1ZCNA

Human pin1 ng mutant
Total Genus 47
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
47
sequence length
155
structure length
143
Chain Sequence
LPPGWEKRMSNGRVYYFNHITNASQWERPSEPARVRCSHLLVKHSQSRRPSSWRQEKITRTKEEALELINGYIQKIKSGEEDFESLASQFSDCSSAKARGDLGAFSRGQMQKPFEDASFALRTGEMSGPVFTDSGIHIILRTE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Peptidyl-prolyl cis-trans isomerase NIMA-interacting 1
publication title Structure-function-folding relationship in a WW domain.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Isomerase
total genus 47
structure length 143
sequence length 155
ec nomenclature ec 5.2.1.8: Peptidylprolyl isomerase.
pdb deposition date 2005-04-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00397 WW WW domain
A PF00639 Rotamase PPIC-type PPIASE domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.20.70.10 Mainly Beta Single Sheet Ubiquitin Ligase Nedd4; Chain: W; Ubiquitin Ligase Nedd4; Chain: W; 1zcnA01
3.10.50.40 Alpha Beta Roll Chitinase A; domain 3 Chitinase A; domain 3 1zcnA02
2DK1A 3O5DA 2AWGA 3PRBA 2YSBA 2XP8A 4E5RA 4JYSA 5B8IC 2IF4A 3IK8A 1FKJA 1W26A 1FKRA 1M5YA 3JXVA 3KABA 3CGNA 1JMQA 4ODRA 3IHZA 3NI6A 2ZQSA 4JFLA 3IKDA 2VN1A 4ODLA 3UQBA 2RQSA 4LAXA 2MNTA 3NTPA 2LJ4A 5J6EA 3ODKA 2XP4A 2XP9A 1JNTA 4U84A 4ODOA 1ROTA 3KZ7A 5HUAA 3TCZA 1FKIA 2DK7A 2PV3A 2DG4A 1QPLA 2ZR4A 1ZK6A 5HWCA 4JFIA 1J6YA 4DZ2A 4JFMA 2M8IA 4TX0A 1EG3A 1WR7A 3KAHA 1Q6IA 5HTGA 1J4RA 4DRHA 2LGOA 2MLZA 2MLXA 3CNGA 1FKSA 1YW5A 3KACA 3FAPA 1FKGA 4IQCA 1R9HA 2KR7A 3MDYB 4MGVA 4QT3A 2YSFA 2F21A 3O5FA 1PINA 3KADA 4DRQA 4TW8A 3UI4A 2UZ5A 2XP3A 2PV1A 3PRDA 1NSGA 4BF8A 4DZ3A 2M08A 2ZR5A 3EY6A 1FAPA 3O5QA 1YATA 2FKEA 2PBCA 1Q6HA 1A7XA 2KI3A 1TCOC 1ZCNA 5HW7A 1Q6UA 4JFJA 3O5PA 2DG3A 3O5JA 3UI5A 4ODMA 1WMVA 5CQ2A 2MPHA 2BA1A 4NNRA 4TYOA 5I98A 2LAJA 2M8JA 2MLYA 1FKLA 2OFNA 4DRMA 3KCEA 4G50A 4FN2A 2KFWA 1FKHA 4DRJA 3O5KA 3GPKA 2Q5AA 2RURA 3NRKA 4ODKA 1P5QA 3VAWA 1FKBA 1FKTA 4LAWA 1JVWA 4W9PA 3TC5A 2YSHA 2DJYA 1QZ2A 2F4EA 2RUQA 3OOBA 2KGJA 4N19A 2YSIA 5BXJA 2XP7A 4DIPA 2PPNA 4LAYA 4LAVA 4IQ2A 4DT4A 3O5MA 2XP6A 4QIBA 2F2DA 3KAFA 4ODNA 2MDIA 1O6WA 5DIUA 3KAGA 3B7XA 1N1AA 4MSPA 1FKFA 1JNSA 2RUCA 2M1IA 5HW6A 2YSGA 4R0XA 2JX8A 1KT0A 5DITA 2ZR6A 3LE4A 2KO7A 3JYMA 1K9QA 5DIVA 3O5RA 1QPFA 2RE3A 3M7NA 4GIVA 3O5OA 4J4NA 3M85A 3UI6A 1FJDA 2VCDA 2M3OW 2ZQVA 4ODPA 2XPBA 2ZQUA 1FKKA 3CGMA 2JMFA 4DH0A 4ITZA 4DROA 1K9RA 2E45A 4ODQA 1NMWA 4TW7A 3WH0A 2DMVA 4JFKA 1EG4A 1D6OA 3L4HA 2LPVA 2RSEA 1C9HA 2FAPA 2KE0A 2RUDA 4DRKA 1NMVA 2ZAJA 4DRPA 2D9FA 2JXWA 5GPGA 1EQ3A 2XP5A 3LUOA 2N87A 1F40A 2JZVA 1BKFA 1TK7A 5AHTA 1FD9A 1D7HA 5HWBA 2DG9A 3O5IA 1D7JA 3UQAA 2PPPA 4FAPA 5D75A 2PV2A 3JYJA 5HT1A 4QT2A 3PA7A 1HXVA 2JV4A 1PBKA 4C02B 1Q1CA 2L2SA 3O5LA 3H9RB 2M2AA 1L1PA 2KXQA 3UQIA 3O5EA 1BL4A 5HW8A 4U86A 4TNSA 2MF9A 4J4OA 3IKGA 1J4HA 4W9QA 1I5HW 1U79A 2PPOA 4IPXA 1T11A 1J4IA 5HKGA 1EYMA 1ROUA 2XPAA 2EZ5W 2L4JA 2ITKA 3I6CA 3RFWA 2LKNA 2ZQTA 1F8AB 2Y78A 4U85A 4DRIA 3RGCA 4G2PA 4GGQA 4O2TA 1D7IA 3TDBA 1KT1A 4W9OA 4TW6A 4REXA 3KAIA 1FKDA 2K8IA 3O5GA 4DRNA 1Y0OA 3UF8A 2DWVA 1B6CA
chains in the Genus database with same CATH superfamily
2DK1A 3B9DA 3O5DA 2AWGA 3PRBA 1HKMA 2YSBA 4S3JA 1W1VA 1W9VA 2XP8A 4E5RA 4JYSA 4NSBA 5GQBA 5B8IC 2IF4A 3IK8A 3QOKA 1FKJA 1W26A 1FKRA 1M5YA 3JXVA 3KABA 3CGNA 1JMQA 5JH8A 4ODRA 3IHZA 3MCBB 1O6IA 1W9PA 3NI6A 2ZQSA 4HARA 4JFLA 3IKDA 2VN1A 2YBUA 4ODLA 3UQBA 1WB0A 2RQSA 4LAXA 3ARTA 1H0IA 2MNTA 3NTPA 1E15A 2LJ4A 5J6EA 1EDQA 3LKXA 3ODKA 1LL6A 2XP4A 2ESCA 2XP9A 1JNTA 4AY1A 4L72B 1JNDA 4U84A 4Z2JA 1ZBVA 4ODOA 1ROTA 3KZ7A 4ML4A 5HUAA 1LL7A 3ALGA 3TCZA 1OWQA 1FKIA 2DK7A 2PV3A 5DEZA 2DG4A 3AS2A 1QPLA 2ZR4A 2A3EA 3ARQA 1ZK6A 5HWCA 3ARUA 2DSUA 4JFIA 2ETNA 3BXWA 2WADA 1J6YA 4DZ2A 4JFMA 2M8IA 4TX0A 1EG3A 3BMBA 1JCHB 1WR7A 4P8WA 4KQZA 3KAHA 1Q6IA 5HTGA 1SR0A 1J4RA 2YAJB 4R5EA 4DRHA 1LL4A 2LGOA 2MLZA 2MLXA 1GPFA 2A3BA 4P8VA 3CNGA 4Q7NA 1FKSA 1YW5A 4WIWA 3KACA 3CHDA 3FAPA 1FKGA 4IQCA 1R9HA 2KR7A 3ARVA 3MDYB 4HBEA 4MGVA 4WKFA 2IUZA 4QT3A 2YSFA 2F21A 2B31A 2O9OA 3O5FA 1PINA 3KADA 4DRQA 4TW8A 3UI4A 2UZ5A 1WAWA 3ARWA 2XP3A 2PV1A 3PRDA 1NSGA 4BF8A 4DZ3A 1FLCA 2M08A 5E64A 2ZR5A 3EY6A 1FAPA 2OWOA 4P8XA 3O5QA 2DSVA 1YATA 2FKEA 1RD6A 2PBCA 1Q6HA 3AQUA 1A7XA 4L3NA 4IT4A 2KI3A 1TCOC 5HBFA 1GOIA 1ZCNA 5E66A 5HW7A 1Q6UA 4JFJA 3O5PA 3PR9A 1W9UA 2DG3A 3O5JA 3UI5A 4WKHA 4ODMA 1WMVA 5CQ2A 2MPHA 2BA1A 1UR9A 1HJXA 4NNRA 4DWSC 4ZS6A 4ZPTR 4MTVA 4TYOA 5I98A 2B5UB 2LAJA 2M8JA 4PTMA 1XRVA 2F23A 3G6LA 2MLYA 2YBTA 1FKLA 2OFNA 4DRMA 2Y8NB 1X6NA 3KCEA 4Z2IA 1OGBA 2DT1A 4G50A 4HBOA 4FN2A 2KFWA 1FKHA 2A3CA 1HKJA 4DRJA 1NWTA 3LKXB 3O5KA 3GPKA 3CHCA 2Q5AA 2OLHA 1X6LA 3CH9A 1H0GA 2RURA 2WM0A 4Z2KA 3RM8A 3W4RA 3NRKA 3PQHA 1SYTA 1FFQA 4ODKA 3GU0A 1P5QA 1E6ZA 1OGGA 3FXYA 3VAWA 1FKBA 1FKTA 4LAWA 1JVWA 4W9PA 2O92A 2WAEA 1ZB5A 3TC5A 2YSHA 2DJYA 1E9LA 1QZ2A 2F4EA 1D2KA 2RUQA 3OOBA 1E6RA 2AOSA 2KGJA 4N19A 2YSIA 5BXJA 1GRJA 1ZBKA 1EHNA 3GTYX 2XP7A 1NWUA 4Q22A 4DIPA 2PPNA 4LAYA 1ZU8A 1ITXA 4LAVA 5DO2A 4IQ2A 4GLXA 4DT4A 3O5MA 2XP6A 4QIBA 2F2DA 3KAFA 1E6NA 4ODNA 2MDIA 2DSZA 1W1TA 1O6WA 5DIUA 2DT3A 1WNOA 2PI6A 4P8UA 3KAGA 3WD1A 3B7XA 1N1AA 2A3AA 4MSPA 3ARXA 1FKFA 3OA5A 1JNSA 2DPEA 2RUCA 2M1IA 5HW6A 2YSGA 3RMEA 4R0XA 3WD3A 4XAKA 4WJXA 4Z2HA 2JX8A 5DF0A 1KT0A 5DITA 2ZR6A 3LE4A 2KO7A 3JYMA 1K9QA 5DIVA 1XHGA 3O5RA 1QPFA 3WD0A 2RE3A 4MNKA 3M7NA 3B9AA 4GIVA 3O5OA 4J4NA 3M85A 3UI6A 1LJYA 3G6MA 1FJDA 2VCDA 2M3OW 4LGXA 2ZQVA 2P4VA 4ODPA 2FDMA 2XPBA 3EIPA 2ZQUA 1FKKA 3CGMA 2JMFA 3ARYA 4DH0A 4IT6A 1W1PA 2DT2A 4ITZA 3B8SA 3WQVA 4DROA 1EIBA 1K9RA 2E45A 4ODQA 1LG1A 1LQ0A 3ALFA 1NMWA 4TW7A 4MPKA 3WH0A 3WIJA 2DMVA 1HJWA 4JFKA 1EG4A 1KFWA 1D6OA 2WLZA 3L4HA 2LPVA 4NZCA 2RSEA 1JNEA 1C9HA 3CZ8A 1VF8A 3WL0A 2FAPA 2KE0A 2RUDA 4DRKA 1RP5A 1NMVA 3MQGA 2ZAJA 1NWSA 4A0UA 3AS1A 1TR8A 4DRPA 2D9FA 2JXWA 3RM9A 5GPGA 1EQ3A 4WK9A 4MNJA 2XP5A 3LUOA 2N87A 1F40A 2JZVA 1BKFA 1TK7A 1TFVA 5AHTA 2QF8A 3ARZA 1FD9A 1D7HA 3RM4A 5HWBA 2DG9A 3O5IA 3MQHA 1D7JA 1K9TA 4Z2GA 3UQAA 2PPPA 4FAPA 5D75A 3ARRA 1ZBWA 2PV2A 3JYJA 4DWSD 4QZVB 3MCBA 1HKKA 3AS3A 4MNLA 2DSWA 5HT1A 4QT2A 2EULA 3PA7A 1NWRA 1HXVA 4WKAA 2JV4A 3AROA 4W5UA 1ZL1A 1PBKA 3ARPA 3FY1A 2G8ZA 4C02B 1Q1CA 2L2SA 4KR0B 3O5LA 3H9RB 1IX5A 2M2AA 3WKZA 1L1PA 3FSBA 2KXQA 1NH6A 3UQIA 3O5EA 1BL4A 5HW8A 4U86A 4TNSA 2MF9A 4J4OA 3IKGA 1LG2A 1J4HA 3B9EA 5E5WA 4W9QA 1I5HW 1U79A 2PPOA 1HKIA 3FSCA 4IPXA 3WL1A 1T11A 1J4IA 4DWSB 1W1YA 1E6PA 1UR8A 5HKGA 1EYMA 3ARSA 1ROUA 2XPAA 2EZ5W 4DWSA 2L4JA 1CTNA 2WK2A 4MAVA 1ZBCA 4URIA 2ITKA 3I6CA 3CHEA 4ZPWR 3RFWA 3WD4A 5E65A 2LKNA 2ZQTA 5GPRA 4ZPVR 1HJVA 3AS0A 4MNMA 1F8AB 2QRVA 2Y78A 3WD2A 3CHFA 3WQWA 4U85A 4DRIA 2PN0A 3RGCA 2DT0A 5E62A 4G2PA 4S3KA 4GGQA 4O2TA 4UDMA 1D7IA 3TDBA 1KT1A 4W9OA 3FS8A 4REXA 3KAIA 4TW6A 1FKDA 2K8IA 5U47A 3O5GA 1FFRA 2WLYA 4DRNA 4Z2LA 2G41A 1E44A 1Y0OA 3UF8A 2DWVA 4A0TA 1GUVA 3PRAA 1B6CA
chains in the Genus database with same CATH topology
2DK1A 3B9DA 3O5DA 2AWGA 3PRBA 1HKMA 2YSBA 4S3JA 1W1VA 1W9VA 2XP8A 4E5RA 4JYSA 4NSBA 5GQBA 5B8IC 2IF4A 3IK8A 3QOKA 1FKJA 1W26A 1FKRA 1M5YA 3JXVA 3KABA 3CGNA 1JMQA 5JH8A 4ODRA 3IHZA 3MCBB 1O6IA 1W9PA 3NI6A 2ZQSA 4HARA 4JFLA 3IKDA 2VN1A 2YBUA 4ODLA 3UQBA 1WB0A 2RQSA 4LAXA 3ARTA 1H0IA 2MNTA 3NTPA 1E15A 2LJ4A 5J6EA 1EDQA 3LKXA 3ODKA 1LL6A 2XP4A 2ESCA 2XP9A 1JNTA 4AY1A 4L72B 1JNDA 4U84A 4Z2JA 1ZBVA 4ODOA 1ROTA 3KZ7A 4ML4A 5HUAA 1LL7A 3ALGA 3TCZA 1OWQA 1FKIA 2DK7A 2PV3A 5DEZA 2DG4A 3AS2A 1QPLA 2ZR4A 2A3EA 3ARQA 1ZK6A 5HWCA 3ARUA 2DSUA 4JFIA 3BXWA 2WADA 1J6YA 4DZ2A 4JFMA 2M8IA 4TX0A 1EG3A 1WR7A 4P8WA 4KQZA 3KAHA 1Q6IA 5HTGA 1SR0A 1J4RA 2YAJB 4R5EA 4DRHA 1LL4A 2LGOA 2MLZA 2MLXA 1GPFA 2A3BA 4P8VA 3CNGA 4Q7NA 1FKSA 1YW5A 4WIWA 3KACA 3CHDA 3FAPA 1FKGA 4IQCA 1R9HA 2KR7A 3ARVA 3MDYB 4HBEA 4MGVA 4WKFA 2IUZA 4QT3A 2YSFA 2F21A 2B31A 2O9OA 3O5FA 1PINA 3KADA 4DRQA 4TW8A 3UI4A 2UZ5A 1WAWA 3ARWA 2XP3A 2PV1A 3PRDA 1NSGA 4BF8A 4DZ3A 1FLCA 2M08A 5E64A 2ZR5A 3EY6A 1FAPA 2OWOA 4P8XA 3O5QA 2DSVA 1YATA 2FKEA 1RD6A 2PBCA 1Q6HA 3AQUA 1A7XA 4L3NA 4IT4A 2KI3A 1TCOC 5HBFA 1GOIA 1ZCNA 5E66A 5HW7A 1Q6UA 4JFJA 3O5PA 3PR9A 1W9UA 2DG3A 3O5JA 3UI5A 4WKHA 4ODMA 1WMVA 5CQ2A 2MPHA 2BA1A 1UR9A 1HJXA 4NNRA 4DWSC 4ZS6A 4ZPTR 4MTVA 4TYOA 5I98A 2LAJA 2M8JA 4PTMA 1XRVA 3G6LA 2MLYA 2YBTA 1FKLA 2OFNA 4DRMA 2Y8NB 1X6NA 3KCEA 4Z2IA 1OGBA 2DT1A 4G50A 4HBOA 4FN2A 2KFWA 1FKHA 2A3CA 1HKJA 4DRJA 1NWTA 3LKXB 3O5KA 3GPKA 3CHCA 2Q5AA 2OLHA 1X6LA 3CH9A 1H0GA 2RURA 2WM0A 4Z2KA 3RM8A 3W4RA 3NRKA 3PQHA 1SYTA 1FFQA 4ODKA 1P5QA 1E6ZA 1OGGA 3FXYA 3VAWA 1FKBA 1FKTA 4LAWA 1JVWA 4W9PA 2O92A 2WAEA 1ZB5A 3TC5A 2YSHA 2DJYA 1E9LA 1QZ2A 2F4EA 1D2KA 2RUQA 3OOBA 1E6RA 2AOSA 2KGJA 4N19A 2YSIA 5BXJA 1ZBKA 1EHNA 2XP7A 1NWUA 4Q22A 4DIPA 2PPNA 4LAYA 1ZU8A 1ITXA 4LAVA 5DO2A 4IQ2A 4GLXA 4DT4A 3O5MA 2XP6A 4QIBA 2F2DA 3KAFA 1E6NA 4ODNA 2MDIA 2DSZA 1W1TA 1O6WA 5DIUA 2DT3A 1WNOA 2PI6A 4P8UA 3KAGA 3WD1A 3B7XA 1N1AA 2A3AA 4MSPA 3ARXA 1FKFA 3OA5A 1JNSA 2DPEA 2RUCA 2M1IA 5HW6A 2YSGA 3RMEA 4R0XA 3WD3A 4XAKA 4WJXA 4Z2HA 2JX8A 5DF0A 1KT0A 5DITA 2ZR6A 3LE4A 2KO7A 3JYMA 1K9QA 5DIVA 1XHGA 3O5RA 1QPFA 3WD0A 2RE3A 4MNKA 3M7NA 3B9AA 4GIVA 3O5OA 4J4NA 3M85A 3UI6A 1LJYA 3G6MA 1FJDA 2VCDA 2M3OW 4LGXA 2ZQVA 4ODPA 2FDMA 2XPBA 2ZQUA 1FKKA 3CGMA 2JMFA 3ARYA 4DH0A 4IT6A 1W1PA 2DT2A 4ITZA 3B8SA 3WQVA 4DROA 1EIBA 1K9RA 2E45A 4ODQA 1LG1A 1LQ0A 3ALFA 1NMWA 4TW7A 4MPKA 3WH0A 3WIJA 2DMVA 1HJWA 4JFKA 1EG4A 1KFWA 1D6OA 2WLZA 3L4HA 2LPVA 4NZCA 2RSEA 1JNEA 1C9HA 3CZ8A 1VF8A 3WL0A 2FAPA 2KE0A 2RUDA 4DRKA 1RP5A 1NMVA 3MQGA 2ZAJA 1NWSA 4A0UA 3AS1A 1TR8A 4DRPA 2D9FA 2JXWA 3RM9A 5GPGA 1EQ3A 4WK9A 4MNJA 2XP5A 3LUOA 2N87A 1F40A 2JZVA 1BKFA 1TK7A 1TFVA 5AHTA 2QF8A 3ARZA 1FD9A 1D7HA 3RM4A 5HWBA 2DG9A 3O5IA 3MQHA 1D7JA 1K9TA 4Z2GA 3UQAA 2PPPA 4FAPA 5D75A 3ARRA 1ZBWA 2PV2A 3JYJA 4DWSD 4QZVB 3MCBA 1HKKA 3AS3A 4MNLA 2DSWA 5HT1A 4QT2A 3PA7A 1NWRA 1HXVA 4WKAA 2JV4A 3AROA 4W5UA 1ZL1A 1PBKA 3ARPA 3FY1A 2G8ZA 4C02B 1Q1CA 2L2SA 4KR0B 3O5LA 3H9RB 1IX5A 2M2AA 3WKZA 1L1PA 3FSBA 2KXQA 1NH6A 3UQIA 3O5EA 1BL4A 5HW8A 4U86A 4TNSA 2MF9A 4J4OA 3IKGA 1LG2A 1J4HA 3B9EA 5E5WA 4W9QA 1I5HW 1U79A 2PPOA 1HKIA 3FSCA 4IPXA 3WL1A 1T11A 1J4IA 4DWSB 1W1YA 1E6PA 1UR8A 5HKGA 1EYMA 3ARSA 1ROUA 2XPAA 2EZ5W 4DWSA 2L4JA 1CTNA 2WK2A 4MAVA 1ZBCA 4URIA 2ITKA 3I6CA 3CHEA 4ZPWR 3RFWA 3WD4A 5E65A 2LKNA 2ZQTA 5GPRA 4ZPVR 1HJVA 3AS0A 4MNMA 1F8AB 2QRVA 2Y78A 3WD2A 3CHFA 3WQWA 4U85A 4DRIA 3RGCA 2DT0A 5E62A 4G2PA 4S3KA 4GGQA 4O2TA 1D7IA 3TDBA 1KT1A 4W9OA 3FS8A 4REXA 3KAIA 4TW6A 1FKDA 2K8IA 5U47A 3O5GA 1FFRA 2WLYA 4DRNA 4Z2LA 2G41A 1Y0OA 3UF8A 2DWVA 4A0TA 1GUVA 3PRAA 1B6CA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2DK1 A;  3O5D A;  2AWG A;  3PRB A;  2YSB A;  2XP8 A;  4E5R A;  4JYS A;  5B8I C;  2IF4 A;  3IK8 A;  1FKJ A;  1W26 A;  1FKR A;  1M5Y A;  3JXV A;  3KAB A;  3CGN A;  1JMQ A;  4ODR A;  3IHZ A;  3NI6 A;  2ZQS A;  4JFL A;  3IKD A;  2VN1 A;  4ODL A;  3UQB A;  2RQS A;  4LAX A;  2MNT A;  3NTP A;  2LJ4 A;  5J6E A;  3ODK A;  2XP4 A;  2XP9 A;  1JNT A;  4U84 A;  4ODO A;  1ROT A;  3KZ7 A;  5HUA A;  3TCZ A;  1FKI A;  2DK7 A;  2PV3 A;  2DG4 A;  1QPL A;  2ZR4 A;  1ZK6 A;  5HWC A;  4JFI A;  1J6Y A;  4DZ2 A;  4JFM A;  2M8I A;  4TX0 A;  1EG3 A;  1WR7 A;  3KAH A;  1Q6I A;  5HTG A;  1J4R A;  4DRH A;  2LGO A;  2MLZ A;  2MLX A;  3CNG A;  1FKS A;  1YW5 A;  3KAC A;  3FAP A;  1FKG A;  4IQC A;  1R9H A;  2KR7 A;  3MDY B;  4MGV A;  4QT3 A;  2YSF A;  2F21 A;  3O5F A;  1PIN A;  3KAD A;  4DRQ A;  4TW8 A;  3UI4 A;  2UZ5 A;  2XP3 A;  2PV1 A;  3PRD A;  1NSG A;  4BF8 A;  4DZ3 A;  2M08 A;  2ZR5 A;  3EY6 A;  1FAP A;  3O5Q A;  1YAT A;  2FKE A;  2PBC A;  1Q6H A;  1A7X A;  2KI3 A;  1TCO C;  1ZCN A;  5HW7 A;  1Q6U A;  4JFJ A;  3O5P A;  2DG3 A;  3O5J A;  3UI5 A;  4ODM A;  1WMV A;  5CQ2 A;  2MPH A;  2BA1 A;  4NNR A;  4TYO A;  5I98 A;  2LAJ A;  2M8J A;  2MLY A;  1FKL A;  2OFN A;  4DRM A;  3KCE A;  4G50 A;  4FN2 A;  2KFW A;  1FKH A;  4DRJ A;  3O5K A;  3GPK A;  2Q5A A;  2RUR A;  3NRK A;  4ODK A;  1P5Q A;  3VAW A;  1FKB A;  1FKT A;  4LAW A;  1JVW A;  4W9P A;  3TC5 A;  2YSH A;  2DJY A;  1QZ2 A;  2F4E A;  2RUQ A;  3OOB A;  2KGJ A;  4N19 A;  2YSI A;  5BXJ A;  2XP7 A;  4DIP A;  2PPN A;  4LAY A;  4LAV A;  4IQ2 A;  4DT4 A;  3O5M A;  2XP6 A;  4QIB A;  2F2D A;  3KAF A;  4ODN A;  2MDI A;  1O6W A;  5DIU A;  3KAG A;  3B7X A;  1N1A A;  4MSP A;  1FKF A;  1JNS A;  2RUC A;  2M1I A;  5HW6 A;  2YSG A;  4R0X A;  2JX8 A;  1KT0 A;  5DIT A;  2ZR6 A;  3LE4 A;  2KO7 A;  3JYM A;  1K9Q A;  5DIV A;  3O5R A;  1QPF A;  2RE3 A;  3M7N A;  4GIV A;  3O5O A;  4J4N A;  3M85 A;  3UI6 A;  1FJD A;  2VCD A;  2M3O W;  2ZQV A;  4ODP A;  2XPB A;  2ZQU A;  1FKK A;  3CGM A;  2JMF A;  4DH0 A;  4ITZ A;  4DRO A;  1K9R A;  2E45 A;  4ODQ A;  1NMW A;  4TW7 A;  3WH0 A;  2DMV A;  4JFK A;  1EG4 A;  1D6O A;  3L4H A;  2LPV A;  2RSE A;  1C9H A;  2FAP A;  2KE0 A;  2RUD A;  4DRK A;  1NMV A;  2ZAJ A;  4DRP A;  2D9F A;  2JXW A;  5GPG A;  1EQ3 A;  2XP5 A;  3LUO A;  2N87 A;  1F40 A;  2JZV A;  1BKF A;  1TK7 A;  5AHT A;  1FD9 A;  1D7H A;  5HWB A;  2DG9 A;  3O5I A;  1D7J A;  3UQA A;  2PPP A;  4FAP A;  5D75 A;  2PV2 A;  3JYJ A;  5HT1 A;  4QT2 A;  3PA7 A;  1HXV A;  2JV4 A;  1PBK A;  4C02 B;  1Q1C A;  2L2S A;  3O5L A;  3H9R B;  2M2A A;  1L1P A;  2KXQ A;  3UQI A;  3O5E A;  1BL4 A;  5HW8 A;  4U86 A;  4TNS A;  2MF9 A;  4J4O A;  3IKG A;  1J4H A;  4W9Q A;  1I5H W;  1U79 A;  2PPO A;  4IPX A;  1T11 A;  1J4I A;  5HKG A;  1EYM A;  1ROU A;  2XPA A;  2EZ5 W;  2L4J A;  2ITK A;  3I6C A;  3RFW A;  2LKN A;  2ZQT A;  1F8A B;  2Y78 A;  4U85 A;  4DRI A;  3RGC A;  4G2P A;  4GGQ A;  4O2T A;  1D7I A;  3TDB A;  1KT1 A;  4W9O A;  4TW6 A;  4REX A;  3KAI A;  1FKD A;  2K8I A;  3O5G A;  4DRN A;  1Y0O A;  3UF8 A;  2DWV A;  1B6C A; 
#chains in the Genus database with same CATH topology
 2DK1 A;  3B9D A;  3O5D A;  2AWG A;  3PRB A;  1HKM A;  2YSB A;  4S3J A;  1W1V A;  1W9V A;  2XP8 A;  4E5R A;  4JYS A;  4NSB A;  5GQB A;  5B8I C;  2IF4 A;  3IK8 A;  3QOK A;  1FKJ A;  1W26 A;  1FKR A;  1M5Y A;  3JXV A;  3KAB A;  3CGN A;  1JMQ A;  5JH8 A;  4ODR A;  3IHZ A;  3MCB B;  1O6I A;  1W9P A;  3NI6 A;  2ZQS A;  4HAR A;  4JFL A;  3IKD A;  2VN1 A;  2YBU A;  4ODL A;  3UQB A;  1WB0 A;  2RQS A;  4LAX A;  3ART A;  1H0I A;  2MNT A;  3NTP A;  1E15 A;  2LJ4 A;  5J6E A;  1EDQ A;  3LKX A;  3ODK A;  1LL6 A;  2XP4 A;  2ESC A;  2XP9 A;  1JNT A;  4AY1 A;  4L72 B;  1JND A;  4U84 A;  4Z2J A;  1ZBV A;  4ODO A;  1ROT A;  3KZ7 A;  4ML4 A;  5HUA A;  1LL7 A;  3ALG A;  3TCZ A;  1OWQ A;  1FKI A;  2DK7 A;  2PV3 A;  5DEZ A;  2DG4 A;  3AS2 A;  1QPL A;  2ZR4 A;  2A3E A;  3ARQ A;  1ZK6 A;  5HWC A;  3ARU A;  2DSU A;  4JFI A;  2ETN A;  3BXW A;  2WAD A;  1J6Y A;  4DZ2 A;  4JFM A;  2M8I A;  4TX0 A;  1EG3 A;  3BMB A;  1JCH B;  1WR7 A;  4P8W A;  4KQZ A;  3KAH A;  1Q6I A;  5HTG A;  1SR0 A;  1J4R A;  2YAJ B;  4R5E A;  4DRH A;  1LL4 A;  2LGO A;  2MLZ A;  2MLX A;  1GPF A;  2A3B A;  4P8V A;  3CNG A;  4Q7N A;  1FKS A;  1YW5 A;  4WIW A;  3KAC A;  3CHD A;  3FAP A;  1FKG A;  4IQC A;  1R9H A;  2KR7 A;  3ARV A;  3MDY B;  4HBE A;  4MGV A;  4WKF A;  2IUZ A;  4QT3 A;  2YSF A;  2F21 A;  2B31 A;  2O9O A;  3O5F A;  1PIN A;  3KAD A;  4DRQ A;  4TW8 A;  3UI4 A;  2UZ5 A;  1WAW A;  3ARW A;  2XP3 A;  2PV1 A;  3PRD A;  1NSG A;  4BF8 A;  4DZ3 A;  1FLC A;  2M08 A;  5E64 A;  2ZR5 A;  3EY6 A;  1FAP A;  2OWO A;  4P8X A;  3O5Q A;  2DSV A;  1YAT A;  2FKE A;  1RD6 A;  2PBC A;  1Q6H A;  3AQU A;  1A7X A;  4L3N A;  4IT4 A;  2KI3 A;  1TCO C;  5HBF A;  1GOI A;  1ZCN A;  5E66 A;  5HW7 A;  1Q6U A;  4JFJ A;  3O5P A;  3PR9 A;  1W9U A;  2DG3 A;  3O5J A;  3UI5 A;  4WKH A;  4ODM A;  1WMV A;  5CQ2 A;  2MPH A;  2BA1 A;  1UR9 A;  1HJX A;  4NNR A;  4DWS C;  4ZS6 A;  4ZPT R;  4MTV A;  4TYO A;  5I98 A;  2B5U B;  2LAJ A;  2M8J A;  4PTM A;  1XRV A;  2F23 A;  3G6L A;  2MLY A;  2YBT A;  1FKL A;  2OFN A;  4DRM A;  2Y8N B;  1X6N A;  3KCE A;  4Z2I A;  1OGB A;  2DT1 A;  4G50 A;  4HBO A;  4FN2 A;  2KFW A;  1FKH A;  2A3C A;  1HKJ A;  4DRJ A;  1NWT A;  3LKX B;  3O5K A;  3GPK A;  3CHC A;  2Q5A A;  2OLH A;  1X6L A;  3CH9 A;  1H0G A;  2RUR A;  2WM0 A;  4Z2K A;  3RM8 A;  3W4R A;  3NRK A;  3PQH A;  1SYT A;  1FFQ A;  4ODK A;  3GU0 A;  1P5Q A;  1E6Z A;  1OGG A;  3FXY A;  3VAW A;  1FKB A;  1FKT A;  4LAW A;  1JVW A;  4W9P A;  2O92 A;  2WAE A;  1ZB5 A;  3TC5 A;  2YSH A;  2DJY A;  1E9L A;  1QZ2 A;  2F4E A;  1D2K A;  2RUQ A;  3OOB A;  1E6R A;  2AOS A;  2KGJ A;  4N19 A;  2YSI A;  5BXJ A;  1GRJ A;  1ZBK A;  1EHN A;  3GTY X;  2XP7 A;  1NWU A;  4Q22 A;  4DIP A;  2PPN A;  4LAY A;  1ZU8 A;  1ITX A;  4LAV A;  5DO2 A;  4IQ2 A;  4GLX A;  4DT4 A;  3O5M A;  2XP6 A;  4QIB A;  2F2D A;  3KAF A;  1E6N A;  4ODN A;  2MDI A;  2DSZ A;  1W1T A;  1O6W A;  5DIU A;  2DT3 A;  1WNO A;  2PI6 A;  4P8U A;  3KAG A;  3WD1 A;  3B7X A;  1N1A A;  2A3A A;  4MSP A;  3ARX A;  1FKF A;  3OA5 A;  1JNS A;  2DPE A;  2RUC A;  2M1I A;  5HW6 A;  2YSG A;  3RME A;  4R0X A;  3WD3 A;  4XAK A;  4WJX A;  4Z2H A;  2JX8 A;  5DF0 A;  1KT0 A;  5DIT A;  2ZR6 A;  3LE4 A;  2KO7 A;  3JYM A;  1K9Q A;  5DIV A;  1XHG A;  3O5R A;  1QPF A;  3WD0 A;  2RE3 A;  4MNK A;  3M7N A;  3B9A A;  4GIV A;  3O5O A;  4J4N A;  3M85 A;  3UI6 A;  1LJY A;  3G6M A;  1FJD A;  2VCD A;  2M3O W;  4LGX A;  2ZQV A;  2P4V A;  4ODP A;  2FDM A;  2XPB A;  3EIP A;  2ZQU A;  1FKK A;  3CGM A;  2JMF A;  3ARY A;  4DH0 A;  4IT6 A;  1W1P A;  2DT2 A;  4ITZ A;  3B8S A;  3WQV A;  4DRO A;  1EIB A;  1K9R A;  2E45 A;  4ODQ A;  1LG1 A;  1LQ0 A;  3ALF A;  1NMW A;  4TW7 A;  4MPK A;  3WH0 A;  3WIJ A;  2DMV A;  1HJW A;  4JFK A;  1EG4 A;  1KFW A;  1D6O A;  2WLZ A;  3L4H A;  2LPV A;  4NZC A;  2RSE A;  1JNE A;  1C9H A;  3CZ8 A;  1VF8 A;  3WL0 A;  2FAP A;  2KE0 A;  2RUD A;  4DRK A;  1RP5 A;  1NMV A;  3MQG A;  2ZAJ A;  1NWS A;  4A0U A;  3AS1 A;  1TR8 A;  4DRP A;  2D9F A;  2JXW A;  3RM9 A;  5GPG A;  1EQ3 A;  4WK9 A;  4MNJ A;  2XP5 A;  3LUO A;  2N87 A;  1F40 A;  2JZV A;  1BKF A;  1TK7 A;  1TFV A;  5AHT A;  2QF8 A;  3ARZ A;  1FD9 A;  1D7H A;  3RM4 A;  5HWB A;  2DG9 A;  3O5I A;  3MQH A;  1D7J A;  1K9T A;  4Z2G A;  3UQA A;  2PPP A;  4FAP A;  5D75 A;  3ARR A;  1ZBW A;  2PV2 A;  3JYJ A;  4DWS D;  4QZV B;  3MCB A;  1HKK A;  3AS3 A;  4MNL A;  2DSW A;  5HT1 A;  4QT2 A;  2EUL A;  3PA7 A;  1NWR A;  1HXV A;  4WKA A;  2JV4 A;  3ARO A;  4W5U A;  1ZL1 A;  1PBK A;  3ARP A;  3FY1 A;  2G8Z A;  4C02 B;  1Q1C A;  2L2S A;  4KR0 B;  3O5L A;  3H9R B;  1IX5 A;  2M2A A;  3WKZ A;  1L1P A;  3FSB A;  2KXQ A;  1NH6 A;  3UQI A;  3O5E A;  1BL4 A;  5HW8 A;  4U86 A;  4TNS A;  2MF9 A;  4J4O A;  3IKG A;  1LG2 A;  1J4H A;  3B9E A;  5E5W A;  4W9Q A;  1I5H W;  1U79 A;  2PPO A;  1HKI A;  3FSC A;  4IPX A;  3WL1 A;  1T11 A;  1J4I A;  4DWS B;  1W1Y A;  1E6P A;  1UR8 A;  5HKG A;  1EYM A;  3ARS A;  1ROU A;  2XPA A;  2EZ5 W;  4DWS A;  2L4J A;  1CTN A;  2WK2 A;  4MAV A;  1ZBC A;  4URI A;  2ITK A;  3I6C A;  3CHE A;  4ZPW R;  3RFW A;  3WD4 A;  5E65 A;  2LKN A;  2ZQT A;  5GPR A;  4ZPV R;  1HJV A;  3AS0 A;  4MNM A;  1F8A B;  2QRV A;  2Y78 A;  3WD2 A;  3CHF A;  3WQW A;  4U85 A;  4DRI A;  2PN0 A;  3RGC A;  2DT0 A;  5E62 A;  4G2P A;  4S3K A;  4GGQ A;  4O2T A;  4UDM A;  1D7I A;  3TDB A;  1KT1 A;  4W9O A;  3FS8 A;  4REX A;  3KAI A;  4TW6 A;  1FKD A;  2K8I A;  5U47 A;  3O5G A;  1FFR A;  2WLY A;  4DRN A;  4Z2L A;  2G41 A;  1E44 A;  1Y0O A;  3UF8 A;  2DWV A;  4A0T A;  1GUV A;  3PRA A;  1B6C A; 
#chains in the Genus database with same CATH homology
 2DK1 A;  3B9D A;  3O5D A;  2AWG A;  3PRB A;  1HKM A;  2YSB A;  4S3J A;  1W1V A;  1W9V A;  2XP8 A;  4E5R A;  4JYS A;  4NSB A;  5GQB A;  5B8I C;  2IF4 A;  3IK8 A;  3QOK A;  1FKJ A;  1W26 A;  1FKR A;  1M5Y A;  3JXV A;  3KAB A;  3CGN A;  1JMQ A;  5JH8 A;  4ODR A;  3IHZ A;  3MCB B;  1O6I A;  1W9P A;  3NI6 A;  2ZQS A;  4HAR A;  4JFL A;  3IKD A;  2VN1 A;  2YBU A;  4ODL A;  3UQB A;  1WB0 A;  2RQS A;  4LAX A;  3ART A;  1H0I A;  2MNT A;  3NTP A;  1E15 A;  2LJ4 A;  5J6E A;  1EDQ A;  3LKX A;  3ODK A;  1LL6 A;  2XP4 A;  2ESC A;  2XP9 A;  1JNT A;  4AY1 A;  4L72 B;  1JND A;  4U84 A;  4Z2J A;  1ZBV A;  4ODO A;  1ROT A;  3KZ7 A;  4ML4 A;  5HUA A;  1LL7 A;  3ALG A;  3TCZ A;  1OWQ A;  1FKI A;  2DK7 A;  2PV3 A;  5DEZ A;  2DG4 A;  3AS2 A;  1QPL A;  2ZR4 A;  2A3E A;  3ARQ A;  1ZK6 A;  5HWC A;  3ARU A;  2DSU A;  4JFI A;  3BXW A;  2WAD A;  1J6Y A;  4DZ2 A;  4JFM A;  2M8I A;  4TX0 A;  1EG3 A;  1WR7 A;  4P8W A;  4KQZ A;  3KAH A;  1Q6I A;  5HTG A;  1SR0 A;  1J4R A;  2YAJ B;  4R5E A;  4DRH A;  1LL4 A;  2LGO A;  2MLZ A;  2MLX A;  1GPF A;  2A3B A;  4P8V A;  3CNG A;  4Q7N A;  1FKS A;  1YW5 A;  4WIW A;  3KAC A;  3CHD A;  3FAP A;  1FKG A;  4IQC A;  1R9H A;  2KR7 A;  3ARV A;  3MDY B;  4HBE A;  4MGV A;  4WKF A;  2IUZ A;  4QT3 A;  2YSF A;  2F21 A;  2B31 A;  2O9O A;  3O5F A;  1PIN A;  3KAD A;  4DRQ A;  4TW8 A;  3UI4 A;  2UZ5 A;  1WAW A;  3ARW A;  2XP3 A;  2PV1 A;  3PRD A;  1NSG A;  4BF8 A;  4DZ3 A;  1FLC A;  2M08 A;  5E64 A;  2ZR5 A;  3EY6 A;  1FAP A;  2OWO A;  4P8X A;  3O5Q A;  2DSV A;  1YAT A;  2FKE A;  1RD6 A;  2PBC A;  1Q6H A;  3AQU A;  1A7X A;  4L3N A;  4IT4 A;  2KI3 A;  1TCO C;  5HBF A;  1GOI A;  1ZCN A;  5E66 A;  5HW7 A;  1Q6U A;  4JFJ A;  3O5P A;  3PR9 A;  1W9U A;  2DG3 A;  3O5J A;  3UI5 A;  4WKH A;  4ODM A;  1WMV A;  5CQ2 A;  2MPH A;  2BA1 A;  1UR9 A;  1HJX A;  4NNR A;  4DWS C;  4ZS6 A;  4ZPT R;  4MTV A;  4TYO A;  5I98 A;  2LAJ A;  2M8J A;  4PTM A;  1XRV A;  3G6L A;  2MLY A;  2YBT A;  1FKL A;  2OFN A;  4DRM A;  2Y8N B;  1X6N A;  3KCE A;  4Z2I A;  1OGB A;  2DT1 A;  4G50 A;  4HBO A;  4FN2 A;  2KFW A;  1FKH A;  2A3C A;  1HKJ A;  4DRJ A;  1NWT A;  3LKX B;  3O5K A;  3GPK A;  3CHC A;  2Q5A A;  2OLH A;  1X6L A;  3CH9 A;  1H0G A;  2RUR A;  2WM0 A;  4Z2K A;  3RM8 A;  3W4R A;  3NRK A;  3PQH A;  1SYT A;  1FFQ A;  4ODK A;  1P5Q A;  1E6Z A;  1OGG A;  3FXY A;  3VAW A;  1FKB A;  1FKT A;  4LAW A;  1JVW A;  4W9P A;  2O92 A;  2WAE A;  1ZB5 A;  3TC5 A;  2YSH A;  2DJY A;  1E9L A;  1QZ2 A;  2F4E A;  1D2K A;  2RUQ A;  3OOB A;  1E6R A;  2AOS A;  2KGJ A;  4N19 A;  2YSI A;  5BXJ A;  1ZBK A;  1EHN A;  2XP7 A;  1NWU A;  4Q22 A;  4DIP A;  2PPN A;  4LAY A;  1ZU8 A;  1ITX A;  4LAV A;  5DO2 A;  4IQ2 A;  4GLX A;  4DT4 A;  3O5M A;  2XP6 A;  4QIB A;  2F2D A;  3KAF A;  1E6N A;  4ODN A;  2MDI A;  2DSZ A;  1W1T A;  1O6W A;  5DIU A;  2DT3 A;  1WNO A;  2PI6 A;  4P8U A;  3KAG A;  3WD1 A;  3B7X A;  1N1A A;  2A3A A;  4MSP A;  3ARX A;  1FKF A;  3OA5 A;  1JNS A;  2DPE A;  2RUC A;  2M1I A;  5HW6 A;  2YSG A;  3RME A;  4R0X A;  3WD3 A;  4XAK A;  4WJX A;  4Z2H A;  2JX8 A;  5DF0 A;  1KT0 A;  5DIT A;  2ZR6 A;  3LE4 A;  2KO7 A;  3JYM A;  1K9Q A;  5DIV A;  1XHG A;  3O5R A;  1QPF A;  3WD0 A;  2RE3 A;  4MNK A;  3M7N A;  3B9A A;  4GIV A;  3O5O A;  4J4N A;  3M85 A;  3UI6 A;  1LJY A;  3G6M A;  1FJD A;  2VCD A;  2M3O W;  4LGX A;  2ZQV A;  4ODP A;  2FDM A;  2XPB A;  2ZQU A;  1FKK A;  3CGM A;  2JMF A;  3ARY A;  4DH0 A;  4IT6 A;  1W1P A;  2DT2 A;  4ITZ A;  3B8S A;  3WQV A;  4DRO A;  1EIB A;  1K9R A;  2E45 A;  4ODQ A;  1LG1 A;  1LQ0 A;  3ALF A;  1NMW A;  4TW7 A;  4MPK A;  3WH0 A;  3WIJ A;  2DMV A;  1HJW A;  4JFK A;  1EG4 A;  1KFW A;  1D6O A;  2WLZ A;  3L4H A;  2LPV A;  4NZC A;  2RSE A;  1JNE A;  1C9H A;  3CZ8 A;  1VF8 A;  3WL0 A;  2FAP A;  2KE0 A;  2RUD A;  4DRK A;  1RP5 A;  1NMV A;  3MQG A;  2ZAJ A;  1NWS A;  4A0U A;  3AS1 A;  1TR8 A;  4DRP A;  2D9F A;  2JXW A;  3RM9 A;  5GPG A;  1EQ3 A;  4WK9 A;  4MNJ A;  2XP5 A;  3LUO A;  2N87 A;  1F40 A;  2JZV A;  1BKF A;  1TK7 A;  1TFV A;  5AHT A;  2QF8 A;  3ARZ A;  1FD9 A;  1D7H A;  3RM4 A;  5HWB A;  2DG9 A;  3O5I A;  3MQH A;  1D7J A;  1K9T A;  4Z2G A;  3UQA A;  2PPP A;  4FAP A;  5D75 A;  3ARR A;  1ZBW A;  2PV2 A;  3JYJ A;  4DWS D;  4QZV B;  3MCB A;  1HKK A;  3AS3 A;  4MNL A;  2DSW A;  5HT1 A;  4QT2 A;  3PA7 A;  1NWR A;  1HXV A;  4WKA A;  2JV4 A;  3ARO A;  4W5U A;  1ZL1 A;  1PBK A;  3ARP A;  3FY1 A;  2G8Z A;  4C02 B;  1Q1C A;  2L2S A;  4KR0 B;  3O5L A;  3H9R B;  1IX5 A;  2M2A A;  3WKZ A;  1L1P A;  3FSB A;  2KXQ A;  1NH6 A;  3UQI A;  3O5E A;  1BL4 A;  5HW8 A;  4U86 A;  4TNS A;  2MF9 A;  4J4O A;  3IKG A;  1LG2 A;  1J4H A;  3B9E A;  5E5W A;  4W9Q A;  1I5H W;  1U79 A;  2PPO A;  1HKI A;  3FSC A;  4IPX A;  3WL1 A;  1T11 A;  1J4I A;  4DWS B;  1W1Y A;  1E6P A;  1UR8 A;  5HKG A;  1EYM A;  3ARS A;  1ROU A;  2XPA A;  2EZ5 W;  4DWS A;  2L4J A;  1CTN A;  2WK2 A;  4MAV A;  1ZBC A;  4URI A;  2ITK A;  3I6C A;  3CHE A;  4ZPW R;  3RFW A;  3WD4 A;  5E65 A;  2LKN A;  2ZQT A;  5GPR A;  4ZPV R;  1HJV A;  3AS0 A;  4MNM A;  1F8A B;  2QRV A;  2Y78 A;  3WD2 A;  3CHF A;  3WQW A;  4U85 A;  4DRI A;  3RGC A;  2DT0 A;  5E62 A;  4G2P A;  4S3K A;  4GGQ A;  4O2T A;  1D7I A;  3TDB A;  1KT1 A;  4W9O A;  3FS8 A;  4REX A;  3KAI A;  4TW6 A;  1FKD A;  2K8I A;  5U47 A;  3O5G A;  1FFR A;  2WLY A;  4DRN A;  4Z2L A;  2G41 A;  1Y0O A;  3UF8 A;  2DWV A;  4A0T A;  1GUV A;  3PRA A;  1B6C A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...