1ZCNA

Human pin1 ng mutant
Total Genus 47
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
47
sequence length
155
structure length
143
Chain Sequence
LPPGWEKRMSNGRVYYFNHITNASQWERPSEPARVRCSHLLVKHSQSRRPSSWRQEKITRTKEEALELINGYIQKIKSGEEDFESLASQFSDCSSAKARGDLGAFSRGQMQKPFEDASFALRTGEMSGPVFTDSGIHIILRTE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure-function-folding relationship in a WW domain.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Isomerase
molecule keywords Peptidyl-prolyl cis-trans isomerase NIMA-interacting 1
total genus 47
structure length 143
sequence length 155
ec nomenclature ec 5.2.1.8: Peptidylprolyl isomerase.
pdb deposition date 2005-04-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00397 WW WW domain
A PF00639 Rotamase PPIC-type PPIASE domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.20.70.10 Mainly Beta Single Sheet Ubiquitin Ligase Nedd4; Chain: W; Ubiquitin Ligase Nedd4; Chain: W; 1zcnA01
3.10.50.40 Alpha Beta Roll Chitinase A; domain 3 Chitinase A; domain 3 1zcnA02
2AWGA 1ZCNA 3WH0A 2MLZA 4J4NA 4QT3A 4FAPA 2YSFA 1U79A 3OOBA 5AHTA 3O5OA 1WR7A 1KT1A 2IF4A 2Y78A 1O6WA 1Y0OA 4DIPA 1D7HA 3IK8A 1B6CA 1M5YA 2L2SA 5HWBA 2DMVA 1J4IA 1R9HA 2RSEA 4W9QA 4ODPA 1HXVA 3PA7A 2ZAJA 2DG9A 1NMVA 3O5RA 1FKIA 2JV4A 2PPPA 4ODRA 2OFNA 4DZ2A 2VCDA 3GPKA 3O5JA 4MGVA 3TDBA 3L4HA 2D9FA 3O5IA 1FKBA 1FKRA 2RUQA 1KT0A 3M7NA 4ODNA 2JXWA 2XP3A 1Q1CA 3CNGA 3O5QA 4G50A 2YSGA 4DRNA 2PPOA 1F40A 4LAWA 3UI5A 3MDYB 4QIBA 3IKDA 2JMFA 4U84A 1FKFA 1ROTA 2XP4A 3M85A 3PRBA 2XP5A 1D7JA 1Q6UA 5B8IC 1Q6IA 2DG4A 1FKLA 2XPBA 5J6EA 2ZQVA 1J4RA 1EYMA 2FKEA 3O5EA 5HTGA 3O5MA 2YSIA 3UI6A 1JNSA 3KZ7A 4DH0A 2M1IA 4QT2A 5BXJA 2KI3A 4MSPA 2DK1A 2XP7A 1N1AA 2DG3A 1PBKA 2VN1A 4C02B 4JFKA 1EG3A 2ZR5A 2LPVA 4ODOA 2K8IA 4TNSA 1PINA 3JYJA 3PRDA 2RQSA 4TW7A 2YSHA 4JYSA 5DITA 1QZ2A 3O5DA 3UF8A 4DT4A 2KE0A 2PV1A 4NNRA 3KCEA 3UI4A 4DRJA 4JFMA 4IPXA 2KXQA 2JZVA 3VAWA 4JFIA 3FAPA 3O5PA 2PBCA 1BL4A 1C9HA 2MNTA 4LAXA 2MLXA 5HUAA 3O5GA 2RE3A 4JFLA 2JX8A 2DK7A 4G2PA 3NI6A 1K9RA 3H9RB 1FKSA 2M08A 1FJDA 1NSGA 1FKJA 5GPGA 1TK7A 4BF8A 3CGNA 1BKFA 3TC5A 2RURA 2ZQUA 2RUCA 5DIUA 3KABA 1F8AB 2LAJA 3NTPA 4IQCA 4W9PA 1QPLA 2FAPA 1W26A 3KAHA 1NMWA 2MDIA 1YATA 4GIVA 4DRIA 2MLYA 4DZ3A 2M2AA 2LKNA 1L1PA 3NRKA 1J6YA 4LAYA 4DRPA 1P5QA 1JMQA 1ZK6A 1JNTA 2ZR6A 2KO7A 3KACA 5HWCA 3UQAA 2MF9A 3B7XA 4REXA 4TYOA 1A7XA 4DRMA 3UQBA 3KAFA 2XP9A 2Q5AA 5D75A 1ROUA 2DWVA 2ZQTA 4TX0A 2RUDA 4GGQA 4N19A 1YW5A 1D7IA 1WMVA 1FKTA 4O2TA 4TW6A 2UZ5A 4ODKA 4W9OA 2F2DA 5CQ2A 4ODQA 3RFWA 3KAIA 3KAGA 2F21A 1FKHA 3TCZA 4R0XA 2BA1A 2XPAA 2KFWA 3CGMA 3EY6A 4IQ2A 4LAVA 1Q6HA 2YSBA 3IKGA 1FD9A 2N87A 2DJYA 1FAPA 2M8IA 4U85A 4J4OA 1FKKA 4DRKA 1T11A 1K9QA 3JYMA 4DRHA 2PPNA 3ODKA 3KADA 2L4JA 2LGOA 3O5LA 3UQIA 4DRQA 3IHZA 2F4EA 5HKGA 3LUOA 2PV3A 3O5FA 3I6CA 1D6OA 4ODLA 4DROA 3O5KA 2EZ5W 1FKGA 2ZR4A 1J4HA 2KR7A 2M8JA 1I5HW 1QPFA 3RGCA 2MPHA 1EQ3A 1TCOC 2ITKA 2XP6A 5HT1A 4TW8A 5HW8A 1EG4A 3LE4A 2M3OW 4FN2A 4ODMA 1FKDA 2E45A 2XP8A 2KGJA 3JXVA 2PV2A 5DIVA 2ZQSA 2LJ4A 5HW7A 4E5RA 4JFJA 5HW6A 5I98A 1JVWA 4ITZA 4U86A
chains in the Genus database with same CATH superfamily
4LGXA 4DWSA 2MLZA 3QOKA 1LL4A 4FAPA 1W9UA 4DIPA 1E6RA 2OLHA 1M5YA 2L2SA 3ARPA 5HWBA 2DMVA 2DG9A 1JCHB 2OFNA 2YAJB 3O5JA 4GLXA 1SR0A 2JXWA 3O5QA 3WKZA 1OWQA 2PPOA 4MNMA 1IX5A 3IKDA 2JMFA 1FKFA 4ZPVR 5DF0A 1Q6IA 1JNSA 3OA5A 2A3CA 1EYMA 2FKEA 4XAKA 4P8XA 2A3AA 4R5EA 4DH0A 2DK1A 3GTYX 1N1AA 1PBKA 3WD0A 1EG3A 4TNSA 3WQVA 2RQSA 1HJXA 3ARQA 2YSHA 4JYSA 1ZU8A 4DRJA 3VAWA 3FAPA 3O5PA 1X6NA 5HBFA 1W9PA 4MNJA 3PR9A 2WLYA 2F23A 3O5GA 4JFLA 4G2PA 1K9RA 1RD6A 3G6MA 3CGNA 2RURA 2WAEA 3W4RA 4Q7NA 3WD2A 1E15A 1WAWA 2LKNA 2WLZA 4Q22A 1ZK6A 3FSCA 3CHDA 2MF9A 2XP9A 5D75A 2DWVA 4P8WA 4TX0A 2RUDA 4N19A 4W9OA 1E44A 1HJWA 2F2DA 3RFWA 2DSZA 3KAGA 2F21A 2KFWA 3CGMA 4LAVA 3B9EA 1NWUA 1FD9A 4IT6A 5GPRA 1FKKA 4MNLA 4MPKA 2PV3A 3I6CA 1D6OA 4ODLA 3ARZA 3RGCA 2MPHA 2DT3A 2XP6A 1EG4A 1XRVA 1UR9A 1FKDA 1FFQA 2YBUA 4E5RA 3FXYA 5I98A 5JH8A 4ITZA 2ITKA 4NNRA 2AWGA 1ZCNA 4ZPWR 4QT3A 1HKKA 5E62A 1H0GA 3ARUA 5E65A 2DSUA 1Y0OA 1R9HA 1J4IA 2RSEA 4W9QA 1HXVA 1NMVA 3CH9A 2PPPA 4DZ2A 2VCDA 4IT4A 4MGVA 3TDBA 3B8SA 3L4HA 3O5IA 4P8UA 2RUQA 5DEZA 4Z2IA 4G50A 2YSGA 4ZS6A 4AY1A 3UI5A 3MDYB 3AS1A 2G8ZA 4U84A 1UR8A 2DT2A 1ROTA 3MCBB 1KFWA 5B8IC 5J6EA 2ZQVA 3O5EA 3O5MA 2YSIA 3KZ7A 2M1IA 5BXJA 2EULA 2VN1A 4ZPTR 1WNOA 4TW7A 5DITA 3O5DA 4DT4A 2KE0A 2PV1A 3WQWA 4JFIA 4LAXA 4QZVB 2PBCA 1C9HA 2MNTA 3WD4A 4Z2GA 2MLXA 1FLCA 3ARWA 2JX8A 3LKXA 1E6NA 2DPEA 1FKSA 1FKJA 5GPGA 1HKMA 4A0TA 3CHCA 2O92A 1JNEA 1WB0A 2IUZA 3FS8A 1EDQA 1NMWA 2MDIA 4GIVA 2MLYA 4WKHA 2M2AA 1J6YA 4LAYA 1JMQA 3ALFA 1JNTA 1CTNA 5E5WA 5HWCA 3UQAA 3B7XA 4REXA 4TYOA 3UQBA 1K9TA 3RM4A 2Y8NB 4WKFA 4MAVA 2ZQTA 4O2TA 1NWRA 4ODKA 4ODQA 4KR0B 2BA1A 5U47A 3LKXB 4WIWA 1FAPA 2M8IA 4U85A 5DO2A 1LQ0A 2PPNA 3ODKA 3KADA 2ETNA 3AQUA 3UQIA 3RM9A 3IHZA 2A3EA 3LUOA 3EIPA 2EZ5W 1J4HA 2QF8A 1I5HW 1ZL1A 3MQGA 4S3JA 2M3OW 1LJYA 4FN2A 3WL1A 2KGJA 5DIVA 4MNKA 4Z2KA 5HW7A 5E66A 4JFJA 4U86A 1NWSA 4DWSC 2YSFA 3O5OA 5AHTA 1WR7A 1KT1A 2IF4A 2Y78A 1O6WA 3IK8A 4WKAA 2G41A 1W9VA 3PA7A 4Z2JA 3GPKA 1TFVA 1FKBA 4ODNA 3AS3A 3CNGA 4DRNA 3ALGA 3FY1A 4LAWA 1F40A 4QIBA 3M85A 3PRBA 1D7JA 1Q6UA 2B5UB 2DG4A 5HTGA 1J4RA 3PRAA 3B9AA 3CZ8A 1GRJA 1ZBCA 1LL7A 4QT2A 2KI3A 4MSPA 2DG3A 4C02B 2ZR5A 3PRDA 4IPXA 3CHFA 1LG1A 2JZVA 1XHGA 3FSBA 1GPFA 3ARRA 3NI6A 1FJDA 1ZBVA 1TK7A 4BF8A 3TC5A 2ZQUA 2DSWA 2RUCA 3KABA 1F8AB 2LAJA 3B9DA 4IQCA 1QPLA 1EHNA 4DZ3A 1YATA 1NWTA 3NRKA 1L1PA 3BXWA 4DRPA 3KACA 2KO7A 1JNDA 1H0IA 4MTVA 1A7XA 1ROUA 4GGQA 1YW5A 1D7IA 1FKTA 2UZ5A 5CQ2A 1FKHA 2XPAA 1Q6HA 2YSBA 1TR8A 2ESCA 3IKGA 4P8VA 1OGGA 1W1PA 4DRKA 3RM8A 1EIBA 4Z2LA 4URIA 4NSBA 2L4JA 2LGOA 3G6LA 4DRQA 3MQHA 2F4EA 3O5FA 2WK2A 1GUVA 1FKGA 2M8JA 1TCOC 4TW8A 2DSVA 5GQBA 5HW8A 1VF8A 1OGBA 3WIJA 2PV2A 2ZQSA 2LJ4A 5HW6A 2P4VA 1JVWA 3WL0A 2AOSA 4HBEA 4J4NA 3WH0A 1U79A 3OOBA 1FFRA 1D7HA 1B6CA 1D2KA 3ARXA 2DT0A 4ODPA 2ZAJA 2WM0A 3O5RA 1FKIA 1E9LA 2JV4A 1EQ3A 4ODRA 1HKJA 2D9FA 3RMEA 1FKRA 1KT0A 3M7NA 4Z2HA 2XP3A 1Q1CA 3MCBA 1LL6A 3AS2A 3PQHA 1E6ZA 2XP4A 2XP5A 1SYTA 3CHEA 1FKLA 2XPBA 1ITXA 1RP5A 1GOIA 3ARVA 3UI6A 4W5UA 2XP7A 1HKIA 2YBTA 4JFKA 2A3BA 2LPVA 4ODOA 4WJXA 2K8IA 1PINA 3JYJA 2FDMA 1QZ2A 3UF8A 4L72B 3KCEA 3UI4A 1O6IA 4JFMA 2KXQA 2PI6A 5HUAA 2WADA 1BL4A 4DWSD 4HBOA 3BMBA 2RE3A 2DK7A 2OWOA 2PN0A 3H9RB 2M08A 1NSGA 4KQZA 3ARSA 3ARTA 1ZB5A 1W1TA 1BKFA 5DIUA 1E6PA 3NTPA 4W9PA 2FAPA 1W26A 3KAHA 4NZCA 4PTMA 4DRIA 1ZBKA 3WD3A 1P5QA 2ZR6A 4DRMA 3KAFA 4WK9A 2Q5AA 1WMVA 4TW6A 3KAIA 4R0XA 3TCZA 3EY6A 2DT1A 4IQ2A 3AS0A 2QRVA 2N87A 2DJYA 4J4OA 4DRHA 1T11A 1K9QA 3JYMA 1NH6A 5E64A 2B31A 3O5LA 1HJVA 4L3NA 5HKGA 1ZBWA 3O5KA 4DROA 1W1YA 2ZR4A 2KR7A 4S3KA 1QPFA 4ML4A 4UDMA 4A0UA 1LG2A 2O9OA 3AROA 3GU0A 5HT1A 3ARYA 3LE4A 1X6LA 4ODMA 4DWSB 4HARA 2E45A 2XP8A 3JXVA 1W1VA 3WD1A
chains in the Genus database with same CATH topology
4LGXA 4DWSA 2MLZA 3QOKA 1LL4A 4FAPA 1W9UA 4DIPA 1E6RA 2OLHA 1M5YA 2L2SA 3ARPA 5HWBA 2DMVA 2DG9A 2OFNA 2YAJB 3O5JA 4GLXA 1SR0A 2JXWA 3O5QA 3WKZA 1OWQA 2PPOA 4MNMA 1IX5A 3IKDA 2JMFA 1FKFA 4ZPVR 5DF0A 1Q6IA 1JNSA 3OA5A 2A3CA 1EYMA 2FKEA 4XAKA 4P8XA 2A3AA 4R5EA 4DH0A 2DK1A 1N1AA 1PBKA 3WD0A 1EG3A 4TNSA 3WQVA 2RQSA 1HJXA 3ARQA 2YSHA 4JYSA 1ZU8A 4DRJA 3VAWA 3FAPA 3O5PA 1X6NA 5HBFA 1W9PA 4MNJA 3PR9A 2WLYA 3O5GA 4JFLA 4G2PA 1K9RA 1RD6A 3G6MA 3CGNA 2RURA 2WAEA 3W4RA 4Q7NA 3WD2A 1E15A 1WAWA 2LKNA 2WLZA 4Q22A 1ZK6A 3FSCA 3CHDA 2MF9A 2XP9A 5D75A 2DWVA 4P8WA 4TX0A 2RUDA 4N19A 4W9OA 1HJWA 2F2DA 3RFWA 2DSZA 3KAGA 2F21A 2KFWA 3CGMA 4LAVA 3B9EA 1NWUA 1FD9A 4IT6A 5GPRA 1FKKA 4MNLA 4MPKA 2PV3A 3I6CA 1D6OA 4ODLA 3ARZA 3RGCA 2MPHA 2DT3A 2XP6A 1EG4A 1XRVA 1UR9A 1FKDA 1FFQA 2YBUA 4E5RA 3FXYA 5I98A 5JH8A 4ITZA 2ITKA 4NNRA 2AWGA 1ZCNA 4ZPWR 4QT3A 1HKKA 5E62A 1H0GA 3ARUA 5E65A 2DSUA 1Y0OA 1R9HA 1J4IA 2RSEA 4W9QA 1HXVA 1NMVA 3CH9A 2PPPA 4DZ2A 2VCDA 4IT4A 4MGVA 3TDBA 3B8SA 3L4HA 3O5IA 4P8UA 2RUQA 5DEZA 4Z2IA 4G50A 2YSGA 4ZS6A 4AY1A 3UI5A 3MDYB 3AS1A 2G8ZA 4U84A 1UR8A 2DT2A 1ROTA 3MCBB 1KFWA 5B8IC 5J6EA 2ZQVA 3O5EA 3O5MA 2YSIA 3KZ7A 2M1IA 5BXJA 2VN1A 4ZPTR 1WNOA 4TW7A 5DITA 3O5DA 4DT4A 2KE0A 2PV1A 3WQWA 4JFIA 4LAXA 4QZVB 2PBCA 1C9HA 2MNTA 3WD4A 4Z2GA 2MLXA 1FLCA 3ARWA 2JX8A 3LKXA 1E6NA 2DPEA 1FKSA 1FKJA 5GPGA 1HKMA 4A0TA 3CHCA 2O92A 1JNEA 1WB0A 2IUZA 3FS8A 1EDQA 1NMWA 2MDIA 4GIVA 2MLYA 4WKHA 2M2AA 1J6YA 4LAYA 1JMQA 3ALFA 1JNTA 1CTNA 5E5WA 5HWCA 3UQAA 3B7XA 4REXA 4TYOA 3UQBA 1K9TA 3RM4A 2Y8NB 4WKFA 4MAVA 2ZQTA 4O2TA 1NWRA 4ODKA 4ODQA 4KR0B 2BA1A 5U47A 3LKXB 4WIWA 1FAPA 2M8IA 4U85A 5DO2A 1LQ0A 2PPNA 3ODKA 3KADA 3AQUA 3UQIA 3RM9A 3IHZA 2A3EA 3LUOA 2EZ5W 1J4HA 2QF8A 1I5HW 1ZL1A 3MQGA 4S3JA 2M3OW 1LJYA 4FN2A 3WL1A 2KGJA 5DIVA 4MNKA 4Z2KA 5HW7A 5E66A 4JFJA 4U86A 1NWSA 4DWSC 2YSFA 3O5OA 5AHTA 1WR7A 1KT1A 2IF4A 2Y78A 1O6WA 3IK8A 4WKAA 2G41A 1W9VA 3PA7A 4Z2JA 3GPKA 1TFVA 1FKBA 4ODNA 3AS3A 3CNGA 4DRNA 3ALGA 3FY1A 4LAWA 1F40A 4QIBA 3M85A 3PRBA 1D7JA 1Q6UA 2DG4A 5HTGA 1J4RA 3PRAA 3B9AA 3CZ8A 1ZBCA 1LL7A 4QT2A 2KI3A 4MSPA 2DG3A 4C02B 2ZR5A 3PRDA 4IPXA 3CHFA 1LG1A 2JZVA 1XHGA 3FSBA 1GPFA 3ARRA 3NI6A 1FJDA 1ZBVA 1TK7A 4BF8A 3TC5A 2ZQUA 2DSWA 2RUCA 3KABA 1F8AB 2LAJA 3B9DA 4IQCA 1QPLA 1EHNA 4DZ3A 1YATA 1NWTA 3NRKA 1L1PA 3BXWA 4DRPA 3KACA 2KO7A 1JNDA 1H0IA 4MTVA 1A7XA 1ROUA 4GGQA 1YW5A 1D7IA 1FKTA 2UZ5A 5CQ2A 1FKHA 2XPAA 1Q6HA 2YSBA 1TR8A 2ESCA 3IKGA 4P8VA 1OGGA 1W1PA 4DRKA 3RM8A 1EIBA 4Z2LA 4URIA 4NSBA 2L4JA 2LGOA 3G6LA 4DRQA 3MQHA 2F4EA 3O5FA 2WK2A 1GUVA 1FKGA 2M8JA 1TCOC 4TW8A 2DSVA 5GQBA 5HW8A 1VF8A 1OGBA 3WIJA 2PV2A 2ZQSA 2LJ4A 5HW6A 1JVWA 3WL0A 2AOSA 4HBEA 4J4NA 3WH0A 1U79A 3OOBA 1FFRA 1D7HA 1B6CA 1D2KA 3ARXA 2DT0A 4ODPA 2ZAJA 2WM0A 3O5RA 1FKIA 1E9LA 2JV4A 1EQ3A 4ODRA 1HKJA 2D9FA 3RMEA 1FKRA 1KT0A 3M7NA 4Z2HA 2XP3A 1Q1CA 3MCBA 1LL6A 3AS2A 3PQHA 1E6ZA 2XP4A 2XP5A 1SYTA 3CHEA 1FKLA 2XPBA 1ITXA 1RP5A 1GOIA 3ARVA 3UI6A 4W5UA 2XP7A 1HKIA 2YBTA 4JFKA 2A3BA 2LPVA 4ODOA 4WJXA 2K8IA 1PINA 3JYJA 2FDMA 1QZ2A 3UF8A 4L72B 3KCEA 3UI4A 1O6IA 4JFMA 2KXQA 2PI6A 5HUAA 2WADA 1BL4A 4DWSD 4HBOA 2RE3A 2DK7A 2OWOA 3H9RB 2M08A 1NSGA 4KQZA 3ARSA 3ARTA 1ZB5A 1W1TA 1BKFA 5DIUA 1E6PA 3NTPA 4W9PA 2FAPA 1W26A 3KAHA 4NZCA 4PTMA 4DRIA 1ZBKA 3WD3A 1P5QA 2ZR6A 4DRMA 3KAFA 4WK9A 2Q5AA 1WMVA 4TW6A 3KAIA 4R0XA 3TCZA 3EY6A 2DT1A 4IQ2A 3AS0A 2QRVA 2N87A 2DJYA 4J4OA 4DRHA 1T11A 1K9QA 3JYMA 1NH6A 5E64A 2B31A 3O5LA 1HJVA 4L3NA 5HKGA 1ZBWA 3O5KA 4DROA 1W1YA 2ZR4A 2KR7A 4S3KA 1QPFA 4ML4A 4A0UA 1LG2A 2O9OA 3AROA 5HT1A 3ARYA 3LE4A 1X6LA 4ODMA 4DWSB 4HARA 2E45A 2XP8A 3JXVA 1W1VA 3WD1A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2AWG A;  1ZCN A;  3WH0 A;  2MLZ A;  4J4N A;  4QT3 A;  4FAP A;  2YSF A;  1U79 A;  3OOB A;  5AHT A;  3O5O A;  1WR7 A;  1KT1 A;  2IF4 A;  2Y78 A;  1O6W A;  1Y0O A;  4DIP A;  1D7H A;  3IK8 A;  1B6C A;  1M5Y A;  2L2S A;  5HWB A;  2DMV A;  1J4I A;  1R9H A;  2RSE A;  4W9Q A;  4ODP A;  1HXV A;  3PA7 A;  2ZAJ A;  2DG9 A;  1NMV A;  3O5R A;  1FKI A;  2JV4 A;  2PPP A;  4ODR A;  2OFN A;  4DZ2 A;  2VCD A;  3GPK A;  3O5J A;  4MGV A;  3TDB A;  3L4H A;  2D9F A;  3O5I A;  1FKB A;  1FKR A;  2RUQ A;  1KT0 A;  3M7N A;  4ODN A;  2JXW A;  2XP3 A;  1Q1C A;  3CNG A;  3O5Q A;  4G50 A;  2YSG A;  4DRN A;  2PPO A;  1F40 A;  4LAW A;  3UI5 A;  3MDY B;  4QIB A;  3IKD A;  2JMF A;  4U84 A;  1FKF A;  1ROT A;  2XP4 A;  3M85 A;  3PRB A;  2XP5 A;  1D7J A;  1Q6U A;  5B8I C;  1Q6I A;  2DG4 A;  1FKL A;  2XPB A;  5J6E A;  2ZQV A;  1J4R A;  1EYM A;  2FKE A;  3O5E A;  5HTG A;  3O5M A;  2YSI A;  3UI6 A;  1JNS A;  3KZ7 A;  4DH0 A;  2M1I A;  4QT2 A;  5BXJ A;  2KI3 A;  4MSP A;  2DK1 A;  2XP7 A;  1N1A A;  2DG3 A;  1PBK A;  2VN1 A;  4C02 B;  4JFK A;  1EG3 A;  2ZR5 A;  2LPV A;  4ODO A;  2K8I A;  4TNS A;  1PIN A;  3JYJ A;  3PRD A;  2RQS A;  4TW7 A;  2YSH A;  4JYS A;  5DIT A;  1QZ2 A;  3O5D A;  3UF8 A;  4DT4 A;  2KE0 A;  2PV1 A;  4NNR A;  3KCE A;  3UI4 A;  4DRJ A;  4JFM A;  4IPX A;  2KXQ A;  2JZV A;  3VAW A;  4JFI A;  3FAP A;  3O5P A;  2PBC A;  1BL4 A;  1C9H A;  2MNT A;  4LAX A;  2MLX A;  5HUA A;  3O5G A;  2RE3 A;  4JFL A;  2JX8 A;  2DK7 A;  4G2P A;  3NI6 A;  1K9R A;  3H9R B;  1FKS A;  2M08 A;  1FJD A;  1NSG A;  1FKJ A;  5GPG A;  1TK7 A;  4BF8 A;  3CGN A;  1BKF A;  3TC5 A;  2RUR A;  2ZQU A;  2RUC A;  5DIU A;  3KAB A;  1F8A B;  2LAJ A;  3NTP A;  4IQC A;  4W9P A;  1QPL A;  2FAP A;  1W26 A;  3KAH A;  1NMW A;  2MDI A;  1YAT A;  4GIV A;  4DRI A;  2MLY A;  4DZ3 A;  2M2A A;  2LKN A;  1L1P A;  3NRK A;  1J6Y A;  4LAY A;  4DRP A;  1P5Q A;  1JMQ A;  1ZK6 A;  1JNT A;  2ZR6 A;  2KO7 A;  3KAC A;  5HWC A;  3UQA A;  2MF9 A;  3B7X A;  4REX A;  4TYO A;  1A7X A;  4DRM A;  3UQB A;  3KAF A;  2XP9 A;  2Q5A A;  5D75 A;  1ROU A;  2DWV A;  2ZQT A;  4TX0 A;  2RUD A;  4GGQ A;  4N19 A;  1YW5 A;  1D7I A;  1WMV A;  1FKT A;  4O2T A;  4TW6 A;  2UZ5 A;  4ODK A;  4W9O A;  2F2D A;  5CQ2 A;  4ODQ A;  3RFW A;  3KAI A;  3KAG A;  2F21 A;  1FKH A;  3TCZ A;  4R0X A;  2BA1 A;  2XPA A;  2KFW A;  3CGM A;  3EY6 A;  4IQ2 A;  4LAV A;  1Q6H A;  2YSB A;  3IKG A;  1FD9 A;  2N87 A;  2DJY A;  1FAP A;  2M8I A;  4U85 A;  4J4O A;  1FKK A;  4DRK A;  1T11 A;  1K9Q A;  3JYM A;  4DRH A;  2PPN A;  3ODK A;  3KAD A;  2L4J A;  2LGO A;  3O5L A;  3UQI A;  4DRQ A;  3IHZ A;  2F4E A;  5HKG A;  3LUO A;  2PV3 A;  3O5F A;  3I6C A;  1D6O A;  4ODL A;  4DRO A;  3O5K A;  2EZ5 W;  1FKG A;  2ZR4 A;  1J4H A;  2KR7 A;  2M8J A;  1I5H W;  1QPF A;  3RGC A;  2MPH A;  1EQ3 A;  1TCO C;  2ITK A;  2XP6 A;  5HT1 A;  4TW8 A;  5HW8 A;  1EG4 A;  3LE4 A;  2M3O W;  4FN2 A;  4ODM A;  1FKD A;  2E45 A;  2XP8 A;  2KGJ A;  3JXV A;  2PV2 A;  5DIV A;  2ZQS A;  2LJ4 A;  5HW7 A;  4E5R A;  4JFJ A;  5HW6 A;  5I98 A;  1JVW A;  4ITZ A;  4U86 A; 
#chains in the Genus database with same CATH topology
 4LGX A;  4DWS A;  2MLZ A;  3QOK A;  1LL4 A;  4FAP A;  1W9U A;  4DIP A;  1E6R A;  2OLH A;  1M5Y A;  2L2S A;  3ARP A;  5HWB A;  2DMV A;  2DG9 A;  1JCH B;  2OFN A;  2YAJ B;  3O5J A;  4GLX A;  1SR0 A;  2JXW A;  3O5Q A;  3WKZ A;  1OWQ A;  2PPO A;  4MNM A;  1IX5 A;  3IKD A;  2JMF A;  1FKF A;  4ZPV R;  5DF0 A;  1Q6I A;  1JNS A;  3OA5 A;  2A3C A;  1EYM A;  2FKE A;  4XAK A;  4P8X A;  2A3A A;  4R5E A;  4DH0 A;  2DK1 A;  3GTY X;  1N1A A;  1PBK A;  3WD0 A;  1EG3 A;  4TNS A;  3WQV A;  2RQS A;  1HJX A;  3ARQ A;  2YSH A;  4JYS A;  1ZU8 A;  4DRJ A;  3VAW A;  3FAP A;  3O5P A;  1X6N A;  5HBF A;  1W9P A;  4MNJ A;  3PR9 A;  2WLY A;  2F23 A;  3O5G A;  4JFL A;  4G2P A;  1K9R A;  1RD6 A;  3G6M A;  3CGN A;  2RUR A;  2WAE A;  3W4R A;  4Q7N A;  3WD2 A;  1E15 A;  1WAW A;  2LKN A;  2WLZ A;  4Q22 A;  1ZK6 A;  3FSC A;  3CHD A;  2MF9 A;  2XP9 A;  5D75 A;  2DWV A;  4P8W A;  4TX0 A;  2RUD A;  4N19 A;  4W9O A;  1E44 A;  1HJW A;  2F2D A;  3RFW A;  2DSZ A;  3KAG A;  2F21 A;  2KFW A;  3CGM A;  4LAV A;  3B9E A;  1NWU A;  1FD9 A;  4IT6 A;  5GPR A;  1FKK A;  4MNL A;  4MPK A;  2PV3 A;  3I6C A;  1D6O A;  4ODL A;  3ARZ A;  3RGC A;  2MPH A;  2DT3 A;  2XP6 A;  1EG4 A;  1XRV A;  1UR9 A;  1FKD A;  1FFQ A;  2YBU A;  4E5R A;  3FXY A;  5I98 A;  5JH8 A;  4ITZ A;  2ITK A;  4NNR A;  2AWG A;  1ZCN A;  4ZPW R;  4QT3 A;  1HKK A;  5E62 A;  1H0G A;  3ARU A;  5E65 A;  2DSU A;  1Y0O A;  1R9H A;  1J4I A;  2RSE A;  4W9Q A;  1HXV A;  1NMV A;  3CH9 A;  2PPP A;  4DZ2 A;  2VCD A;  4IT4 A;  4MGV A;  3TDB A;  3B8S A;  3L4H A;  3O5I A;  4P8U A;  2RUQ A;  5DEZ A;  4Z2I A;  4G50 A;  2YSG A;  4ZS6 A;  4AY1 A;  3UI5 A;  3MDY B;  3AS1 A;  2G8Z A;  4U84 A;  1UR8 A;  2DT2 A;  1ROT A;  3MCB B;  1KFW A;  5B8I C;  5J6E A;  2ZQV A;  3O5E A;  3O5M A;  2YSI A;  3KZ7 A;  2M1I A;  5BXJ A;  2EUL A;  2VN1 A;  4ZPT R;  1WNO A;  4TW7 A;  5DIT A;  3O5D A;  4DT4 A;  2KE0 A;  2PV1 A;  3WQW A;  4JFI A;  4LAX A;  4QZV B;  2PBC A;  1C9H A;  2MNT A;  3WD4 A;  4Z2G A;  2MLX A;  1FLC A;  3ARW A;  2JX8 A;  3LKX A;  1E6N A;  2DPE A;  1FKS A;  1FKJ A;  5GPG A;  1HKM A;  4A0T A;  3CHC A;  2O92 A;  1JNE A;  1WB0 A;  2IUZ A;  3FS8 A;  1EDQ A;  1NMW A;  2MDI A;  4GIV A;  2MLY A;  4WKH A;  2M2A A;  1J6Y A;  4LAY A;  1JMQ A;  3ALF A;  1JNT A;  1CTN A;  5E5W A;  5HWC A;  3UQA A;  3B7X A;  4REX A;  4TYO A;  3UQB A;  1K9T A;  3RM4 A;  2Y8N B;  4WKF A;  4MAV A;  2ZQT A;  4O2T A;  1NWR A;  4ODK A;  4ODQ A;  4KR0 B;  2BA1 A;  5U47 A;  3LKX B;  4WIW A;  1FAP A;  2M8I A;  4U85 A;  5DO2 A;  1LQ0 A;  2PPN A;  3ODK A;  3KAD A;  2ETN A;  3AQU A;  3UQI A;  3RM9 A;  3IHZ A;  2A3E A;  3LUO A;  3EIP A;  2EZ5 W;  1J4H A;  2QF8 A;  1I5H W;  1ZL1 A;  3MQG A;  4S3J A;  2M3O W;  1LJY A;  4FN2 A;  3WL1 A;  2KGJ A;  5DIV A;  4MNK A;  4Z2K A;  5HW7 A;  5E66 A;  4JFJ A;  4U86 A;  1NWS A;  4DWS C;  2YSF A;  3O5O A;  5AHT A;  1WR7 A;  1KT1 A;  2IF4 A;  2Y78 A;  1O6W A;  3IK8 A;  4WKA A;  2G41 A;  1W9V A;  3PA7 A;  4Z2J A;  3GPK A;  1TFV A;  1FKB A;  4ODN A;  3AS3 A;  3CNG A;  4DRN A;  3ALG A;  3FY1 A;  4LAW A;  1F40 A;  4QIB A;  3M85 A;  3PRB A;  1D7J A;  1Q6U A;  2B5U B;  2DG4 A;  5HTG A;  1J4R A;  3PRA A;  3B9A A;  3CZ8 A;  1GRJ A;  1ZBC A;  1LL7 A;  4QT2 A;  2KI3 A;  4MSP A;  2DG3 A;  4C02 B;  2ZR5 A;  3PRD A;  4IPX A;  3CHF A;  1LG1 A;  2JZV A;  1XHG A;  3FSB A;  1GPF A;  3ARR A;  3NI6 A;  1FJD A;  1ZBV A;  1TK7 A;  4BF8 A;  3TC5 A;  2ZQU A;  2DSW A;  2RUC A;  3KAB A;  1F8A B;  2LAJ A;  3B9D A;  4IQC A;  1QPL A;  1EHN A;  4DZ3 A;  1YAT A;  1NWT A;  3NRK A;  1L1P A;  3BXW A;  4DRP A;  3KAC A;  2KO7 A;  1JND A;  1H0I A;  4MTV A;  1A7X A;  1ROU A;  4GGQ A;  1YW5 A;  1D7I A;  1FKT A;  2UZ5 A;  5CQ2 A;  1FKH A;  2XPA A;  1Q6H A;  2YSB A;  1TR8 A;  2ESC A;  3IKG A;  4P8V A;  1OGG A;  1W1P A;  4DRK A;  3RM8 A;  1EIB A;  4Z2L A;  4URI A;  4NSB A;  2L4J A;  2LGO A;  3G6L A;  4DRQ A;  3MQH A;  2F4E A;  3O5F A;  2WK2 A;  1GUV A;  1FKG A;  2M8J A;  1TCO C;  4TW8 A;  2DSV A;  5GQB A;  5HW8 A;  1VF8 A;  1OGB A;  3WIJ A;  2PV2 A;  2ZQS A;  2LJ4 A;  5HW6 A;  2P4V A;  1JVW A;  3WL0 A;  2AOS A;  4HBE A;  4J4N A;  3WH0 A;  1U79 A;  3OOB A;  1FFR A;  1D7H A;  1B6C A;  1D2K A;  3ARX A;  2DT0 A;  4ODP A;  2ZAJ A;  2WM0 A;  3O5R A;  1FKI A;  1E9L A;  2JV4 A;  1EQ3 A;  4ODR A;  1HKJ A;  2D9F A;  3RME A;  1FKR A;  1KT0 A;  3M7N A;  4Z2H A;  2XP3 A;  1Q1C A;  3MCB A;  1LL6 A;  3AS2 A;  3PQH A;  1E6Z A;  2XP4 A;  2XP5 A;  1SYT A;  3CHE A;  1FKL A;  2XPB A;  1ITX A;  1RP5 A;  1GOI A;  3ARV A;  3UI6 A;  4W5U A;  2XP7 A;  1HKI A;  2YBT A;  4JFK A;  2A3B A;  2LPV A;  4ODO A;  4WJX A;  2K8I A;  1PIN A;  3JYJ A;  2FDM A;  1QZ2 A;  3UF8 A;  4L72 B;  3KCE A;  3UI4 A;  1O6I A;  4JFM A;  2KXQ A;  2PI6 A;  5HUA A;  2WAD A;  1BL4 A;  4DWS D;  4HBO A;  3BMB A;  2RE3 A;  2DK7 A;  2OWO A;  2PN0 A;  3H9R B;  2M08 A;  1NSG A;  4KQZ A;  3ARS A;  3ART A;  1ZB5 A;  1W1T A;  1BKF A;  5DIU A;  1E6P A;  3NTP A;  4W9P A;  2FAP A;  1W26 A;  3KAH A;  4NZC A;  4PTM A;  4DRI A;  1ZBK A;  3WD3 A;  1P5Q A;  2ZR6 A;  4DRM A;  3KAF A;  4WK9 A;  2Q5A A;  1WMV A;  4TW6 A;  3KAI A;  4R0X A;  3TCZ A;  3EY6 A;  2DT1 A;  4IQ2 A;  3AS0 A;  2QRV A;  2N87 A;  2DJY A;  4J4O A;  4DRH A;  1T11 A;  1K9Q A;  3JYM A;  1NH6 A;  5E64 A;  2B31 A;  3O5L A;  1HJV A;  4L3N A;  5HKG A;  1ZBW A;  3O5K A;  4DRO A;  1W1Y A;  2ZR4 A;  2KR7 A;  4S3K A;  1QPF A;  4ML4 A;  4UDM A;  4A0U A;  1LG2 A;  2O9O A;  3ARO A;  3GU0 A;  5HT1 A;  3ARY A;  3LE4 A;  1X6L A;  4ODM A;  4DWS B;  4HAR A;  2E45 A;  2XP8 A;  3JXV A;  1W1V A;  3WD1 A; 
#chains in the Genus database with same CATH homology
 4LGX A;  4DWS A;  2MLZ A;  3QOK A;  1LL4 A;  4FAP A;  1W9U A;  4DIP A;  1E6R A;  2OLH A;  1M5Y A;  2L2S A;  3ARP A;  5HWB A;  2DMV A;  2DG9 A;  2OFN A;  2YAJ B;  3O5J A;  4GLX A;  1SR0 A;  2JXW A;  3O5Q A;  3WKZ A;  1OWQ A;  2PPO A;  4MNM A;  1IX5 A;  3IKD A;  2JMF A;  1FKF A;  4ZPV R;  5DF0 A;  1Q6I A;  1JNS A;  3OA5 A;  2A3C A;  1EYM A;  2FKE A;  4XAK A;  4P8X A;  2A3A A;  4R5E A;  4DH0 A;  2DK1 A;  1N1A A;  1PBK A;  3WD0 A;  1EG3 A;  4TNS A;  3WQV A;  2RQS A;  1HJX A;  3ARQ A;  2YSH A;  4JYS A;  1ZU8 A;  4DRJ A;  3VAW A;  3FAP A;  3O5P A;  1X6N A;  5HBF A;  1W9P A;  4MNJ A;  3PR9 A;  2WLY A;  3O5G A;  4JFL A;  4G2P A;  1K9R A;  1RD6 A;  3G6M A;  3CGN A;  2RUR A;  2WAE A;  3W4R A;  4Q7N A;  3WD2 A;  1E15 A;  1WAW A;  2LKN A;  2WLZ A;  4Q22 A;  1ZK6 A;  3FSC A;  3CHD A;  2MF9 A;  2XP9 A;  5D75 A;  2DWV A;  4P8W A;  4TX0 A;  2RUD A;  4N19 A;  4W9O A;  1HJW A;  2F2D A;  3RFW A;  2DSZ A;  3KAG A;  2F21 A;  2KFW A;  3CGM A;  4LAV A;  3B9E A;  1NWU A;  1FD9 A;  4IT6 A;  5GPR A;  1FKK A;  4MNL A;  4MPK A;  2PV3 A;  3I6C A;  1D6O A;  4ODL A;  3ARZ A;  3RGC A;  2MPH A;  2DT3 A;  2XP6 A;  1EG4 A;  1XRV A;  1UR9 A;  1FKD A;  1FFQ A;  2YBU A;  4E5R A;  3FXY A;  5I98 A;  5JH8 A;  4ITZ A;  2ITK A;  4NNR A;  2AWG A;  1ZCN A;  4ZPW R;  4QT3 A;  1HKK A;  5E62 A;  1H0G A;  3ARU A;  5E65 A;  2DSU A;  1Y0O A;  1R9H A;  1J4I A;  2RSE A;  4W9Q A;  1HXV A;  1NMV A;  3CH9 A;  2PPP A;  4DZ2 A;  2VCD A;  4IT4 A;  4MGV A;  3TDB A;  3B8S A;  3L4H A;  3O5I A;  4P8U A;  2RUQ A;  5DEZ A;  4Z2I A;  4G50 A;  2YSG A;  4ZS6 A;  4AY1 A;  3UI5 A;  3MDY B;  3AS1 A;  2G8Z A;  4U84 A;  1UR8 A;  2DT2 A;  1ROT A;  3MCB B;  1KFW A;  5B8I C;  5J6E A;  2ZQV A;  3O5E A;  3O5M A;  2YSI A;  3KZ7 A;  2M1I A;  5BXJ A;  2VN1 A;  4ZPT R;  1WNO A;  4TW7 A;  5DIT A;  3O5D A;  4DT4 A;  2KE0 A;  2PV1 A;  3WQW A;  4JFI A;  4LAX A;  4QZV B;  2PBC A;  1C9H A;  2MNT A;  3WD4 A;  4Z2G A;  2MLX A;  1FLC A;  3ARW A;  2JX8 A;  3LKX A;  1E6N A;  2DPE A;  1FKS A;  1FKJ A;  5GPG A;  1HKM A;  4A0T A;  3CHC A;  2O92 A;  1JNE A;  1WB0 A;  2IUZ A;  3FS8 A;  1EDQ A;  1NMW A;  2MDI A;  4GIV A;  2MLY A;  4WKH A;  2M2A A;  1J6Y A;  4LAY A;  1JMQ A;  3ALF A;  1JNT A;  1CTN A;  5E5W A;  5HWC A;  3UQA A;  3B7X A;  4REX A;  4TYO A;  3UQB A;  1K9T A;  3RM4 A;  2Y8N B;  4WKF A;  4MAV A;  2ZQT A;  4O2T A;  1NWR A;  4ODK A;  4ODQ A;  4KR0 B;  2BA1 A;  5U47 A;  3LKX B;  4WIW A;  1FAP A;  2M8I A;  4U85 A;  5DO2 A;  1LQ0 A;  2PPN A;  3ODK A;  3KAD A;  3AQU A;  3UQI A;  3RM9 A;  3IHZ A;  2A3E A;  3LUO A;  2EZ5 W;  1J4H A;  2QF8 A;  1I5H W;  1ZL1 A;  3MQG A;  4S3J A;  2M3O W;  1LJY A;  4FN2 A;  3WL1 A;  2KGJ A;  5DIV A;  4MNK A;  4Z2K A;  5HW7 A;  5E66 A;  4JFJ A;  4U86 A;  1NWS A;  4DWS C;  2YSF A;  3O5O A;  5AHT A;  1WR7 A;  1KT1 A;  2IF4 A;  2Y78 A;  1O6W A;  3IK8 A;  4WKA A;  2G41 A;  1W9V A;  3PA7 A;  4Z2J A;  3GPK A;  1TFV A;  1FKB A;  4ODN A;  3AS3 A;  3CNG A;  4DRN A;  3ALG A;  3FY1 A;  4LAW A;  1F40 A;  4QIB A;  3M85 A;  3PRB A;  1D7J A;  1Q6U A;  2DG4 A;  5HTG A;  1J4R A;  3PRA A;  3B9A A;  3CZ8 A;  1ZBC A;  1LL7 A;  4QT2 A;  2KI3 A;  4MSP A;  2DG3 A;  4C02 B;  2ZR5 A;  3PRD A;  4IPX A;  3CHF A;  1LG1 A;  2JZV A;  1XHG A;  3FSB A;  1GPF A;  3ARR A;  3NI6 A;  1FJD A;  1ZBV A;  1TK7 A;  4BF8 A;  3TC5 A;  2ZQU A;  2DSW A;  2RUC A;  3KAB A;  1F8A B;  2LAJ A;  3B9D A;  4IQC A;  1QPL A;  1EHN A;  4DZ3 A;  1YAT A;  1NWT A;  3NRK A;  1L1P A;  3BXW A;  4DRP A;  3KAC A;  2KO7 A;  1JND A;  1H0I A;  4MTV A;  1A7X A;  1ROU A;  4GGQ A;  1YW5 A;  1D7I A;  1FKT A;  2UZ5 A;  5CQ2 A;  1FKH A;  2XPA A;  1Q6H A;  2YSB A;  1TR8 A;  2ESC A;  3IKG A;  4P8V A;  1OGG A;  1W1P A;  4DRK A;  3RM8 A;  1EIB A;  4Z2L A;  4URI A;  4NSB A;  2L4J A;  2LGO A;  3G6L A;  4DRQ A;  3MQH A;  2F4E A;  3O5F A;  2WK2 A;  1GUV A;  1FKG A;  2M8J A;  1TCO C;  4TW8 A;  2DSV A;  5GQB A;  5HW8 A;  1VF8 A;  1OGB A;  3WIJ A;  2PV2 A;  2ZQS A;  2LJ4 A;  5HW6 A;  1JVW A;  3WL0 A;  2AOS A;  4HBE A;  4J4N A;  3WH0 A;  1U79 A;  3OOB A;  1FFR A;  1D7H A;  1B6C A;  1D2K A;  3ARX A;  2DT0 A;  4ODP A;  2ZAJ A;  2WM0 A;  3O5R A;  1FKI A;  1E9L A;  2JV4 A;  1EQ3 A;  4ODR A;  1HKJ A;  2D9F A;  3RME A;  1FKR A;  1KT0 A;  3M7N A;  4Z2H A;  2XP3 A;  1Q1C A;  3MCB A;  1LL6 A;  3AS2 A;  3PQH A;  1E6Z A;  2XP4 A;  2XP5 A;  1SYT A;  3CHE A;  1FKL A;  2XPB A;  1ITX A;  1RP5 A;  1GOI A;  3ARV A;  3UI6 A;  4W5U A;  2XP7 A;  1HKI A;  2YBT A;  4JFK A;  2A3B A;  2LPV A;  4ODO A;  4WJX A;  2K8I A;  1PIN A;  3JYJ A;  2FDM A;  1QZ2 A;  3UF8 A;  4L72 B;  3KCE A;  3UI4 A;  1O6I A;  4JFM A;  2KXQ A;  2PI6 A;  5HUA A;  2WAD A;  1BL4 A;  4DWS D;  4HBO A;  2RE3 A;  2DK7 A;  2OWO A;  3H9R B;  2M08 A;  1NSG A;  4KQZ A;  3ARS A;  3ART A;  1ZB5 A;  1W1T A;  1BKF A;  5DIU A;  1E6P A;  3NTP A;  4W9P A;  2FAP A;  1W26 A;  3KAH A;  4NZC A;  4PTM A;  4DRI A;  1ZBK A;  3WD3 A;  1P5Q A;  2ZR6 A;  4DRM A;  3KAF A;  4WK9 A;  2Q5A A;  1WMV A;  4TW6 A;  3KAI A;  4R0X A;  3TCZ A;  3EY6 A;  2DT1 A;  4IQ2 A;  3AS0 A;  2QRV A;  2N87 A;  2DJY A;  4J4O A;  4DRH A;  1T11 A;  1K9Q A;  3JYM A;  1NH6 A;  5E64 A;  2B31 A;  3O5L A;  1HJV A;  4L3N A;  5HKG A;  1ZBW A;  3O5K A;  4DRO A;  1W1Y A;  2ZR4 A;  2KR7 A;  4S3K A;  1QPF A;  4ML4 A;  4A0U A;  1LG2 A;  2O9O A;  3ARO A;  5HT1 A;  3ARY A;  3LE4 A;  1X6L A;  4ODM A;  4DWS B;  4HAR A;  2E45 A;  2XP8 A;  3JXV A;  1W1V A;  3WD1 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...