1ZCNA

Human pin1 ng mutant
Total Genus 47
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
47
sequence length
155
structure length
143
Chain Sequence
LPPGWEKRMSNGRVYYFNHITNASQWERPSEPARVRCSHLLVKHSQSRRPSSWRQEKITRTKEEALELINGYIQKIKSGEEDFESLASQFSDCSSAKARGDLGAFSRGQMQKPFEDASFALRTGEMSGPVFTDSGIHIILRTE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Isomerase
molecule keywords Peptidyl-prolyl cis-trans isomerase NIMA-interacting 1
publication title Structure-function-folding relationship in a WW domain.
pubmed doi rcsb
source organism Homo sapiens
total genus 47
structure length 143
sequence length 155
ec nomenclature ec 5.2.1.8: Peptidylprolyl isomerase.
pdb deposition date 2005-04-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00397 WW WW domain
A PF00639 Rotamase PPIC-type PPIASE domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.20.70.10 Mainly Beta Single Sheet Ubiquitin Ligase Nedd4; Chain: W; Ubiquitin Ligase Nedd4; Chain: W; 1zcnA01
3.10.50.40 Alpha Beta Roll Chitinase A; domain 3 Chitinase A; domain 3 1zcnA02
1B6CA 3JYMA 3ODKA 1JNSA 3O5OA 3KAGA 4LAVA 1ZK6A 2JZVA 3UQIA 3RGCA 2PV3A 1NMWA 3UI4A 2ZR5A 2RQSA 3O5DA 4E5RA 1FAPA 3PRDA 4JYSA 1D7IA 2PBCA 2VN1A 3KABA 2MLXA 4J4NA 1J6YA 3CGMA 1FKDA 1EYMA 2AWGA 3O5IA 2XP4A 4J4OA 3UQAA 1HXVA 4ODLA 3EY6A 2MLZA 2XP3A 2KFWA 3B7XA 3KCEA 3UI6A 2KXQA 4DRJA 4DRQA 3O5RA 2YSFA 1ZCNA 2BA1A 3O5FA 2XP9A 4ODNA 4IPXA 1JNTA 4QT3A 3IK8A 4DIPA 1I5HW 2ZQUA 2MPHA 1Q1CA 1M5YA 2DK7A 3TCZA 1QPFA 1NMVA 1D6OA 2DK1A 4C02B 3KACA 4W9PA 4TNSA 4DZ3A 3KAFA 3TDBA 3LE4A 1QZ2A 2RUQA 2PV1A 1FKFA 5HW8A 1EG4A 2DWVA 1Q6UA 2XP6A 1Q6IA 3IKDA 1U79A 2FAPA 2XP7A 3O5PA 2OFNA 1D7JA 2M8JA 1ROTA 4REXA 5CQ2A 5DIUA 2ITKA 4N19A 3CNGA 1K9QA 1EG3A 4MGVA 5HUAA 4TW7A 3KAHA 3O5KA 2Q5AA 1JVWA 2MDIA 4QIBA 2FKEA 1J4HA 5HT1A 4W9QA 2N87A 1F8AB 1J4IA 1PBKA 2EZ5W 5HTGA 1ROUA 1O6WA 2F4EA 3TC5A 2KR7A 4LAXA 3WH0A 2ZR4A 4JFIA 4DZ2A 2YSGA 2KGJA 1WR7A 4TYOA 2KE0A 2M8IA 4DT4A 4IQ2A 3UF8A 1D7HA 2MNTA 5HKGA 1FKBA 3O5JA 3GPKA 1Y0OA 1BKFA 5J6EA 2UZ5A 4GGQA 3FAPA 2YSBA 2KO7A 2LKNA 1WMVA 1NSGA 3O5EA 2JX8A 4DH0A 4U84A 2ZQSA 1R9HA 1KT0A 3MDYB 4ODRA 2DG3A 2IF4A 2DJYA 2YSIA 4IQCA 1Q6HA 1BL4A 4LAYA 2XP8A 4DRHA 2LPVA 3M85A 1FKRA 4DRNA 3UQBA 3I6CA 5HWCA 4ODKA 2M2AA 4BF8A 1K9RA 4G50A 2RE3A 1P5QA 2VCDA 1EQ3A 2XPAA 2XPBA 4GIVA 1F40A 4FAPA 2E45A 1FKIA 4DRMA 2LJ4A 1YW5A 5DIVA 3H9RB 5B8IC 1TK7A 2DG4A 4G2PA 4W9OA 2DG9A 2D9FA 3JXVA 5D75A 3IKGA 2M3OW 1T11A 4ODMA 1FKGA 3M7NA 1N1AA 5AHTA 4JFJA 1A7XA 1TCOC 3CGNA 4TW6A 2ZQTA 2DMVA 4TW8A 2ZQVA 4O2TA 4JFMA 2JXWA 1FKLA 2XP5A 4JFKA 3PRBA 4ODQA 1FKTA 3KZ7A 4U86A 3UI5A 3KAIA 5GPGA 4DROA 3L4HA 3O5QA 2PPOA 1FKHA 4JFLA 3OOBA 4FN2A 4DRPA 2YSHA 3O5GA 2PV2A 3RFWA 3VAWA 2Y78A 2RSEA 1FD9A 2M08A 5DITA 4LAWA 1FKSA 5HW6A 2PPNA 1FJDA 1J4RA 2L2SA 2LGOA 1JMQA 2F2DA 4NNRA 1YATA 1FKJA 5HW7A 2LAJA 3O5LA 2KI3A 3KADA 3LUOA 2RUDA 2F21A 2MF9A 4U85A 2K8IA 4ODOA 1C9HA 2M1IA 1L1PA 4TX0A 4MSPA 3NTPA 2JMFA 4DRKA 2PPPA 3NRKA 3O5MA 5HWBA 2RUCA 4DRIA 3JYJA 4ITZA 3IHZA 5BXJA 1W26A 2L4JA 1FKKA 3PA7A 2ZAJA 2JV4A 2ZR6A 5I98A 2MLYA 1KT1A 4QT2A 3NI6A 1PINA 1QPLA 4ODPA 2RURA 4R0XA
chains in the Genus database with same CATH superfamily
1B6CA 3JYMA 3ODKA 1W9UA 4ZS6A 1FFRA 1SYTA 2DSVA 1JNSA 3O5OA 1SR0A 3KAGA 4LAVA 1ZL1A 4NZCA 1ZK6A 3FS8A 1ITXA 3ARQA 4Z2IA 1TR8A 2JZVA 3UQIA 2B31A 3RGCA 2PV3A 1NMWA 2ZR5A 2P4VA 2RQSA 3UI4A 3O5DA 3AROA 4E5RA 1FAPA 3PRDA 3ARPA 4JYSA 1D7IA 2PBCA 3PQHA 3WIJA 2VN1A 1TFVA 3KABA 2O92A 2MLXA 4J4NA 1J6YA 3CGMA 4QZVB 2ESCA 1FKDA 1EYMA 2WAEA 2AWGA 1NH6A 3ALGA 3O5IA 2DSUA 3LKXA 1LG2A 3B8SA 4W5UA 2OWOA 2XP4A 4J4OA 3UQAA 1HXVA 4ODLA 3EY6A 4DWSA 4HBOA 2MLZA 2B5UB 2XP3A 2KFWA 3B7XA 3KCEA 3UI6A 3ARYA 3ARZA 3AQUA 2DT0A 2KXQA 3CHEA 2DPEA 5JH8A 3FSCA 5DO2A 4MNJA 1H0GA 4DRJA 3MQGA 3WQWA 4DRQA 1WAWA 4DWSD 3QOKA 3O5RA 3WL0A 1GPFA 3RMEA 5GQBA 3PR9A 2YSFA 1ZCNA 2BA1A 1E6PA 3O5FA 2XP9A 1JCHB 3WD3A 4ZPVR 4ODNA 4IPXA 1JNTA 4QT3A 3IK8A 4DIPA 1H0IA 2WADA 1I5HW 3WD2A 2ZQUA 2MPHA 2ETNA 1Q1CA 3AS2A 1LJYA 4KR0B 5E65A 1M5YA 4PTMA 2DK7A 3ARRA 1NWTA 1ZBKA 3TCZA 1QPFA 1NMVA 1D6OA 2DK1A 4C02B 3KACA 4DWSC 3FXYA 3CHCA 4W9PA 1OGGA 3GTYX 4TNSA 1OGBA 4DZ3A 3KAFA 3TDBA 1NWSA 1CTNA 2FDMA 3LE4A 1QZ2A 2RUQA 3RM8A 3WKZA 2WK2A 2PV1A 1FKFA 5HW8A 1EG4A 2DWVA 1Q6UA 3CHFA 2XP6A 4KQZA 1E44A 1Q6IA 2G41A 1ZB5A 4WJXA 3IKDA 1U79A 2FAPA 2XP7A 3O5PA 2OFNA 1D7JA 2M8JA 1JNDA 4REXA 1ROTA 4ZPWR 5CQ2A 2G8ZA 1HKKA 5DIUA 1E15A 2ITKA 3CNGA 1ZU8A 4N19A 1K9QA 3WD4A 1EG3A 3B9AA 4MGVA 5HUAA 4TW7A 4MTVA 1EHNA 2AOSA 1GRJA 3KAHA 4Z2JA 3O5KA 3FY1A 2Q5AA 1JVWA 2MDIA 4L3NA 4QIBA 1LL7A 2FKEA 1J4HA 5HT1A 2N87A 4W9QA 1F8AB 1J4IA 1PBKA 2EZ5W 4IT6A 4WKAA 1ROUA 5HTGA 1O6WA 2F4EA 3TC5A 1X6LA 2YBUA 2KR7A 4LAXA 3WH0A 4WKHA 2ZR4A 4JFIA 4ML4A 4DZ2A 4URIA 2YSGA 2KGJA 2PI6A 3WL1A 4R5EA 4LGXA 4IT4A 1WR7A 4P8UA 4TYOA 1NWRA 2KE0A 5DF0A 4L72B 2M8IA 4DT4A 4IQ2A 3UF8A 1D7HA 2MNTA 2YBTA 5HKGA 1FKBA 2DSZA 1JNEA 1NWUA 4HARA 1EIBA 3O5JA 3B9DA 4P8XA 4XAKA 3GPKA 2PN0A 2A3AA 1Y0OA 1BKFA 4WIWA 5J6EA 1W9VA 3BXWA 3ARXA 2UZ5A 1HJVA 4GGQA 3FAPA 2YSBA 1XRVA 2DSWA 1OWQA 2KO7A 1ZBWA 2LKNA 2DT2A 1XHGA 2A3BA 1WMVA 1NSGA 3O5EA 3B9EA 4A0TA 4MNKA 2JX8A 4DH0A 4ZPTR 1O6IA 4U84A 2ZQSA 2F23A 1GOIA 1R9HA 1KT0A 3MDYB 4ODRA 2DG3A 2IF4A 1ZBCA 1HKIA 2DJYA 2YSIA 1W1VA 4IQCA 3PRAA 1Q6HA 1BL4A 4MNMA 3MCBB 4LAYA 2XP8A 2EULA 1WB0A 4DRHA 1IX5A 2QF8A 2LPVA 3FSBA 3M85A 1FKRA 4DRNA 3WD0A 3UQBA 3I6CA 5HBFA 5HWCA 1UR9A 1E6NA 4ODKA 2M2AA 4BF8A 1K9RA 4G50A 2RE3A 1P5QA 2VCDA 1EQ3A 2XPAA 3W4RA 5E66A 2XPBA 4GIVA 4DWSB 1F40A 2A3EA 4FAPA 2E45A 1FKIA 4DRMA 2LJ4A 1W1PA 1E6RA 2O9OA 1YW5A 5DIVA 4NSBA 3RM9A 1E6ZA 3H9RB 3WD1A 5B8IC 1TK7A 2DG4A 4G2PA 4W9OA 2DG9A 2D9FA 3OA5A 3JXVA 5D75A 3IKGA 4Z2LA 2M3OW 3AS3A 1T11A 4ODMA 1FKGA 1LQ0A 3M7NA 5DEZA 1N1AA 5AHTA 2Y8NB 4JFJA 1W1YA 1UR8A 1HKJA 1LL6A 3ARTA 1A7XA 2QRVA 1TCOC 3CGNA 1W1TA 3CH9A 4TW6A 4P8VA 2WLYA 2ZQTA 2DMVA 4TW8A 2ZQVA 4O2TA 4JFMA 2JXWA 1K9TA 4Z2HA 1FKLA 3ALFA 2IUZA 2XP5A 4MNLA 4JFKA 3PRBA 1RP5A 4ODQA 1FLCA 1FKTA 3KZ7A 4WK9A 4U86A 3UI5A 3KAIA 3MCBA 1LG1A 5GPGA 5GPRA 4DROA 3L4HA 4P8WA 3O5QA 2DT3A 2PPOA 5E5WA 4WKFA 1FKHA 4JFLA 3RM4A 3OOBA 4FN2A 3GU0A 4DRPA 4UDMA 2YSHA 1EDQA 2PV2A 3G6MA 3O5GA 3RFWA 3VAWA 3AS0A 2Y78A 2RSEA 4A0UA 3BMBA 1FD9A 2M08A 5DITA 1VF8A 4GLXA 4S3KA 4LAWA 3MQHA 1FKSA 3ARWA 5HW6A 2PPNA 4Q7NA 1FJDA 1ZBVA 1J4RA 2L2SA 2DT1A 4AY1A 2LGOA 1JMQA 2F2DA 3WQVA 4NNRA 1YATA 1RD6A 3EIPA 2WM0A 1FFQA 1FKJA 5HW7A 1D2KA 2LAJA 3O5LA 2KI3A 3KADA 3LUOA 2RUDA 2F21A 2MF9A 4U85A 2K8IA 3ARVA 5U47A 2WLZA 2OLHA 1HJXA 3AS1A 4ODOA 1C9HA 2M1IA 1L1PA 4TX0A 4MAVA 4MSPA 3CHDA 3NTPA 1KFWA 2JMFA 4Z2KA 5E62A 4DRKA 2PPPA 3NRKA 1X6NA 3O5MA 4S3JA 1LL4A 5E64A 1WNOA 5HWBA 3LKXB 2RUCA 4MPKA 4DRIA 3CZ8A 3JYJA 4ITZA 3IHZA 5BXJA 1W26A 1W9PA 2L4JA 1FKKA 3ARSA 3PA7A 2ZAJA 4HBEA 2JV4A 1E9LA 2ZR6A 5I98A 3G6LA 2MLYA 1KT1A 4Z2GA 4QT2A 3NI6A 1GUVA 2YAJB 1PINA 1QPLA 2A3CA 3ARUA 4Q22A 4ODPA 1HKMA 2RURA 4R0XA 1HJWA
chains in the Genus database with same CATH topology
1B6CA 3JYMA 3ODKA 1W9UA 4ZS6A 1FFRA 1SYTA 2DSVA 1JNSA 3O5OA 1SR0A 3KAGA 4LAVA 1ZL1A 4NZCA 1ZK6A 3FS8A 1ITXA 3ARQA 4Z2IA 1TR8A 2JZVA 3UQIA 2B31A 3RGCA 2PV3A 1NMWA 2ZR5A 2RQSA 3UI4A 3O5DA 3AROA 4E5RA 1FAPA 3PRDA 3ARPA 4JYSA 1D7IA 2PBCA 3PQHA 3WIJA 2VN1A 1TFVA 3KABA 2O92A 2MLXA 4J4NA 1J6YA 3CGMA 4QZVB 2ESCA 1FKDA 1EYMA 2WAEA 2AWGA 1NH6A 3ALGA 3O5IA 2DSUA 3LKXA 1LG2A 3B8SA 4W5UA 2OWOA 2XP4A 4J4OA 3UQAA 1HXVA 4ODLA 3EY6A 4DWSA 4HBOA 2MLZA 2XP3A 2KFWA 3B7XA 3KCEA 3UI6A 3ARYA 3ARZA 3AQUA 2DT0A 2KXQA 3CHEA 2DPEA 5JH8A 3FSCA 5DO2A 4MNJA 1H0GA 4DRJA 3MQGA 3WQWA 4DRQA 1WAWA 4DWSD 3QOKA 3O5RA 3WL0A 1GPFA 3RMEA 5GQBA 3PR9A 2YSFA 1ZCNA 2BA1A 1E6PA 3O5FA 2XP9A 3WD3A 4ZPVR 4ODNA 4IPXA 1JNTA 4QT3A 3IK8A 4DIPA 1H0IA 2WADA 1I5HW 3WD2A 2ZQUA 2MPHA 1Q1CA 3AS2A 1LJYA 4KR0B 5E65A 1M5YA 4PTMA 2DK7A 3ARRA 1NWTA 1ZBKA 3TCZA 1QPFA 1NMVA 1D6OA 2DK1A 4C02B 3KACA 4DWSC 3FXYA 3CHCA 4W9PA 1OGGA 4TNSA 1OGBA 4DZ3A 3KAFA 3TDBA 1NWSA 1CTNA 2FDMA 3LE4A 1QZ2A 2RUQA 3RM8A 3WKZA 2WK2A 2PV1A 1FKFA 5HW8A 1EG4A 2DWVA 1Q6UA 3CHFA 2XP6A 4KQZA 1Q6IA 2G41A 1ZB5A 4WJXA 3IKDA 1U79A 2FAPA 2XP7A 3O5PA 2OFNA 1D7JA 2M8JA 1JNDA 4REXA 1ROTA 4ZPWR 5CQ2A 2G8ZA 1HKKA 5DIUA 1E15A 2ITKA 3CNGA 1ZU8A 4N19A 1K9QA 3WD4A 1EG3A 3B9AA 4MGVA 5HUAA 4TW7A 4MTVA 1EHNA 2AOSA 3KAHA 4Z2JA 3O5KA 3FY1A 2Q5AA 1JVWA 2MDIA 4L3NA 4QIBA 1LL7A 2FKEA 1J4HA 5HT1A 2N87A 4W9QA 1F8AB 1J4IA 1PBKA 2EZ5W 4IT6A 4WKAA 1ROUA 5HTGA 1O6WA 2F4EA 3TC5A 1X6LA 2YBUA 2KR7A 4LAXA 3WH0A 4WKHA 2ZR4A 4JFIA 4ML4A 4DZ2A 4URIA 2YSGA 2KGJA 2PI6A 3WL1A 4R5EA 4LGXA 4IT4A 1WR7A 4P8UA 4TYOA 1NWRA 2KE0A 5DF0A 4L72B 2M8IA 4DT4A 4IQ2A 3UF8A 1D7HA 2MNTA 2YBTA 5HKGA 1FKBA 2DSZA 1JNEA 1NWUA 4HARA 1EIBA 3O5JA 3B9DA 4P8XA 4XAKA 3GPKA 2A3AA 1Y0OA 1BKFA 4WIWA 5J6EA 1W9VA 3BXWA 3ARXA 2UZ5A 1HJVA 4GGQA 3FAPA 2YSBA 1XRVA 2DSWA 1OWQA 2KO7A 1ZBWA 2LKNA 2DT2A 1XHGA 2A3BA 1WMVA 1NSGA 3O5EA 3B9EA 4A0TA 4MNKA 2JX8A 4DH0A 4ZPTR 1O6IA 4U84A 2ZQSA 1GOIA 1R9HA 1KT0A 3MDYB 4ODRA 2DG3A 2IF4A 1ZBCA 1HKIA 2DJYA 2YSIA 1W1VA 4IQCA 3PRAA 1Q6HA 1BL4A 4MNMA 3MCBB 4LAYA 2XP8A 1WB0A 4DRHA 1IX5A 2QF8A 2LPVA 3FSBA 3M85A 1FKRA 4DRNA 3WD0A 3UQBA 3I6CA 5HBFA 5HWCA 1UR9A 1E6NA 4ODKA 2M2AA 4BF8A 1K9RA 4G50A 2RE3A 1P5QA 2VCDA 1EQ3A 2XPAA 3W4RA 5E66A 2XPBA 4GIVA 4DWSB 1F40A 2A3EA 4FAPA 2E45A 1FKIA 4DRMA 2LJ4A 1W1PA 1E6RA 2O9OA 1YW5A 5DIVA 4NSBA 3RM9A 1E6ZA 3H9RB 3WD1A 5B8IC 1TK7A 2DG4A 4G2PA 4W9OA 2DG9A 2D9FA 3OA5A 3JXVA 5D75A 3IKGA 4Z2LA 2M3OW 3AS3A 1T11A 4ODMA 1FKGA 1LQ0A 3M7NA 5DEZA 1N1AA 5AHTA 2Y8NB 4JFJA 1W1YA 1UR8A 1HKJA 1LL6A 3ARTA 1A7XA 2QRVA 1TCOC 3CGNA 1W1TA 3CH9A 4TW6A 4P8VA 2WLYA 2ZQTA 2DMVA 4TW8A 2ZQVA 4O2TA 4JFMA 2JXWA 1K9TA 4Z2HA 1FKLA 3ALFA 2IUZA 2XP5A 4MNLA 4JFKA 3PRBA 1RP5A 4ODQA 1FLCA 1FKTA 3KZ7A 4WK9A 4U86A 3UI5A 3KAIA 3MCBA 1LG1A 5GPGA 5GPRA 4DROA 3L4HA 4P8WA 3O5QA 2DT3A 2PPOA 5E5WA 4WKFA 1FKHA 4JFLA 3RM4A 3OOBA 4FN2A 4DRPA 2YSHA 1EDQA 2PV2A 3G6MA 3O5GA 3RFWA 3VAWA 3AS0A 2Y78A 2RSEA 4A0UA 1FD9A 2M08A 5DITA 1VF8A 4GLXA 4S3KA 4LAWA 3MQHA 1FKSA 3ARWA 5HW6A 2PPNA 4Q7NA 1FJDA 1ZBVA 1J4RA 2L2SA 2DT1A 4AY1A 2LGOA 1JMQA 2F2DA 3WQVA 4NNRA 1YATA 1RD6A 2WM0A 1FFQA 1FKJA 5HW7A 1D2KA 2LAJA 3O5LA 2KI3A 3KADA 3LUOA 2RUDA 2F21A 2MF9A 4U85A 2K8IA 3ARVA 5U47A 2WLZA 2OLHA 1HJXA 3AS1A 4ODOA 1C9HA 2M1IA 1L1PA 4TX0A 4MAVA 4MSPA 3CHDA 3NTPA 1KFWA 2JMFA 4Z2KA 5E62A 4DRKA 2PPPA 3NRKA 1X6NA 3O5MA 4S3JA 1LL4A 5E64A 1WNOA 5HWBA 3LKXB 2RUCA 4MPKA 4DRIA 3CZ8A 3JYJA 4ITZA 3IHZA 5BXJA 1W26A 1W9PA 2L4JA 1FKKA 3ARSA 3PA7A 2ZAJA 4HBEA 2JV4A 1E9LA 2ZR6A 5I98A 3G6LA 2MLYA 1KT1A 4Z2GA 4QT2A 3NI6A 1GUVA 2YAJB 1PINA 1QPLA 2A3CA 3ARUA 4Q22A 4ODPA 1HKMA 2RURA 4R0XA 1HJWA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1B6C A;  3JYM A;  3ODK A;  1JNS A;  3O5O A;  3KAG A;  4LAV A;  1ZK6 A;  2JZV A;  3UQI A;  3RGC A;  2PV3 A;  1NMW A;  3UI4 A;  2ZR5 A;  2RQS A;  3O5D A;  4E5R A;  1FAP A;  3PRD A;  4JYS A;  1D7I A;  2PBC A;  2VN1 A;  3KAB A;  2MLX A;  4J4N A;  1J6Y A;  3CGM A;  1FKD A;  1EYM A;  2AWG A;  3O5I A;  2XP4 A;  4J4O A;  3UQA A;  1HXV A;  4ODL A;  3EY6 A;  2MLZ A;  2XP3 A;  2KFW A;  3B7X A;  3KCE A;  3UI6 A;  2KXQ A;  4DRJ A;  4DRQ A;  3O5R A;  2YSF A;  1ZCN A;  2BA1 A;  3O5F A;  2XP9 A;  4ODN A;  4IPX A;  1JNT A;  4QT3 A;  3IK8 A;  4DIP A;  1I5H W;  2ZQU A;  2MPH A;  1Q1C A;  1M5Y A;  2DK7 A;  3TCZ A;  1QPF A;  1NMV A;  1D6O A;  2DK1 A;  4C02 B;  3KAC A;  4W9P A;  4TNS A;  4DZ3 A;  3KAF A;  3TDB A;  3LE4 A;  1QZ2 A;  2RUQ A;  2PV1 A;  1FKF A;  5HW8 A;  1EG4 A;  2DWV A;  1Q6U A;  2XP6 A;  1Q6I A;  3IKD A;  1U79 A;  2FAP A;  2XP7 A;  3O5P A;  2OFN A;  1D7J A;  2M8J A;  1ROT A;  4REX A;  5CQ2 A;  5DIU A;  2ITK A;  4N19 A;  3CNG A;  1K9Q A;  1EG3 A;  4MGV A;  5HUA A;  4TW7 A;  3KAH A;  3O5K A;  2Q5A A;  1JVW A;  2MDI A;  4QIB A;  2FKE A;  1J4H A;  5HT1 A;  4W9Q A;  2N87 A;  1F8A B;  1J4I A;  1PBK A;  2EZ5 W;  5HTG A;  1ROU A;  1O6W A;  2F4E A;  3TC5 A;  2KR7 A;  4LAX A;  3WH0 A;  2ZR4 A;  4JFI A;  4DZ2 A;  2YSG A;  2KGJ A;  1WR7 A;  4TYO A;  2KE0 A;  2M8I A;  4DT4 A;  4IQ2 A;  3UF8 A;  1D7H A;  2MNT A;  5HKG A;  1FKB A;  3O5J A;  3GPK A;  1Y0O A;  1BKF A;  5J6E A;  2UZ5 A;  4GGQ A;  3FAP A;  2YSB A;  2KO7 A;  2LKN A;  1WMV A;  1NSG A;  3O5E A;  2JX8 A;  4DH0 A;  4U84 A;  2ZQS A;  1R9H A;  1KT0 A;  3MDY B;  4ODR A;  2DG3 A;  2IF4 A;  2DJY A;  2YSI A;  4IQC A;  1Q6H A;  1BL4 A;  4LAY A;  2XP8 A;  4DRH A;  2LPV A;  3M85 A;  1FKR A;  4DRN A;  3UQB A;  3I6C A;  5HWC A;  4ODK A;  2M2A A;  4BF8 A;  1K9R A;  4G50 A;  2RE3 A;  1P5Q A;  2VCD A;  1EQ3 A;  2XPA A;  2XPB A;  4GIV A;  1F40 A;  4FAP A;  2E45 A;  1FKI A;  4DRM A;  2LJ4 A;  1YW5 A;  5DIV A;  3H9R B;  5B8I C;  1TK7 A;  2DG4 A;  4G2P A;  4W9O A;  2DG9 A;  2D9F A;  3JXV A;  5D75 A;  3IKG A;  2M3O W;  1T11 A;  4ODM A;  1FKG A;  3M7N A;  1N1A A;  5AHT A;  4JFJ A;  1A7X A;  1TCO C;  3CGN A;  4TW6 A;  2ZQT A;  2DMV A;  4TW8 A;  2ZQV A;  4O2T A;  4JFM A;  2JXW A;  1FKL A;  2XP5 A;  4JFK A;  3PRB A;  4ODQ A;  1FKT A;  3KZ7 A;  4U86 A;  3UI5 A;  3KAI A;  5GPG A;  4DRO A;  3L4H A;  3O5Q A;  2PPO A;  1FKH A;  4JFL A;  3OOB A;  4FN2 A;  4DRP A;  2YSH A;  3O5G A;  2PV2 A;  3RFW A;  3VAW A;  2Y78 A;  2RSE A;  1FD9 A;  2M08 A;  5DIT A;  4LAW A;  1FKS A;  5HW6 A;  2PPN A;  1FJD A;  1J4R A;  2L2S A;  2LGO A;  1JMQ A;  2F2D A;  4NNR A;  1YAT A;  1FKJ A;  5HW7 A;  2LAJ A;  3O5L A;  2KI3 A;  3KAD A;  3LUO A;  2RUD A;  2F21 A;  2MF9 A;  4U85 A;  2K8I A;  4ODO A;  1C9H A;  2M1I A;  1L1P A;  4TX0 A;  4MSP A;  3NTP A;  2JMF A;  4DRK A;  2PPP A;  3NRK A;  3O5M A;  5HWB A;  2RUC A;  4DRI A;  3JYJ A;  4ITZ A;  3IHZ A;  5BXJ A;  1W26 A;  2L4J A;  1FKK A;  3PA7 A;  2ZAJ A;  2JV4 A;  2ZR6 A;  5I98 A;  2MLY A;  1KT1 A;  4QT2 A;  3NI6 A;  1PIN A;  1QPL A;  4ODP A;  2RUR A;  4R0X A; 
#chains in the Genus database with same CATH topology
 1B6C A;  3JYM A;  3ODK A;  1W9U A;  4ZS6 A;  1FFR A;  1SYT A;  2DSV A;  1JNS A;  3O5O A;  1SR0 A;  3KAG A;  4LAV A;  1ZL1 A;  4NZC A;  1ZK6 A;  3FS8 A;  1ITX A;  3ARQ A;  4Z2I A;  1TR8 A;  2JZV A;  3UQI A;  2B31 A;  3RGC A;  2PV3 A;  1NMW A;  2ZR5 A;  2P4V A;  2RQS A;  3UI4 A;  3O5D A;  3ARO A;  4E5R A;  1FAP A;  3PRD A;  3ARP A;  4JYS A;  1D7I A;  2PBC A;  3PQH A;  3WIJ A;  2VN1 A;  1TFV A;  3KAB A;  2O92 A;  2MLX A;  4J4N A;  1J6Y A;  3CGM A;  4QZV B;  2ESC A;  1FKD A;  1EYM A;  2WAE A;  2AWG A;  1NH6 A;  3ALG A;  3O5I A;  2DSU A;  3LKX A;  1LG2 A;  3B8S A;  4W5U A;  2OWO A;  2XP4 A;  4J4O A;  3UQA A;  1HXV A;  4ODL A;  3EY6 A;  4DWS A;  4HBO A;  2MLZ A;  2B5U B;  2XP3 A;  2KFW A;  3B7X A;  3KCE A;  3UI6 A;  3ARY A;  3ARZ A;  3AQU A;  2DT0 A;  2KXQ A;  3CHE A;  2DPE A;  5JH8 A;  3FSC A;  5DO2 A;  4MNJ A;  1H0G A;  4DRJ A;  3MQG A;  3WQW A;  4DRQ A;  1WAW A;  4DWS D;  3QOK A;  3O5R A;  3WL0 A;  1GPF A;  3RME A;  5GQB A;  3PR9 A;  2YSF A;  1ZCN A;  2BA1 A;  1E6P A;  3O5F A;  2XP9 A;  1JCH B;  3WD3 A;  4ZPV R;  4ODN A;  4IPX A;  1JNT A;  4QT3 A;  3IK8 A;  4DIP A;  1H0I A;  2WAD A;  1I5H W;  3WD2 A;  2ZQU A;  2MPH A;  2ETN A;  1Q1C A;  3AS2 A;  1LJY A;  4KR0 B;  5E65 A;  1M5Y A;  4PTM A;  2DK7 A;  3ARR A;  1NWT A;  1ZBK A;  3TCZ A;  1QPF A;  1NMV A;  1D6O A;  2DK1 A;  4C02 B;  3KAC A;  4DWS C;  3FXY A;  3CHC A;  4W9P A;  1OGG A;  3GTY X;  4TNS A;  1OGB A;  4DZ3 A;  3KAF A;  3TDB A;  1NWS A;  1CTN A;  2FDM A;  3LE4 A;  1QZ2 A;  2RUQ A;  3RM8 A;  3WKZ A;  2WK2 A;  2PV1 A;  1FKF A;  5HW8 A;  1EG4 A;  2DWV A;  1Q6U A;  3CHF A;  2XP6 A;  4KQZ A;  1E44 A;  1Q6I A;  2G41 A;  1ZB5 A;  4WJX A;  3IKD A;  1U79 A;  2FAP A;  2XP7 A;  3O5P A;  2OFN A;  1D7J A;  2M8J A;  1JND A;  4REX A;  1ROT A;  4ZPW R;  5CQ2 A;  2G8Z A;  1HKK A;  5DIU A;  1E15 A;  2ITK A;  3CNG A;  1ZU8 A;  4N19 A;  1K9Q A;  3WD4 A;  1EG3 A;  3B9A A;  4MGV A;  5HUA A;  4TW7 A;  4MTV A;  1EHN A;  2AOS A;  1GRJ A;  3KAH A;  4Z2J A;  3O5K A;  3FY1 A;  2Q5A A;  1JVW A;  2MDI A;  4L3N A;  4QIB A;  1LL7 A;  2FKE A;  1J4H A;  5HT1 A;  2N87 A;  4W9Q A;  1F8A B;  1J4I A;  1PBK A;  2EZ5 W;  4IT6 A;  4WKA A;  1ROU A;  5HTG A;  1O6W A;  2F4E A;  3TC5 A;  1X6L A;  2YBU A;  2KR7 A;  4LAX A;  3WH0 A;  4WKH A;  2ZR4 A;  4JFI A;  4ML4 A;  4DZ2 A;  4URI A;  2YSG A;  2KGJ A;  2PI6 A;  3WL1 A;  4R5E A;  4LGX A;  4IT4 A;  1WR7 A;  4P8U A;  4TYO A;  1NWR A;  2KE0 A;  5DF0 A;  4L72 B;  2M8I A;  4DT4 A;  4IQ2 A;  3UF8 A;  1D7H A;  2MNT A;  2YBT A;  5HKG A;  1FKB A;  2DSZ A;  1JNE A;  1NWU A;  4HAR A;  1EIB A;  3O5J A;  3B9D A;  4P8X A;  4XAK A;  3GPK A;  2PN0 A;  2A3A A;  1Y0O A;  1BKF A;  4WIW A;  5J6E A;  1W9V A;  3BXW A;  3ARX A;  2UZ5 A;  1HJV A;  4GGQ A;  3FAP A;  2YSB A;  1XRV A;  2DSW A;  1OWQ A;  2KO7 A;  1ZBW A;  2LKN A;  2DT2 A;  1XHG A;  2A3B A;  1WMV A;  1NSG A;  3O5E A;  3B9E A;  4A0T A;  4MNK A;  2JX8 A;  4DH0 A;  4ZPT R;  1O6I A;  4U84 A;  2ZQS A;  2F23 A;  1GOI A;  1R9H A;  1KT0 A;  3MDY B;  4ODR A;  2DG3 A;  2IF4 A;  1ZBC A;  1HKI A;  2DJY A;  2YSI A;  1W1V A;  4IQC A;  3PRA A;  1Q6H A;  1BL4 A;  4MNM A;  3MCB B;  4LAY A;  2XP8 A;  2EUL A;  1WB0 A;  4DRH A;  1IX5 A;  2QF8 A;  2LPV A;  3FSB A;  3M85 A;  1FKR A;  4DRN A;  3WD0 A;  3UQB A;  3I6C A;  5HBF A;  5HWC A;  1UR9 A;  1E6N A;  4ODK A;  2M2A A;  4BF8 A;  1K9R A;  4G50 A;  2RE3 A;  1P5Q A;  2VCD A;  1EQ3 A;  2XPA A;  3W4R A;  5E66 A;  2XPB A;  4GIV A;  4DWS B;  1F40 A;  2A3E A;  4FAP A;  2E45 A;  1FKI A;  4DRM A;  2LJ4 A;  1W1P A;  1E6R A;  2O9O A;  1YW5 A;  5DIV A;  4NSB A;  3RM9 A;  1E6Z A;  3H9R B;  3WD1 A;  5B8I C;  1TK7 A;  2DG4 A;  4G2P A;  4W9O A;  2DG9 A;  2D9F A;  3OA5 A;  3JXV A;  5D75 A;  3IKG A;  4Z2L A;  2M3O W;  3AS3 A;  1T11 A;  4ODM A;  1FKG A;  1LQ0 A;  3M7N A;  5DEZ A;  1N1A A;  5AHT A;  2Y8N B;  4JFJ A;  1W1Y A;  1UR8 A;  1HKJ A;  1LL6 A;  3ART A;  1A7X A;  2QRV A;  1TCO C;  3CGN A;  1W1T A;  3CH9 A;  4TW6 A;  4P8V A;  2WLY A;  2ZQT A;  2DMV A;  4TW8 A;  2ZQV A;  4O2T A;  4JFM A;  2JXW A;  1K9T A;  4Z2H A;  1FKL A;  3ALF A;  2IUZ A;  2XP5 A;  4MNL A;  4JFK A;  3PRB A;  1RP5 A;  4ODQ A;  1FLC A;  1FKT A;  3KZ7 A;  4WK9 A;  4U86 A;  3UI5 A;  3KAI A;  3MCB A;  1LG1 A;  5GPG A;  5GPR A;  4DRO A;  3L4H A;  4P8W A;  3O5Q A;  2DT3 A;  2PPO A;  5E5W A;  4WKF A;  1FKH A;  4JFL A;  3RM4 A;  3OOB A;  4FN2 A;  3GU0 A;  4DRP A;  4UDM A;  2YSH A;  1EDQ A;  2PV2 A;  3G6M A;  3O5G A;  3RFW A;  3VAW A;  3AS0 A;  2Y78 A;  2RSE A;  4A0U A;  3BMB A;  1FD9 A;  2M08 A;  5DIT A;  1VF8 A;  4GLX A;  4S3K A;  4LAW A;  3MQH A;  1FKS A;  3ARW A;  5HW6 A;  2PPN A;  4Q7N A;  1FJD A;  1ZBV A;  1J4R A;  2L2S A;  2DT1 A;  4AY1 A;  2LGO A;  1JMQ A;  2F2D A;  3WQV A;  4NNR A;  1YAT A;  1RD6 A;  3EIP A;  2WM0 A;  1FFQ A;  1FKJ A;  5HW7 A;  1D2K A;  2LAJ A;  3O5L A;  2KI3 A;  3KAD A;  3LUO A;  2RUD A;  2F21 A;  2MF9 A;  4U85 A;  2K8I A;  3ARV A;  5U47 A;  2WLZ A;  2OLH A;  1HJX A;  3AS1 A;  4ODO A;  1C9H A;  2M1I A;  1L1P A;  4TX0 A;  4MAV A;  4MSP A;  3CHD A;  3NTP A;  1KFW A;  2JMF A;  4Z2K A;  5E62 A;  4DRK A;  2PPP A;  3NRK A;  1X6N A;  3O5M A;  4S3J A;  1LL4 A;  5E64 A;  1WNO A;  5HWB A;  3LKX B;  2RUC A;  4MPK A;  4DRI A;  3CZ8 A;  3JYJ A;  4ITZ A;  3IHZ A;  5BXJ A;  1W26 A;  1W9P A;  2L4J A;  1FKK A;  3ARS A;  3PA7 A;  2ZAJ A;  4HBE A;  2JV4 A;  1E9L A;  2ZR6 A;  5I98 A;  3G6L A;  2MLY A;  1KT1 A;  4Z2G A;  4QT2 A;  3NI6 A;  1GUV A;  2YAJ B;  1PIN A;  1QPL A;  2A3C A;  3ARU A;  4Q22 A;  4ODP A;  1HKM A;  2RUR A;  4R0X A;  1HJW A; 
#chains in the Genus database with same CATH homology
 1B6C A;  3JYM A;  3ODK A;  1W9U A;  4ZS6 A;  1FFR A;  1SYT A;  2DSV A;  1JNS A;  3O5O A;  1SR0 A;  3KAG A;  4LAV A;  1ZL1 A;  4NZC A;  1ZK6 A;  3FS8 A;  1ITX A;  3ARQ A;  4Z2I A;  1TR8 A;  2JZV A;  3UQI A;  2B31 A;  3RGC A;  2PV3 A;  1NMW A;  2ZR5 A;  2RQS A;  3UI4 A;  3O5D A;  3ARO A;  4E5R A;  1FAP A;  3PRD A;  3ARP A;  4JYS A;  1D7I A;  2PBC A;  3PQH A;  3WIJ A;  2VN1 A;  1TFV A;  3KAB A;  2O92 A;  2MLX A;  4J4N A;  1J6Y A;  3CGM A;  4QZV B;  2ESC A;  1FKD A;  1EYM A;  2WAE A;  2AWG A;  1NH6 A;  3ALG A;  3O5I A;  2DSU A;  3LKX A;  1LG2 A;  3B8S A;  4W5U A;  2OWO A;  2XP4 A;  4J4O A;  3UQA A;  1HXV A;  4ODL A;  3EY6 A;  4DWS A;  4HBO A;  2MLZ A;  2XP3 A;  2KFW A;  3B7X A;  3KCE A;  3UI6 A;  3ARY A;  3ARZ A;  3AQU A;  2DT0 A;  2KXQ A;  3CHE A;  2DPE A;  5JH8 A;  3FSC A;  5DO2 A;  4MNJ A;  1H0G A;  4DRJ A;  3MQG A;  3WQW A;  4DRQ A;  1WAW A;  4DWS D;  3QOK A;  3O5R A;  3WL0 A;  1GPF A;  3RME A;  5GQB A;  3PR9 A;  2YSF A;  1ZCN A;  2BA1 A;  1E6P A;  3O5F A;  2XP9 A;  3WD3 A;  4ZPV R;  4ODN A;  4IPX A;  1JNT A;  4QT3 A;  3IK8 A;  4DIP A;  1H0I A;  2WAD A;  1I5H W;  3WD2 A;  2ZQU A;  2MPH A;  1Q1C A;  3AS2 A;  1LJY A;  4KR0 B;  5E65 A;  1M5Y A;  4PTM A;  2DK7 A;  3ARR A;  1NWT A;  1ZBK A;  3TCZ A;  1QPF A;  1NMV A;  1D6O A;  2DK1 A;  4C02 B;  3KAC A;  4DWS C;  3FXY A;  3CHC A;  4W9P A;  1OGG A;  4TNS A;  1OGB A;  4DZ3 A;  3KAF A;  3TDB A;  1NWS A;  1CTN A;  2FDM A;  3LE4 A;  1QZ2 A;  2RUQ A;  3RM8 A;  3WKZ A;  2WK2 A;  2PV1 A;  1FKF A;  5HW8 A;  1EG4 A;  2DWV A;  1Q6U A;  3CHF A;  2XP6 A;  4KQZ A;  1Q6I A;  2G41 A;  1ZB5 A;  4WJX A;  3IKD A;  1U79 A;  2FAP A;  2XP7 A;  3O5P A;  2OFN A;  1D7J A;  2M8J A;  1JND A;  4REX A;  1ROT A;  4ZPW R;  5CQ2 A;  2G8Z A;  1HKK A;  5DIU A;  1E15 A;  2ITK A;  3CNG A;  1ZU8 A;  4N19 A;  1K9Q A;  3WD4 A;  1EG3 A;  3B9A A;  4MGV A;  5HUA A;  4TW7 A;  4MTV A;  1EHN A;  2AOS A;  3KAH A;  4Z2J A;  3O5K A;  3FY1 A;  2Q5A A;  1JVW A;  2MDI A;  4L3N A;  4QIB A;  1LL7 A;  2FKE A;  1J4H A;  5HT1 A;  2N87 A;  4W9Q A;  1F8A B;  1J4I A;  1PBK A;  2EZ5 W;  4IT6 A;  4WKA A;  1ROU A;  5HTG A;  1O6W A;  2F4E A;  3TC5 A;  1X6L A;  2YBU A;  2KR7 A;  4LAX A;  3WH0 A;  4WKH A;  2ZR4 A;  4JFI A;  4ML4 A;  4DZ2 A;  4URI A;  2YSG A;  2KGJ A;  2PI6 A;  3WL1 A;  4R5E A;  4LGX A;  4IT4 A;  1WR7 A;  4P8U A;  4TYO A;  1NWR A;  2KE0 A;  5DF0 A;  4L72 B;  2M8I A;  4DT4 A;  4IQ2 A;  3UF8 A;  1D7H A;  2MNT A;  2YBT A;  5HKG A;  1FKB A;  2DSZ A;  1JNE A;  1NWU A;  4HAR A;  1EIB A;  3O5J A;  3B9D A;  4P8X A;  4XAK A;  3GPK A;  2A3A A;  1Y0O A;  1BKF A;  4WIW A;  5J6E A;  1W9V A;  3BXW A;  3ARX A;  2UZ5 A;  1HJV A;  4GGQ A;  3FAP A;  2YSB A;  1XRV A;  2DSW A;  1OWQ A;  2KO7 A;  1ZBW A;  2LKN A;  2DT2 A;  1XHG A;  2A3B A;  1WMV A;  1NSG A;  3O5E A;  3B9E A;  4A0T A;  4MNK A;  2JX8 A;  4DH0 A;  4ZPT R;  1O6I A;  4U84 A;  2ZQS A;  1GOI A;  1R9H A;  1KT0 A;  3MDY B;  4ODR A;  2DG3 A;  2IF4 A;  1ZBC A;  1HKI A;  2DJY A;  2YSI A;  1W1V A;  4IQC A;  3PRA A;  1Q6H A;  1BL4 A;  4MNM A;  3MCB B;  4LAY A;  2XP8 A;  1WB0 A;  4DRH A;  1IX5 A;  2QF8 A;  2LPV A;  3FSB A;  3M85 A;  1FKR A;  4DRN A;  3WD0 A;  3UQB A;  3I6C A;  5HBF A;  5HWC A;  1UR9 A;  1E6N A;  4ODK A;  2M2A A;  4BF8 A;  1K9R A;  4G50 A;  2RE3 A;  1P5Q A;  2VCD A;  1EQ3 A;  2XPA A;  3W4R A;  5E66 A;  2XPB A;  4GIV A;  4DWS B;  1F40 A;  2A3E A;  4FAP A;  2E45 A;  1FKI A;  4DRM A;  2LJ4 A;  1W1P A;  1E6R A;  2O9O A;  1YW5 A;  5DIV A;  4NSB A;  3RM9 A;  1E6Z A;  3H9R B;  3WD1 A;  5B8I C;  1TK7 A;  2DG4 A;  4G2P A;  4W9O A;  2DG9 A;  2D9F A;  3OA5 A;  3JXV A;  5D75 A;  3IKG A;  4Z2L A;  2M3O W;  3AS3 A;  1T11 A;  4ODM A;  1FKG A;  1LQ0 A;  3M7N A;  5DEZ A;  1N1A A;  5AHT A;  2Y8N B;  4JFJ A;  1W1Y A;  1UR8 A;  1HKJ A;  1LL6 A;  3ART A;  1A7X A;  2QRV A;  1TCO C;  3CGN A;  1W1T A;  3CH9 A;  4TW6 A;  4P8V A;  2WLY A;  2ZQT A;  2DMV A;  4TW8 A;  2ZQV A;  4O2T A;  4JFM A;  2JXW A;  1K9T A;  4Z2H A;  1FKL A;  3ALF A;  2IUZ A;  2XP5 A;  4MNL A;  4JFK A;  3PRB A;  1RP5 A;  4ODQ A;  1FLC A;  1FKT A;  3KZ7 A;  4WK9 A;  4U86 A;  3UI5 A;  3KAI A;  3MCB A;  1LG1 A;  5GPG A;  5GPR A;  4DRO A;  3L4H A;  4P8W A;  3O5Q A;  2DT3 A;  2PPO A;  5E5W A;  4WKF A;  1FKH A;  4JFL A;  3RM4 A;  3OOB A;  4FN2 A;  4DRP A;  2YSH A;  1EDQ A;  2PV2 A;  3G6M A;  3O5G A;  3RFW A;  3VAW A;  3AS0 A;  2Y78 A;  2RSE A;  4A0U A;  1FD9 A;  2M08 A;  5DIT A;  1VF8 A;  4GLX A;  4S3K A;  4LAW A;  3MQH A;  1FKS A;  3ARW A;  5HW6 A;  2PPN A;  4Q7N A;  1FJD A;  1ZBV A;  1J4R A;  2L2S A;  2DT1 A;  4AY1 A;  2LGO A;  1JMQ A;  2F2D A;  3WQV A;  4NNR A;  1YAT A;  1RD6 A;  2WM0 A;  1FFQ A;  1FKJ A;  5HW7 A;  1D2K A;  2LAJ A;  3O5L A;  2KI3 A;  3KAD A;  3LUO A;  2RUD A;  2F21 A;  2MF9 A;  4U85 A;  2K8I A;  3ARV A;  5U47 A;  2WLZ A;  2OLH A;  1HJX A;  3AS1 A;  4ODO A;  1C9H A;  2M1I A;  1L1P A;  4TX0 A;  4MAV A;  4MSP A;  3CHD A;  3NTP A;  1KFW A;  2JMF A;  4Z2K A;  5E62 A;  4DRK A;  2PPP A;  3NRK A;  1X6N A;  3O5M A;  4S3J A;  1LL4 A;  5E64 A;  1WNO A;  5HWB A;  3LKX B;  2RUC A;  4MPK A;  4DRI A;  3CZ8 A;  3JYJ A;  4ITZ A;  3IHZ A;  5BXJ A;  1W26 A;  1W9P A;  2L4J A;  1FKK A;  3ARS A;  3PA7 A;  2ZAJ A;  4HBE A;  2JV4 A;  1E9L A;  2ZR6 A;  5I98 A;  3G6L A;  2MLY A;  1KT1 A;  4Z2G A;  4QT2 A;  3NI6 A;  1GUV A;  2YAJ B;  1PIN A;  1QPL A;  2A3C A;  3ARU A;  4Q22 A;  4ODP A;  1HKM A;  2RUR A;  4R0X A;  1HJW A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...