S A;  1JNT A;  1FKF A;  2XP3 A;  4R0X A;  1T11 A;  4LAY A;  2FKE A;  2JMF A;  2VCD A;  1TK7 A;  3KAI A;  4DRI A;  3O5D A;  1BL4 A;  4ODR A;  4C02 B;  4ODQ A;  2M8I A;  2RUR A;  4DT4 A;  1W26 A;  1K9R A;  1EQ3 A;  2IF4 A;  3L4H A;  3CGM A;  5D75 A;  4JFK A;  5CQ2 A;  1R9H A;  4W9Q A;  4O2T A;  3O5L A;  1WMV A;  1FAP A;  2ITK A;  1FJD A;  3TC5 A;  2LKN A;  1F40 A;  5J6E A;  4W9O A;  1U79 A;  5AHT A;  4JFM A;  2UZ5 A;  2N87 A;  1FKH A;  1FKK A;  2DK7 A;  1D6O A;  4IPX A;  5I98 A;  2KO7 A;  2MLZ A;  1Q6U A;  1ROU A;  2F21 A;  2E45 A;  4ODP A;  4TW8 A;  1N1A A;  3O5F A;  2YSF A;  5HW7 A;  4J4O A;  2DG3 A;  1FKS A;  1B6C A;  4G50 A;  1JNS A;  1P5Q A;  2YSH A;  4TW6 A;  3NTP A;  3UQB A;  2LJ4 A;  1ZK6 A;  2PPO A;  3UI6 A;  3EY6 A;  2KR7 A;  2YSB A;  4ODN A;  3O5I A;  1FKT A;  4QT2 A;  3O5Q A;  2KE0 A;  1EYM A;  3JXV A;  2F4E A;  1NMW A;  2DK1 A;  5B8I C;  2KGJ A;  4BF8 A;  4DRP A;  4DZ3 A;  1QPF A;  2MLX A; 
#chains in the Genus database with same CATH topology
 1ITX A;  5JH8 A;  2VN1 A;  2A3E A;  1KT1 A;  2O9O A;  2M2A A;  1RD6 A;  1D7H A;  2ZR6 A;  3KAH A;  3ALG A;  2DG9 A;  1JCH B;  3JYJ A;  2JZV A;  4ML4 A;  1ZBK A;  2Q5A A;  3B9A A;  4DRK A;  1O6W A;  2ZQU A;  2KI3 A;  2XP6 A;  3FAP A;  3RFW A;  2ZR4 A;  2PV3 A;  3O5O A;  4P8X A;  1W1V A;  4WIW A;  1GUV A;  4DIP A;  2DT2 A;  4MPK A;  4MSP A;  5HW8 A;  2D9F A;  4REX A;  3PRD A;  2JX8 A;  4DRJ A;  4E5R A;  1JNE A;  1SYT A;  3KAD A;  2RQS A;  2FDM A;  4U86 A;  2AWG A;  2PV2 A;  3UI4 A;  3UQI A;  3FS8 A;  3FXY A;  3RM8 A;  3O5M A;  3KZ7 A;  1LQ0 A;  2P4V A;  3WD4 A;  2KXQ A;  5DF0 A;  1PBK A;  4L3N A;  2PBC A;  5GPG A;  3MDY B;  4S3J A;  5E65 A;  2XP9 A;  1W9V A;  2PPN A;  4LAX A;  1HKI A;  1ROT A;  3KAC A;  3FSB A;  3QOK A;  1CTN A;  1HJV A;  2EUL A;  3WIJ A;  1YW5 A;  3KAB A;  1A7X A;  4DRH A;  3B7X A;  1TFV A;  5DO2 A;  2ZQV A;  2F23 A;  3AS0 A;  5HUA A;  4U85 A;  1WNO A;  4DRQ A;  1QPL A;  4LAV A;  4ODM A;  1FKD A;  3B9D A;  5HWB A;  1UR9 A;  3ARX A;  3ARO A;  4A0T A;  1LJY A;  1O6I A;  2M1I A;  4DWS B;  1M5Y A;  2ZQT A;  2MDI A;  1H0I A;  1XRV A;  2XP7 A;  3ART A;  4JFJ A;  4A0U A;  2PN0 A;  2QF8 A;  2M8J A;  2RUD A;  3WQW A;  4Z2J A;  3UQA A;  2PPP A;  1LL6 A;  3I6C A;  3GTY X;  2XP8 A;  2AOS A;  4PTM A;  2RE3 A;  5HW6 A;  1HJW A;  2L4J A;  4NNR A;  1E6P A;  2XP5 A;  4JYS A;  3LKX B;  1C9H A;  3WD1 A;  1JND A;  1NMV A;  4ODL A;  4MNM A;  3ARP A;  4HBO A;  2LAJ A;  1QZ2 A;  2BA1 A;  5DIU A;  1LG1 A;  1D7J A;  3LE4 A;  1D7I A;  4MNK A;  1BKF A;  2DG4 A;  4Z2H A;  3B9E A;  3IK8 A;  4TYO A;  4P8U A;  4HAR A;  3GPK A;  1ZBC A;  4TW7 A;  4LGX A;  3AS2 A;  4S3K A;  5HKG A;  2OFN A;  3TCZ A;  1JVW A;  2DT1 A;  4QIB A;  2K8I A;  3LUO A;  2DSZ A;  3ALF A;  1X6L A;  1K9Q A;  3CZ8 A;  2A3B A;  1W1P A;  1W1T A;  1NWT A;  1FKJ A;  2DPE A;  3AS3 A;  4JFL A;  1L1P A;  4LAW A;  1NH6 A;  4KR0 B;  3OA5 A;  5E66 A;  4G2P A;  4DWS D;  5E62 A;  3MQG A;  4MNJ A;  2G8Z A;  3MCB B;  3H9R B;  4ZPW R;  3O5G A;  3MQH A;  1E6R A;  2DMV A;  1Y0O A;  1ZB5 A;  3O5E A;  3RM4 A;  1ZBW A;  5E64 A;  2FAP A;  4Z2L A;  1EG3 A;  1FKR A;  2WLZ A;  4P8V A;  4TX0 A;  2RUC A;  1E9L A;  3TDB A;  3O5J A;  2OLH A;  3O5R A;  1WR7 A;  2MNT A;  2XP4 A;  4ODO A;  4DWS A;  1FKG A;  2YSG A;  1LL4 A;  5HWC A;  2JXW A;  4TNS A;  2YSI A;  4NZC A;  3IKG A;  2KFW A;  1Q1C A;  1NWR A;  1GPF A;  1EHN A;  3GU0 A;  1ZU8 A;  4ODK A;  1GOI A;  4IQ2 A;  1E15 A;  2RSE A;  4AY1 A;  1OGB A;  3LKX A;  2YAJ B;  3M85 A;  4KQZ A;  4Q7N A;  3RM9 A;  3VAW A;  3NRK A;  4GGQ A;  5GQB A;  1FKB A;  3CHC A;  5DIV A;  3BXW A;  1ZBV A;  5BXJ A;  3UI5 A;  3KAF A;  3ARQ A;  2ZR5 A;  3O5P A;  4IT6 A;  4GIV A;  3WH0 A;  3KAG A;  4ITZ A;  1JMQ A;  2WLY A;  1YAT A;  2Y78 A;  3G6M A;  5GPR A;  1EDQ A;  4HBE A;  2IUZ A;  2LGO A;  4U84 A;  1EIB A;  5DIT A;  4ZS6 A;  1J4R A;  2PV1 A;  4DRN A;  2DWV A;  2QRV A;  1TR8 A;  3KCE A;  4J4N A;  2M08 A;  1ZL1 A;  2MPH A;  1KT0 A;  3AQU A;  3ARV A;  1FKI A;  1WAW A;  1RP5 A;  3MCB A;  1LG2 A;  2MF9 A;  2RUQ A;  3WKZ A;  2LPV A;  3PRB A;  4DRO A;  3ARR A;  3FY1 A;  2EZ5 W;  2WK2 A;  1FD9 A;  4ZPV R;  2DT0 A;  3ARU A;  3EIP A;  5HTG A;  4MGV A;  4DWS C;  1OGG A;  1E44 A;  1J6Y A;  1HKM A;  1TCO C;  1ZCN A;  4IQC A;  3O5K A;  1LL7 A;  4FAP A;  3WL0 A;  2DJY A;  3CGN A;  4FN2 A;  4DRM A;  1Q6I A;  2Y8N B;  1Q6H A;  4Z2I A;  4JFI A;  1IX5 A;  4WKA A;  3ARS A;  2M3O W;  3M7N A;  1FFQ A;  3CNG A;  1SR0 A;  1HKJ A;  3WD2 A;  2XPB A;  5HBF A;  4DH0 A;  2ZQS A;  3PR9 A;  2JV4 A;  3FSC A;  1UR8 A;  3JYM A;  4IT4 A;  4W9P A;  2XPA A;  3OOB A;  1J4I A;  1PIN A;  1EG4 A;  5DEZ A;  1E6Z A;  3PA7 A;  3ODK A;  4UDM A;  4NSB A;  3WQV A;  3CHE A;  3UF8 A;  1FKL A;  1I5H W;  4ZPT R;  4DZ2 A;  3IKD A;  4MAV A;  5U47 A;  1FFR A;  1NSG A;  4WKH A;  4N19 A;  5HT1 A;  3PRA A;  4XAK A;  3IHZ A;  1F8A B;  1HXV A;  2MLY A;  2ESC A;  3WD0 A;  3RME A;  3NI6 A;  3ARW A;  2F2D A;  3RGC A;  2A3C A;  2ZAJ A;  4QT3 A;  1J4H A;  2L2S A;  1JNT A;  3W4R A;  1FKF A;  4WKF A;  2A3A A;  2XP3 A;  2PI6 A;  4R0X A;  2DSV A;  2O92 A;  1T11 A;  4LAY A;  2FKE A;  4WJX A;  2JMF A;  2VCD A;  1TK7 A;  1W9P A;  3KAI A;  4DRI A;  3O5D A;  1BL4 A;  4ODR A;  4C02 B;  4ODQ A;  4R5E A;  2M8I A;  3WD3 A;  2RUR A;  2ETN A;  4Q22 A;  3ARY A;  4DT4 A;  1W26 A;  1K9R A;  1EQ3 A;  2G41 A;  2IF4 A;  3L4H A;  3CGM A;  1X6N A;  5D75 A;  4JFK A;  3B8S A;  5CQ2 A;  1R9H A;  4W9Q A;  4O2T A;  3O5L A;  4W5U A;  1WMV A;  1FAP A;  2B5U B;  2ITK A;  2B31 A;  1FJD A;  3BMB A;  3TC5 A;  1WB0 A;  2LKN A;  4Z2K A;  1F40 A;  5J6E A;  4W9O A;  1U79 A;  5AHT A;  1XHG A;  3WL1 A;  4JFM A;  4GLX A;  2UZ5 A;  1HKK A;  2WM0 A;  1VF8 A;  2N87 A;  1FKH A;  1FKK A;  2DK7 A;  1D6O A;  4P8W A;  3G6L A;  4IPX A;  5I98 A;  2KO7 A;  1GRJ A;  2MLZ A;  1Q6U A;  1ROU A;  1W9U A;  3CH9 A;  2F21 A;  2YBU A;  4URI A;  2E45 A;  4ODP A;  4TW8 A;  4QZV B;  1N1A A;  3ARZ A;  3O5F A;  2YSF A;  1D2K A;  1NWS A;  1E6N A;  3CHD A;  2YBT A;  1K9T A;  5HW7 A;  3CHF A;  4Z2G A;  4J4O A;  2DG3 A;  1OWQ A;  1FKS A;  1B6C A;  4G50 A;  2DSU A;  1JNS A;  1P5Q A;  3AS1 A;  1KFW A;  2YSH A;  4TW6 A;  3NTP A;  3UQB A;  4WK9 A;  2WAD A;  2LJ4 A;  4MNL A;  1ZK6 A;  2PPO A;  3UI6 A;  3EY6 A;  5E5W A;  2KR7 A;  4MTV A;  2YSB A;  4ODN A;  1HJX A;  3O5I A;  1FKT A;  4QT2 A;  3O5Q A;  1H0G A;  2DSW A;  1W1Y A;  2KE0 A;  3PQH A;  1EYM A;  3JXV A;  2F4E A;  1NMW A;  1NWU A;  2DK1 A;  5B8I C;  2KGJ A;  2DT3 A;  4L72 B;  4BF8 A;  2WAE A;  2OWO A;  4DRP A;  4DZ3 A;  1QPF A;  2MLX A;  1FLC A; 
#chains in the Genus database with same CATH homology
 1ITX A;  5JH8 A;  2VN1 A;  2A3E A;  1KT1 A;  2O9O A;  2M2A A;  1RD6 A;  1D7H A;  2ZR6 A;  3KAH A;  3ALG A;  2DG9 A;  3JYJ A;  2JZV A;  4ML4 A;  1ZBK A;  2Q5A A;  3B9A A;  4DRK A;  1O6W A;  2ZQU A;  2KI3 A;  2XP6 A;  3FAP A;  3RFW A;  2ZR4 A;  2PV3 A;  3O5O A;  4P8X A;  1W1V A;  4WIW A;  1GUV A;  4DIP A;  2DT2 A;  4MPK A;  4MSP A;  5HW8 A;  2D9F A;  4REX A;  3PRD A;  2JX8 A;  4DRJ A;  4E5R A;  1JNE A;  1SYT A;  3KAD A;  2RQS A;  2FDM A;  4U86 A;  2AWG A;  2PV2 A;  3UI4 A;  3UQI A;  3FS8 A;  3FXY A;  3RM8 A;  3O5M A;  3KZ7 A;  1LQ0 A;  3WD4 A;  2KXQ A;  5DF0 A;  1PBK A;  4L3N A;  2PBC A;  5GPG A;  3MDY B;  4S3J A;  5E65 A;  2XP9 A;  2PPN A;  1W9V A;  4LAX A;  1HKI A;  1ROT A;  3KAC A;  3FSB A;  3QOK A;  1CTN A;  1HJV A;  3WIJ A;  1YW5 A;  3KAB A;  1A7X A;  4DRH A;  3B7X A;  1TFV A;  5DO2 A;  2ZQV A;  3AS0 A;  5HUA A;  4U85 A;  1WNO A;  4DRQ A;  1QPL A;  4LAV A;  4ODM A;  1FKD A;  3B9D A;  5HWB A;  1UR9 A;  3ARX A;  3ARO A;  4A0T A;  1LJY A;  1O6I A;  2M1I A;  4DWS B;  1M5Y A;  2ZQT A;  2MDI A;  1H0I A;  1XRV A;  2XP7 A;  3ART A;  4JFJ A;  4A0U A;  2QF8 A;  2M8J A;  2RUD A;  3WQW A;  4Z2J A;  3UQA A;  2PPP A;  1LL6 A;  3I6C A;  2XP8 A;  2AOS A;  4PTM A;  2RE3 A;  5HW6 A;  1HJW A;  2L4J A;  4NNR A;  1E6P A;  2XP5 A;  4JYS A;  3LKX B;  1C9H A;  3WD1 A;  1JND A;  1NMV A;  4ODL A;  4MNM A;  3ARP A;  4HBO A;  2LAJ A;  1QZ2 A;  2BA1 A;  5DIU A;  1LG1 A;  1D7J A;  3LE4 A;  1D7I A;  4MNK A;  1BKF A;  2DG4 A;  4Z2H A;  3B9E A;  3IK8 A;  4TYO A;  4P8U A;  4HAR A;  3GPK A;  1ZBC A;  4TW7 A;  4LGX A;  3AS2 A;  4S3K A;  5HKG A;  2OFN A;  3TCZ A;  1JVW A;  2DT1 A;  4QIB A;  2K8I A;  3LUO A;  2DSZ A;  3ALF A;  1X6L A;  1K9Q A;  3CZ8 A;  2A3B A;  1W1P A;  1W1T A;  1NWT A;  1FKJ A;  2DPE A;  3AS3 A;  4JFL A;  1L1P A;  4LAW A;  1NH6 A;  4KR0 B;  3OA5 A;  5E66 A;  4G2P A;  4DWS D;  5E62 A;  3MQG A;  4MNJ A;  2G8Z A;  3MCB B;  3H9R B;  4ZPW R;  3O5G A;  3MQH A;  1E6R A;  2DMV A;  1Y0O A;  1ZB5 A;  3O5E A;  3RM4 A;  1ZBW A;  5E64 A;  2FAP A;  4Z2L A;  1EG3 A;  1FKR A;  2WLZ A;  4P8V A;  4TX0 A;  2RUC A;  1E9L A;  3TDB A;  3O5J A;  2OLH A;  3O5R A;  1WR7 A;  2MNT A;  2XP4 A;  4ODO A;  4DWS A;  1FKG A;  2YSG A;  1LL4 A;  5HWC A;  2JXW A;  4TNS A;  2YSI A;  4NZC A;  3IKG A;  2KFW A;  1Q1C A;  1NWR A;  1GPF A;  1EHN A;  1ZU8 A;  4ODK A;  1GOI A;  4IQ2 A;  1E15 A;  2RSE A;  4AY1 A;  1OGB A;  3LKX A;  2YAJ B;  3M85 A;  4KQZ A;  4Q7N A;  3RM9 A;  3VAW A;  3NRK A;  4GGQ A;  5GQB A;  1FKB A;  3CHC A;  5DIV A;  3BXW A;  1ZBV A;  5BXJ A;  3UI5 A;  3KAF A;  3ARQ A;  2ZR5 A;  3O5P A;  4IT6 A;  4GIV A;  3WH0 A;  3KAG A;  4ITZ A;  1JMQ A;  2WLY A;  1YAT A;  2Y78 A;  3G6M A;  5GPR A;  1EDQ A;  4HBE A;  2IUZ A;  2LGO A;  4U84 A;  1EIB A;  5DIT A;  4ZS6 A;  1J4R A;  2PV1 A;  4DRN A;  2DWV A;  2QRV A;  1TR8 A;  3KCE A;  4J4N A;  2M08 A;  1ZL1 A;  2MPH A;  1KT0 A;  3AQU A;  3ARV A;  1FKI A;  1WAW A;  1RP5 A;  3MCB A;  1LG2 A;  2MF9 A;  2RUQ A;  3WKZ A;  2LPV A;  3PRB A;  4DRO A;  3ARR A;  3FY1 A;  2EZ5 W;  2WK2 A;  1FD9 A;  4ZPV R;  2DT0 A;  3ARU A;  5HTG A;  4MGV A;  4DWS C;  1OGG A;  1J6Y A;  1HKM A;  1TCO C;  1ZCN A;  4IQC A;  3O5K A;  1LL7 A;  4FAP A;  3WL0 A;  2DJY A;  3CGN A;  4FN2 A;  4DRM A;  1Q6I A;  2Y8N B;  1Q6H A;  4Z2I A;  4JFI A;  1IX5 A;  4WKA A;  3ARS A;  2M3O W;  3M7N A;  1FFQ A;  3CNG A;  1SR0 A;  1HKJ A;  3WD2 A;  2XPB A;  5HBF A;  4DH0 A;  2ZQS A;  3PR9 A;  2JV4 A;  3FSC A;  1UR8 A;  3JYM A;  4IT4 A;  4W9P A;  2XPA A;  3OOB A;  1J4I A;  1PIN A;  1EG4 A;  5DEZ A;  1E6Z A;  3PA7 A;  3ODK A;  4NSB A;  3WQV A;  3CHE A;  3UF8 A;  1FKL A;  1I5H W;  4ZPT R;  4DZ2 A;  3IKD A;  4MAV A;  5U47 A;  1FFR A;  1NSG A;  4WKH A;  4N19 A;  5HT1 A;  3PRA A;  4XAK A;  3IHZ A;  1F8A B;  1HXV A;  2MLY A;  2ESC A;  3WD0 A;  3RME A;  3NI6 A;  3ARW A;  2F2D A;  3RGC A;  2A3C A;  2ZAJ A;  4QT3 A;  1J4H A;  2L2S A;  1JNT A;  3W4R A;  1FKF A;  4WKF A;  2A3A A;  2XP3 A;  2PI6 A;  4R0X A;  2DSV A;  2O92 A;  1T11 A;  4LAY A;  2FKE A;  4WJX A;  2JMF A;  2VCD A;  1TK7 A;  1W9P A;  3KAI A;  4DRI A;  3O5D A;  1BL4 A;  4ODR A;  4C02 B;  4ODQ A;  4R5E A;  2M8I A;  3WD3 A;  2RUR A;  4Q22 A;  3ARY A;  4DT4 A;  1W26 A;  1K9R A;  1EQ3 A;  2G41 A;  2IF4 A;  3L4H A;  3CGM A;  1X6N A;  5D75 A;  4JFK A;  3B8S A;  5CQ2 A;  1R9H A;  4W9Q A;  4O2T A;  3O5L A;  4W5U A;  1WMV A;  1FAP A;  2ITK A;  2B31 A;  1FJD A;  3TC5 A;  1WB0 A;  2LKN A;  4Z2K A;  1F40 A;  5J6E A;  4W9O A;  1U79 A;  5AHT A;  1XHG A;  3WL1 A;  4JFM A;  4GLX A;  2UZ5 A;  1HKK A;  2WM0 A;  1VF8 A;  2N87 A;  1FKH A;  1FKK A;  2DK7 A;  1D6O A;  4P8W A;  3G6L A;  4IPX A;  5I98 A;  2KO7 A;  2MLZ A;  1Q6U A;  1ROU A;  1W9U A;  3CH9 A;  2F21 A;  2YBU A;  4URI A;  2E45 A;  4ODP A;  4TW8 A;  4QZV B;  1N1A A;  3ARZ A;  3O5F A;  2YSF A;  1D2K A;  1NWS A;  1E6N A;  3CHD A;  2YBT A;  1K9T A;  5HW7 A;  3CHF A;  4Z2G A;  4J4O A;  2DG3 A;  1OWQ A;  1FKS A;  1B6C A;  4G50 A;  2DSU A;  1JNS A;  1P5Q A;  3AS1 A;  1KFW A;  2YSH A;  4TW6 A;  3NTP A;  3UQB A;  4WK9 A;  2WAD A;  2LJ4 A;  4MNL A;  1ZK6 A;  2PPO A;  3UI6 A;  3EY6 A;  5E5W A;  2KR7 A;  4MTV A;  2YSB A;  4ODN A;  1HJX A;  3O5I A;  1FKT A;  4QT2 A;  3O5Q A;  1H0G A;  2DSW A;  1W1Y A;  2KE0 A;  3PQH A;  1EYM A;  3JXV A;  2F4E A;  1NMW A;  1NWU A;  2DK1 A;  5B8I C;  2KGJ A;  2DT3 A;  4L72 B;  4BF8 A;  2WAE A;  2OWO A;  4DRP A;  4DZ3 A;  1QPF A;  2MLX A;  1FLC A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...