1ZCNA

Human pin1 ng mutant
Total Genus 47
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
47
sequence length
155
structure length
143
Chain Sequence
LPPGWEKRMSNGRVYYFNHITNASQWERPSEPARVRCSHLLVKHSQSRRPSSWRQEKITRTKEEALELINGYIQKIKSGEEDFESLASQFSDCSSAKARGDLGAFSRGQMQKPFEDASFALRTGEMSGPVFTDSGIHIILRTE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure-function-folding relationship in a WW domain.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Isomerase
molecule keywords Peptidyl-prolyl cis-trans isomerase NIMA-interacting 1
total genus 47
structure length 143
sequence length 155
ec nomenclature ec 5.2.1.8: Peptidylprolyl isomerase.
pdb deposition date 2005-04-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00397 WW WW domain
A PF00639 Rotamase PPIC-type PPIASE domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.20.70.10 Mainly Beta Single Sheet Ubiquitin Ligase Nedd4; Chain: W; Ubiquitin Ligase Nedd4; Chain: W; 1zcnA01
3.10.50.40 Alpha Beta Roll Chitinase A; domain 3 Chitinase A; domain 3 1zcnA02
1FKLA 5AHTA 5HW6A 1T11A 4DRJA 1BL4A 2DK7A 2XP4A 2ZQTA 3O5KA 4N19A 5DIVA 1EG4A 2LJ4A 2BA1A 2M08A 5HWCA 1TK7A 3UQAA 3M85A 3UQBA 1NSGA 1QPFA 2KI3A 2M8IA 1FKSA 1M5YA 2M1IA 2PV3A 2MDIA 2L4JA 3JYMA 3KAGA 2MLZA 3O5MA 2Y78A 3KAIA 4TX0A 1FKFA 1F40A 1FJDA 2M8JA 1ZCNA 4E5RA 4NNRA 2M3OW 1Q6UA 4DH0A 3O5EA 4W9PA 3NI6A 1D7HA 3TDBA 2F2DA 1TCOC 2KFWA 2RURA 4G50A 2ZR5A 4J4OA 1D7IA 4U85A 1FD9A 4GIVA 4LAYA 1K9RA 3LE4A 1JVWA 1Q1CA 3I6CA 3M7NA 2Q5AA 2LAJA 1JMQA 2XP8A 2PPPA 2VCDA 2M2AA 4J4NA 5HUAA 4U84A 3UI5A 1KT1A 2F21A 2DWVA 3RFWA 3O5DA 3WH0A 5HKGA 3IKGA 4FN2A 4QT2A 4DRNA 1KT0A 3IHZA 4JFIA 4ODQA 1K9QA 4TW6A 4ODKA 4W9OA 3TC5A 2FKEA 4DZ3A 2PPOA 4JFKA 5HTGA 2XP5A 1Y0OA 1JNTA 1B6CA 3FAPA 2AWGA 4ODLA 4ODOA 1J4RA 3VAWA 4BF8A 2RE3A 2FAPA 2RUQA 4DRHA 1YW5A 2ZQSA 2RQSA 4IQ2A 3KABA 4TW7A 3PRBA 2KO7A 2LKNA 1NMVA 4JFLA 2XP6A 3UI4A 4DRIA 1W26A 3O5JA 1FKRA 3O5PA 2VN1A 3UF8A 2XP3A 4DT4A 2XPAA 2JX8A 3RGCA 2L2SA 2UZ5A 1Q6HA 2ZQVA 2JV4A 2MLYA 2YSBA 1HXVA 3CGMA 2LPVA 1JNSA 4U86A 2KGJA 1C9HA 2OFNA 1L1PA 2PV2A 4JFJA 2PBCA 2DMVA 3H9RB 3JXVA 2IF4A 4W9QA 5HT1A 4JFMA 4DRKA 3O5LA 2PPNA 2XP7A 1I5HW 2DG4A 2MLXA 2ZR6A 1D7JA 1FKJA 1PBKA 2RUCA 4ODRA 2ITKA 4TW8A 2F4EA 4ODPA 3UI6A 3KADA 1EQ3A 3PRDA 1O6WA 4C02B 4IPXA 2E45A 3NTPA 1J6YA 2LGOA 1FKDA 2JXWA 1FKBA 1FKTA 3LUOA 5BXJA 1J4HA 5J6EA 1QPLA 4LAXA 4DZ2A 4FAPA 2YSFA 3KAHA 4ITZA 4DROA 5B8IC 2ZQUA 2DJYA 2ZR4A 2K8IA 2KXQA 4DRMA 2DG9A 4MGVA 3ODKA 1WMVA 3TCZA 3O5FA 1FKGA 1EG3A 2XP9A 3B7XA 5DIUA 3OOBA 2DK1A 3KZ7A 4DRQA 4LAWA 1QZ2A 1ROUA 1U79A 3O5RA 1PINA 3MDYB 5GPGA 1A7XA 5DITA 2RUDA 1J4IA 3CNGA 1N1AA 2JZVA 4O2TA 1ZK6A 2YSHA 3UQIA 2XPBA 4TNSA 3PA7A 2MPHA 1R9HA 1YATA 3O5OA 3L4HA 1FKIA 2EZ5W 2MF9A 3O5GA 1WR7A 2PV1A 4ODNA 1FKKA 4R0XA 2KE0A 3NRKA 3GPKA 4QIBA 2D9FA 2KR7A 1ROTA 1F8AB 4TYOA 5HW8A 1Q6IA 1BKFA 4GGQA 3CGNA 4G2PA 4QT3A 2YSIA 5CQ2A 2MNTA 1FKHA 1D6OA 4JYSA 4ODMA 4LAVA 4REXA 5HWBA 2JMFA 1NMWA 3IK8A 5D75A 4MSPA 5I98A 3JYJA 3O5QA 3KACA 2RSEA 1EYMA 5HW7A 3KCEA 2N87A 1FAPA 3KAFA 3IKDA 2DG3A 4IQCA 4DRPA 2ZAJA 1P5QA 3O5IA 3EY6A 2YSGA 4DIPA
chains in the Genus database with same CATH superfamily
5AHTA 1LL4A 3G6LA 2FDMA 3WQVA 2DT2A 3BXWA 5HWCA 1H0GA 2BA1A 3UQBA 1NSGA 1W1PA 2M1IA 2DT3A 2MLZA 3ARWA 4ML4A 4TX0A 4URIA 1FKFA 4NNRA 4WIWA 1Q6UA 4W9PA 1ZL1A 3ARYA 1JNEA 1Q1CA 3I6CA 2Q5AA 1WNOA 4J4NA 2XP8A 3CHFA 3ARSA 5E64A 1OGGA 5HKGA 1VF8A 4DRNA 1O6IA 4TW6A 1K9QA 3TC5A 2B5UB 4JFKA 3FAPA 2A3AA 3VAWA 4MTVA 2FAPA 1YW5A 4ZPVR 2IUZA 1NH6A 1SYTA 2XP6A 3UI4A 3O5PA 1LJYA 3AS2A 2JX8A 2MLYA 1WB0A 2LPVA 2KGJA 2EULA 1LG1A 1D2KA 4P8XA 2PV2A 2PBCA 3H9RB 4Z2LA 3GTYX 3RM8A 4JFMA 2PPNA 2MLXA 1D7JA 4ODRA 4MNMA 1E6RA 4ODPA 3B9AA 4IPXA 3NTPA 1FKDA 2A3BA 5BXJA 3ARZA 4DZ2A 4FAPA 2YSFA 1HJWA 4DRMA 2DJYA 2KXQA 3ODKA 1WMVA 3TCZA 5E5WA 1FKGA 4Z2IA 3B7XA 4DRQA 4LAWA 1CTNA 1UR8A 5DITA 1GUVA 1UR9A 1FKKA 3GPKA 4QIBA 1F8AB 4DWSD 4GGQA 1E15A 3ARVA 1EHNA 2DSZA 4HBEA 5DO2A 1E9LA 3ARTA 4JYSA 4LAVA 3FSBA 4MSPA 5I98A 1OWQA 3WD3A 1FAPA 2O9OA 2YAJB 2PI6A 2ZAJA 4WJXA 3O5IA 3OA5A 1T11A 4N19A 1ZBCA 1ZBKA 2LJ4A 4QZVB 3UQAA 3M85A 2KI3A 1NWRA 1FKSA 2MDIA 2L4JA 1K9TA 1FLCA 2M3OW 3NI6A 1D7HA 3TDBA 4IT4A 3WKZA 2KFWA 1FJDA 2DT0A 2ZR5A 1D7IA 4U85A 3LE4A 1E6ZA 3FS8A 2PN0A 5HUAA 2VCDA 2M2AA 4U84A 1KT1A 1SR0A 2F21A 2DWVA 1XHGA 3WH0A 3QOKA 1KT0A 3ARPA 1XRVA 2PPOA 1Y0OA 2AWGA 2QRVA 1RD6A 3BMBA 3W4RA 3PRBA 5U47A 1LL6A 2KO7A 1NWTA 4DRIA 1EDQA 3O5JA 5DEZA 3UF8A 2XP3A 2UZ5A 2ZQVA 2JV4A 2WM0A 4U86A 2OFNA 1L1PA 5E66A 4JFJA 4W9QA 2WADA 1HKKA 5HT1A 4A0UA 4KQZA 3O5LA 4DRKA 1I5HW 3CZ8A 4TW8A 4P8WA 3KADA 3PR9A 1KFWA 3RMEA 4WKAA 1FFRA 2LGOA 1FKTA 3CHCA 3LUOA 4IT6A 4Z2HA 4S3KA 3WIJA 3KAHA 4ITZA 1ZB5A 4DROA 1EQ3A 2WAEA 2DG9A 1ZBVA 3B9EA 4P8UA 2XP9A 3O5RA 1W9VA 1ZU8A 1J4IA 4L72B 2JZVA 5GQBA 1H0IA 4MNLA 1JCHB 2F23A 1R9HA 1YATA 2MPHA 3L4HA 2MF9A 4ODNA 2PV1A 2KR7A 3AQUA 3CGNA 4QT3A 3MCBB 2A3EA 4REXA 1NMWA 1TR8A 3KCEA 1W1YA 3KAFA 2DG3A 1OGBA 4DIPA 4DRJA 1BL4A 2DK7A 2XP4A 2ZQTA 3ARRA 5HBFA 5DIVA 4Z2GA 1EG4A 2M08A 1QPFA 2M8IA 1E44A 1GPFA 1M5YA 1NWSA 3CH9A 3FY1A 3JYMA 3KAGA 1F40A 2M8JA 1ZCNA 2DSVA 4DH0A 3WD2A 3CHEA 5HW7A 2F2DA 1TCOC 4J4OA 1FD9A 4GIVA 4LAYA 3RGCA 4DT4A 1HKMA 1JMQA 4MNKA 2P4VA 3UI5A 2DT1A 3ALGA 3RFWA 3O5DA 2DPEA 4FN2A 4WKFA 3AS0A 3IHZA 4JFIA 4W9OA 2FKEA 4Z2JA 1JNTA 1B6CA 4ODLA 1J4RA 2RE3A 1FFQA 4TW7A 3KABA 2LKNA 4MAVA 4JFLA 1RP5A 1HKIA 1ZBWA 3B8SA 2XPAA 2L2SA 1Q6HA 2YSBA 2A3CA 2G41A 1C9HA 1EIBA 2DMVA 2IF4A 1ITXA 1GRJA 1HKJA 1FKJA 1PBKA 2RUCA 2DSWA 4A0TA 3UI6A 3PRDA 1O6WA 4C02B 2QF8A 3WD4A 5J6EA 1J4HA 4S3JA 1QPLA 5B8IC 4KR0B 5E62A 3RM9A 1EG3A 2B31A 4NZCA 3WL1A 1ROUA 5DF0A 3MDYB 4O2TA 2XPBA 3B9DA 3PA7A 1HJXA 4TNSA 3WQWA 1WAWA 1TFVA 1FKIA 3O5OA 1X6NA 2KE0A 3ALFA 3NRKA 2D9FA 1ROTA 4TYOA 1Q6IA 2ETNA 1IX5A 3G6MA 3PRAA 2O92A 5CQ2A 1E6NA 1FKHA 1D6OA 3CHDA 3MQHA 5E65A 5HWBA 3IK8A 4Q22A 4XAKA 1E6PA 2WLYA 2N87A 1LL7A 4GLXA 3AROA 1GOIA 1P5QA 1JNDA 1LG2A 1FKLA 5HW6A 3O5KA 3FXYA 1W1VA 2ESCA 1TK7A 4MPKA 3ARUA 4AY1A 3WD0A 2PV3A 2YBTA 4UDMA 1HJVA 3O5MA 2Y78A 3KAIA 4ZPWR 4E5RA 1LQ0A 1NWUA 3O5EA 2RURA 4G50A 4WKHA 2AOSA 3RM4A 1K9RA 1JVWA 3M7NA 2LAJA 2PPPA 4PTMA 5JH8A 3EIPA 3AS3A 3IKGA 4QT2A 4ODQA 4ODKA 4DZ3A 5HTGA 2XP5A 4ODOA 4BF8A 2RUQA 4DRHA 3WL0A 2ZQSA 2RQSA 4IQ2A 4NSBA 1NMVA 4R5EA 4Z2KA 1W26A 4DWSB 1FKRA 2VN1A 3MQGA 4DWSC 1HXVA 3CGMA 1X6LA 1JNSA 2G8ZA 3JXVA 2OLHA 4P8VA 2XP7A 2DG4A 2ZR6A 2ITKA 2F4EA 3LKXB 3FSCA 4MNJA 4L3NA 1J6YA 2E45A 2JXWA 1FKBA 4LGXA 4LAXA 1W1TA 2WK2A 3MCBA 2ZQUA 2ZR4A 2K8IA 3ARQA 3LKXA 4MGVA 1W9PA 3O5FA 5DIUA 3OOBA 2DK1A 3KZ7A 3PQHA 1QZ2A 1U79A 3WD1A 2OWOA 3AS1A 1PINA 5GPGA 1A7XA 2WLZA 4HBOA 2RUDA 3GU0A 1N1AA 3CNGA 3UQIA 3ARXA 1ZK6A 2YSHA 2EZ5W 3O5GA 1WR7A 4R0XA 4W5UA 5HW8A 1BKFA 4WK9A 4G2PA 2YSIA 2MNTA 4DWSA 4ODMA 2JMFA 5D75A 5GPRA 3JYJA 4Q7NA 3O5QA 3KACA 2RSEA 1EYMA 4HARA 3IKDA 1W9UA 4IQCA 4DRPA 2DSUA 4ZPTR 4ZS6A 3EY6A 2YBUA 2YSGA 2Y8NB
chains in the Genus database with same CATH topology
5AHTA 1LL4A 3G6LA 2FDMA 3WQVA 2DT2A 3BXWA 5HWCA 1H0GA 2BA1A 3UQBA 1NSGA 1W1PA 2M1IA 2DT3A 2MLZA 3ARWA 4ML4A 4TX0A 4URIA 1FKFA 4NNRA 4WIWA 1Q6UA 4W9PA 1ZL1A 3ARYA 1JNEA 1Q1CA 3I6CA 2Q5AA 1WNOA 4J4NA 2XP8A 3CHFA 3ARSA 5E64A 1OGGA 5HKGA 1VF8A 4DRNA 1O6IA 4TW6A 1K9QA 3TC5A 4JFKA 3FAPA 2A3AA 3VAWA 4MTVA 2FAPA 1YW5A 4ZPVR 2IUZA 1NH6A 1SYTA 2XP6A 3UI4A 3O5PA 1LJYA 3AS2A 2JX8A 2MLYA 1WB0A 2LPVA 2KGJA 1LG1A 1D2KA 4P8XA 2PV2A 2PBCA 3H9RB 4Z2LA 3RM8A 4JFMA 2PPNA 2MLXA 1D7JA 4ODRA 4MNMA 1E6RA 4ODPA 3B9AA 4IPXA 3NTPA 1FKDA 2A3BA 5BXJA 3ARZA 4DZ2A 4FAPA 2YSFA 1HJWA 4DRMA 2DJYA 2KXQA 3ODKA 1WMVA 3TCZA 5E5WA 1FKGA 4Z2IA 3B7XA 4DRQA 4LAWA 1CTNA 1UR8A 5DITA 1GUVA 1UR9A 1FKKA 3GPKA 4QIBA 1F8AB 4DWSD 4GGQA 1E15A 3ARVA 1EHNA 2DSZA 4HBEA 5DO2A 1E9LA 3ARTA 4JYSA 4LAVA 3FSBA 4MSPA 5I98A 1OWQA 3WD3A 1FAPA 2O9OA 2YAJB 2PI6A 2ZAJA 4WJXA 3O5IA 3OA5A 1T11A 4N19A 1ZBCA 1ZBKA 2LJ4A 4QZVB 3UQAA 3M85A 2KI3A 1NWRA 1FKSA 2MDIA 2L4JA 1K9TA 1FLCA 2M3OW 3NI6A 1D7HA 3TDBA 4IT4A 3WKZA 2KFWA 1FJDA 2DT0A 2ZR5A 1D7IA 4U85A 3LE4A 1E6ZA 3FS8A 5HUAA 2VCDA 2M2AA 4U84A 1KT1A 1SR0A 2F21A 2DWVA 1XHGA 3WH0A 3QOKA 1KT0A 3ARPA 1XRVA 2PPOA 1Y0OA 2AWGA 2QRVA 1RD6A 3W4RA 3PRBA 5U47A 1LL6A 2KO7A 1NWTA 4DRIA 1EDQA 3O5JA 5DEZA 3UF8A 2XP3A 2UZ5A 2ZQVA 2JV4A 2WM0A 4U86A 2OFNA 1L1PA 5E66A 4JFJA 4W9QA 2WADA 1HKKA 5HT1A 4A0UA 4KQZA 3O5LA 4DRKA 1I5HW 3CZ8A 4TW8A 4P8WA 3KADA 3PR9A 1KFWA 3RMEA 4WKAA 1FFRA 2LGOA 1FKTA 3CHCA 3LUOA 4IT6A 4Z2HA 4S3KA 3WIJA 3KAHA 4ITZA 1ZB5A 4DROA 1EQ3A 2WAEA 2DG9A 1ZBVA 3B9EA 4P8UA 2XP9A 3O5RA 1W9VA 1ZU8A 1J4IA 4L72B 2JZVA 5GQBA 1H0IA 4MNLA 2MPHA 1R9HA 1YATA 3L4HA 2MF9A 4ODNA 2PV1A 2KR7A 3AQUA 3CGNA 4QT3A 3MCBB 2A3EA 4REXA 1NMWA 1TR8A 3KCEA 1W1YA 3KAFA 2DG3A 1OGBA 4DIPA 4DRJA 1BL4A 2DK7A 2XP4A 2ZQTA 3ARRA 5HBFA 5DIVA 4Z2GA 1EG4A 2M08A 1QPFA 2M8IA 1GPFA 1M5YA 1NWSA 3CH9A 3FY1A 3JYMA 3KAGA 1F40A 2M8JA 1ZCNA 2DSVA 4DH0A 3WD2A 3CHEA 5HW7A 2F2DA 1TCOC 4J4OA 1FD9A 4GIVA 4LAYA 3RGCA 4DT4A 1HKMA 1JMQA 4MNKA 3UI5A 2DT1A 3ALGA 3RFWA 3O5DA 2DPEA 4FN2A 4WKFA 3AS0A 3IHZA 4JFIA 4W9OA 2FKEA 4Z2JA 1JNTA 1B6CA 4ODLA 1J4RA 2RE3A 1FFQA 4TW7A 3KABA 2LKNA 4MAVA 4JFLA 1RP5A 1HKIA 1ZBWA 3B8SA 2XPAA 2L2SA 1Q6HA 2YSBA 2A3CA 2G41A 1C9HA 1EIBA 2DMVA 2IF4A 1ITXA 1HKJA 1FKJA 1PBKA 2RUCA 2DSWA 4A0TA 3UI6A 3PRDA 1O6WA 4C02B 2QF8A 3WD4A 5J6EA 1J4HA 4S3JA 1QPLA 5B8IC 4KR0B 5E62A 3RM9A 1EG3A 2B31A 4NZCA 3WL1A 1ROUA 5DF0A 3MDYB 4O2TA 2XPBA 3B9DA 3PA7A 1HJXA 4TNSA 3WQWA 1WAWA 1TFVA 1FKIA 3O5OA 1X6NA 2KE0A 3ALFA 3NRKA 2D9FA 1ROTA 4TYOA 1Q6IA 1IX5A 3G6MA 3PRAA 2O92A 5CQ2A 1E6NA 1FKHA 1D6OA 3CHDA 3MQHA 5E65A 5HWBA 3IK8A 4Q22A 4XAKA 1E6PA 2WLYA 2N87A 1LL7A 4GLXA 3AROA 1GOIA 1P5QA 1JNDA 1LG2A 1FKLA 5HW6A 3O5KA 3FXYA 1W1VA 2ESCA 1TK7A 4MPKA 3ARUA 4AY1A 3WD0A 2PV3A 2YBTA 1HJVA 3O5MA 2Y78A 3KAIA 4ZPWR 4E5RA 1LQ0A 1NWUA 3O5EA 2RURA 4G50A 4WKHA 2AOSA 3RM4A 1K9RA 1JVWA 3M7NA 2LAJA 2PPPA 4PTMA 5JH8A 3AS3A 3IKGA 4QT2A 4ODQA 4ODKA 4DZ3A 5HTGA 2XP5A 4ODOA 4BF8A 2RUQA 4DRHA 3WL0A 2ZQSA 2RQSA 4IQ2A 4NSBA 1NMVA 4R5EA 4Z2KA 1W26A 4DWSB 1FKRA 2VN1A 3MQGA 4DWSC 1HXVA 3CGMA 1X6LA 1JNSA 2G8ZA 3JXVA 2OLHA 4P8VA 2XP7A 2DG4A 2ZR6A 2ITKA 2F4EA 3LKXB 3FSCA 4MNJA 4L3NA 1J6YA 2E45A 2JXWA 1FKBA 4LGXA 4LAXA 1W1TA 2WK2A 3MCBA 2ZQUA 2ZR4A 2K8IA 3ARQA 3LKXA 4MGVA 1W9PA 3O5FA 5DIUA 3OOBA 2DK1A 3KZ7A 3PQHA 1QZ2A 1U79A 3WD1A 2OWOA 3AS1A 1PINA 5GPGA 1A7XA 2WLZA 4HBOA 2RUDA 1N1AA 3CNGA 3UQIA 3ARXA 1ZK6A 2YSHA 2EZ5W 3O5GA 1WR7A 4R0XA 4W5UA 5HW8A 1BKFA 4WK9A 4G2PA 2YSIA 2MNTA 4DWSA 4ODMA 2JMFA 5D75A 5GPRA 3JYJA 4Q7NA 3O5QA 3KACA 2RSEA 1EYMA 4HARA 3IKDA 1W9UA 4IQCA 4DRPA 2DSUA 4ZPTR 4ZS6A 3EY6A 2YBUA 2YSGA 2Y8NB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1FKL A;  5AHT A;  5HW6 A;  1T11 A;  4DRJ A;  1BL4 A;  2DK7 A;  2XP4 A;  2ZQT A;  3O5K A;  4N19 A;  5DIV A;  1EG4 A;  2LJ4 A;  2BA1 A;  2M08 A;  5HWC A;  1TK7 A;  3UQA A;  3M85 A;  3UQB A;  1NSG A;  1QPF A;  2KI3 A;  2M8I A;  1FKS A;  1M5Y A;  2M1I A;  2PV3 A;  2MDI A;  2L4J A;  3JYM A;  3KAG A;  2MLZ A;  3O5M A;  2Y78 A;  3KAI A;  4TX0 A;  1FKF A;  1F40 A;  1FJD A;  2M8J A;  1ZCN A;  4E5R A;  4NNR A;  2M3O W;  1Q6U A;  4DH0 A;  3O5E A;  4W9P A;  3NI6 A;  1D7H A;  3TDB A;  2F2D A;  1TCO C;  2KFW A;  2RUR A;  4G50 A;  2ZR5 A;  4J4O A;  1D7I A;  4U85 A;  1FD9 A;  4GIV A;  4LAY A;  1K9R A;  3LE4 A;  1JVW A;  1Q1C A;  3I6C A;  3M7N A;  2Q5A A;  2LAJ A;  1JMQ A;  2XP8 A;  2PPP A;  2VCD A;  2M2A A;  4J4N A;  5HUA A;  4U84 A;  3UI5 A;  1KT1 A;  2F21 A;  2DWV A;  3RFW A;  3O5D A;  3WH0 A;  5HKG A;  3IKG A;  4FN2 A;  4QT2 A;  4DRN A;  1KT0 A;  3IHZ A;  4JFI A;  4ODQ A;  1K9Q A;  4TW6 A;  4ODK A;  4W9O A;  3TC5 A;  2FKE A;  4DZ3 A;  2PPO A;  4JFK A;  5HTG A;  2XP5 A;  1Y0O A;  1JNT A;  1B6C A;  3FAP A;  2AWG A;  4ODL A;  4ODO A;  1J4R A;  3VAW A;  4BF8 A;  2RE3 A;  2FAP A;  2RUQ A;  4DRH A;  1YW5 A;  2ZQS A;  2RQS A;  4IQ2 A;  3KAB A;  4TW7 A;  3PRB A;  2KO7 A;  2LKN A;  1NMV A;  4JFL A;  2XP6 A;  3UI4 A;  4DRI A;  1W26 A;  3O5J A;  1FKR A;  3O5P A;  2VN1 A;  3UF8 A;  2XP3 A;  4DT4 A;  2XPA A;  2JX8 A;  3RGC A;  2L2S A;  2UZ5 A;  1Q6H A;  2ZQV A;  2JV4 A;  2MLY A;  2YSB A;  1HXV A;  3CGM A;  2LPV A;  1JNS A;  4U86 A;  2KGJ A;  1C9H A;  2OFN A;  1L1P A;  2PV2 A;  4JFJ A;  2PBC A;  2DMV A;  3H9R B;  3JXV A;  2IF4 A;  4W9Q A;  5HT1 A;  4JFM A;  4DRK A;  3O5L A;  2PPN A;  2XP7 A;  1I5H W;  2DG4 A;  2MLX A;  2ZR6 A;  1D7J A;  1FKJ A;  1PBK A;  2RUC A;  4ODR A;  2ITK A;  4TW8 A;  2F4E A;  4ODP A;  3UI6 A;  3KAD A;  1EQ3 A;  3PRD A;  1O6W A;  4C02 B;  4IPX A;  2E45 A;  3NTP A;  1J6Y A;  2LGO A;  1FKD A;  2JXW A;  1FKB A;  1FKT A;  3LUO A;  5BXJ A;  1J4H A;  5J6E A;  1QPL A;  4LAX A;  4DZ2 A;  4FAP A;  2YSF A;  3KAH A;  4ITZ A;  4DRO A;  5B8I C;  2ZQU A;  2DJY A;  2ZR4 A;  2K8I A;  2KXQ A;  4DRM A;  2DG9 A;  4MGV A;  3ODK A;  1WMV A;  3TCZ A;  3O5F A;  1FKG A;  1EG3 A;  2XP9 A;  3B7X A;  5DIU A;  3OOB A;  2DK1 A;  3KZ7 A;  4DRQ A;  4LAW A;  1QZ2 A;  1ROU A;  1U79 A;  3O5R A;  1PIN A;  3MDY B;  5GPG A;  1A7X A;  5DIT A;  2RUD A;  1J4I A;  3CNG A;  1N1A A;  2JZV A;  4O2T A;  1ZK6 A;  2YSH A;  3UQI A;  2XPB A;  4TNS A;  3PA7 A;  2MPH A;  1R9H A;  1YAT A;  3O5O A;  3L4H A;  1FKI A;  2EZ5 W;  2MF9 A;  3O5G A;  1WR7 A;  2PV1 A;  4ODN A;  1FKK A;  4R0X A;  2KE0 A;  3NRK A;  3GPK A;  4QIB A;  2D9F A;  2KR7 A;  1ROT A;  1F8A B;  4TYO A;  5HW8 A;  1Q6I A;  1BKF A;  4GGQ A;  3CGN A;  4G2P A;  4QT3 A;  2YSI A;  5CQ2 A;  2MNT A;  1FKH A;  1D6O A;  4JYS A;  4ODM A;  4LAV A;  4REX A;  5HWB A;  2JMF A;  1NMW A;  3IK8 A;  5D75 A;  4MSP A;  5I98 A;  3JYJ A;  3O5Q A;  3KAC A;  2RSE A;  1EYM A;  5HW7 A;  3KCE A;  2N87 A;  1FAP A;  3KAF A;  3IKD A;  2DG3 A;  4IQC A;  4DRP A;  2ZAJ A;  1P5Q A;  3O5I A;  3EY6 A;  2YSG A;  4DIP A; 
#chains in the Genus database with same CATH topology
 5AHT A;  1LL4 A;  3G6L A;  2FDM A;  3WQV A;  2DT2 A;  3BXW A;  5HWC A;  1H0G A;  2BA1 A;  3UQB A;  1NSG A;  1W1P A;  2M1I A;  2DT3 A;  2MLZ A;  3ARW A;  4ML4 A;  4TX0 A;  4URI A;  1FKF A;  4NNR A;  4WIW A;  1Q6U A;  4W9P A;  1ZL1 A;  3ARY A;  1JNE A;  1Q1C A;  3I6C A;  2Q5A A;  1WNO A;  4J4N A;  2XP8 A;  3CHF A;  3ARS A;  5E64 A;  1OGG A;  5HKG A;  1VF8 A;  4DRN A;  1O6I A;  4TW6 A;  1K9Q A;  3TC5 A;  2B5U B;  4JFK A;  3FAP A;  2A3A A;  3VAW A;  4MTV A;  2FAP A;  1YW5 A;  4ZPV R;  2IUZ A;  1NH6 A;  1SYT A;  2XP6 A;  3UI4 A;  3O5P A;  1LJY A;  3AS2 A;  2JX8 A;  2MLY A;  1WB0 A;  2LPV A;  2KGJ A;  2EUL A;  1LG1 A;  1D2K A;  4P8X A;  2PV2 A;  2PBC A;  3H9R B;  4Z2L A;  3GTY X;  3RM8 A;  4JFM A;  2PPN A;  2MLX A;  1D7J A;  4ODR A;  4MNM A;  1E6R A;  4ODP A;  3B9A A;  4IPX A;  3NTP A;  1FKD A;  2A3B A;  5BXJ A;  3ARZ A;  4DZ2 A;  4FAP A;  2YSF A;  1HJW A;  4DRM A;  2DJY A;  2KXQ A;  3ODK A;  1WMV A;  3TCZ A;  5E5W A;  1FKG A;  4Z2I A;  3B7X A;  4DRQ A;  4LAW A;  1CTN A;  1UR8 A;  5DIT A;  1GUV A;  1UR9 A;  1FKK A;  3GPK A;  4QIB A;  1F8A B;  4DWS D;  4GGQ A;  1E15 A;  3ARV A;  1EHN A;  2DSZ A;  4HBE A;  5DO2 A;  1E9L A;  3ART A;  4JYS A;  4LAV A;  3FSB A;  4MSP A;  5I98 A;  1OWQ A;  3WD3 A;  1FAP A;  2O9O A;  2YAJ B;  2PI6 A;  2ZAJ A;  4WJX A;  3O5I A;  3OA5 A;  1T11 A;  4N19 A;  1ZBC A;  1ZBK A;  2LJ4 A;  4QZV B;  3UQA A;  3M85 A;  2KI3 A;  1NWR A;  1FKS A;  2MDI A;  2L4J A;  1K9T A;  1FLC A;  2M3O W;  3NI6 A;  1D7H A;  3TDB A;  4IT4 A;  3WKZ A;  2KFW A;  1FJD A;  2DT0 A;  2ZR5 A;  1D7I A;  4U85 A;  3LE4 A;  1E6Z A;  3FS8 A;  2PN0 A;  5HUA A;  2VCD A;  2M2A A;  4U84 A;  1KT1 A;  1SR0 A;  2F21 A;  2DWV A;  1XHG A;  3WH0 A;  3QOK A;  1KT0 A;  3ARP A;  1XRV A;  2PPO A;  1Y0O A;  2AWG A;  2QRV A;  1RD6 A;  3BMB A;  3W4R A;  3PRB A;  5U47 A;  1LL6 A;  2KO7 A;  1NWT A;  4DRI A;  1EDQ A;  3O5J A;  5DEZ A;  3UF8 A;  2XP3 A;  2UZ5 A;  2ZQV A;  2JV4 A;  2WM0 A;  4U86 A;  2OFN A;  1L1P A;  5E66 A;  4JFJ A;  4W9Q A;  2WAD A;  1HKK A;  5HT1 A;  4A0U A;  4KQZ A;  3O5L A;  4DRK A;  1I5H W;  3CZ8 A;  4TW8 A;  4P8W A;  3KAD A;  3PR9 A;  1KFW A;  3RME A;  4WKA A;  1FFR A;  2LGO A;  1FKT A;  3CHC A;  3LUO A;  4IT6 A;  4Z2H A;  4S3K A;  3WIJ A;  3KAH A;  4ITZ A;  1ZB5 A;  4DRO A;  1EQ3 A;  2WAE A;  2DG9 A;  1ZBV A;  3B9E A;  4P8U A;  2XP9 A;  3O5R A;  1W9V A;  1ZU8 A;  1J4I A;  4L72 B;  2JZV A;  5GQB A;  1H0I A;  4MNL A;  1JCH B;  2F23 A;  1R9H A;  1YAT A;  2MPH A;  3L4H A;  2MF9 A;  4ODN A;  2PV1 A;  2KR7 A;  3AQU A;  3CGN A;  4QT3 A;  3MCB B;  2A3E A;  4REX A;  1NMW A;  1TR8 A;  3KCE A;  1W1Y A;  3KAF A;  2DG3 A;  1OGB A;  4DIP A;  4DRJ A;  1BL4 A;  2DK7 A;  2XP4 A;  2ZQT A;  3ARR A;  5HBF A;  5DIV A;  4Z2G A;  1EG4 A;  2M08 A;  1QPF A;  2M8I A;  1E44 A;  1GPF A;  1M5Y A;  1NWS A;  3CH9 A;  3FY1 A;  3JYM A;  3KAG A;  1F40 A;  2M8J A;  1ZCN A;  2DSV A;  4DH0 A;  3WD2 A;  3CHE A;  5HW7 A;  2F2D A;  1TCO C;  4J4O A;  1FD9 A;  4GIV A;  4LAY A;  3RGC A;  4DT4 A;  1HKM A;  1JMQ A;  4MNK A;  2P4V A;  3UI5 A;  2DT1 A;  3ALG A;  3RFW A;  3O5D A;  2DPE A;  4FN2 A;  4WKF A;  3AS0 A;  3IHZ A;  4JFI A;  4W9O A;  2FKE A;  4Z2J A;  1JNT A;  1B6C A;  4ODL A;  1J4R A;  2RE3 A;  1FFQ A;  4TW7 A;  3KAB A;  2LKN A;  4MAV A;  4JFL A;  1RP5 A;  1HKI A;  1ZBW A;  3B8S A;  2XPA A;  2L2S A;  1Q6H A;  2YSB A;  2A3C A;  2G41 A;  1C9H A;  1EIB A;  2DMV A;  2IF4 A;  1ITX A;  1GRJ A;  1HKJ A;  1FKJ A;  1PBK A;  2RUC A;  2DSW A;  4A0T A;  3UI6 A;  3PRD A;  1O6W A;  4C02 B;  2QF8 A;  3WD4 A;  5J6E A;  1J4H A;  4S3J A;  1QPL A;  5B8I C;  4KR0 B;  5E62 A;  3RM9 A;  1EG3 A;  2B31 A;  4NZC A;  3WL1 A;  1ROU A;  5DF0 A;  3MDY B;  4O2T A;  2XPB A;  3B9D A;  3PA7 A;  1HJX A;  4TNS A;  3WQW A;  1WAW A;  1TFV A;  1FKI A;  3O5O A;  1X6N A;  2KE0 A;  3ALF A;  3NRK A;  2D9F A;  1ROT A;  4TYO A;  1Q6I A;  2ETN A;  1IX5 A;  3G6M A;  3PRA A;  2O92 A;  5CQ2 A;  1E6N A;  1FKH A;  1D6O A;  3CHD A;  3MQH A;  5E65 A;  5HWB A;  3IK8 A;  4Q22 A;  4XAK A;  1E6P A;  2WLY A;  2N87 A;  1LL7 A;  4GLX A;  3ARO A;  1GOI A;  1P5Q A;  1JND A;  1LG2 A;  1FKL A;  5HW6 A;  3O5K A;  3FXY A;  1W1V A;  2ESC A;  1TK7 A;  4MPK A;  3ARU A;  4AY1 A;  3WD0 A;  2PV3 A;  2YBT A;  4UDM A;  1HJV A;  3O5M A;  2Y78 A;  3KAI A;  4ZPW R;  4E5R A;  1LQ0 A;  1NWU A;  3O5E A;  2RUR A;  4G50 A;  4WKH A;  2AOS A;  3RM4 A;  1K9R A;  1JVW A;  3M7N A;  2LAJ A;  2PPP A;  4PTM A;  5JH8 A;  3EIP A;  3AS3 A;  3IKG A;  4QT2 A;  4ODQ A;  4ODK A;  4DZ3 A;  5HTG A;  2XP5 A;  4ODO A;  4BF8 A;  2RUQ A;  4DRH A;  3WL0 A;  2ZQS A;  2RQS A;  4IQ2 A;  4NSB A;  1NMV A;  4R5E A;  4Z2K A;  1W26 A;  4DWS B;  1FKR A;  2VN1 A;  3MQG A;  4DWS C;  1HXV A;  3CGM A;  1X6L A;  1JNS A;  2G8Z A;  3JXV A;  2OLH A;  4P8V A;  2XP7 A;  2DG4 A;  2ZR6 A;  2ITK A;  2F4E A;  3LKX B;  3FSC A;  4MNJ A;  4L3N A;  1J6Y A;  2E45 A;  2JXW A;  1FKB A;  4LGX A;  4LAX A;  1W1T A;  2WK2 A;  3MCB A;  2ZQU A;  2ZR4 A;  2K8I A;  3ARQ A;  3LKX A;  4MGV A;  1W9P A;  3O5F A;  5DIU A;  3OOB A;  2DK1 A;  3KZ7 A;  3PQH A;  1QZ2 A;  1U79 A;  3WD1 A;  2OWO A;  3AS1 A;  1PIN A;  5GPG A;  1A7X A;  2WLZ A;  4HBO A;  2RUD A;  3GU0 A;  1N1A A;  3CNG A;  3UQI A;  3ARX A;  1ZK6 A;  2YSH A;  2EZ5 W;  3O5G A;  1WR7 A;  4R0X A;  4W5U A;  5HW8 A;  1BKF A;  4WK9 A;  4G2P A;  2YSI A;  2MNT A;  4DWS A;  4ODM A;  2JMF A;  5D75 A;  5GPR A;  3JYJ A;  4Q7N A;  3O5Q A;  3KAC A;  2RSE A;  1EYM A;  4HAR A;  3IKD A;  1W9U A;  4IQC A;  4DRP A;  2DSU A;  4ZPT R;  4ZS6 A;  3EY6 A;  2YBU A;  2YSG A;  2Y8N B; 
#chains in the Genus database with same CATH homology
 5AHT A;  1LL4 A;  3G6L A;  2FDM A;  3WQV A;  2DT2 A;  3BXW A;  5HWC A;  1H0G A;  2BA1 A;  3UQB A;  1NSG A;  1W1P A;  2M1I A;  2DT3 A;  2MLZ A;  3ARW A;  4ML4 A;  4TX0 A;  4URI A;  1FKF A;  4NNR A;  4WIW A;  1Q6U A;  4W9P A;  1ZL1 A;  3ARY A;  1JNE A;  1Q1C A;  3I6C A;  2Q5A A;  1WNO A;  4J4N A;  2XP8 A;  3CHF A;  3ARS A;  5E64 A;  1OGG A;  5HKG A;  1VF8 A;  4DRN A;  1O6I A;  4TW6 A;  1K9Q A;  3TC5 A;  4JFK A;  3FAP A;  2A3A A;  3VAW A;  4MTV A;  2FAP A;  1YW5 A;  4ZPV R;  2IUZ A;  1NH6 A;  1SYT A;  2XP6 A;  3UI4 A;  3O5P A;  1LJY A;  3AS2 A;  2JX8 A;  2MLY A;  1WB0 A;  2LPV A;  2KGJ A;  1LG1 A;  1D2K A;  4P8X A;  2PV2 A;  2PBC A;  3H9R B;  4Z2L A;  3RM8 A;  4JFM A;  2PPN A;  2MLX A;  1D7J A;  4ODR A;  4MNM A;  1E6R A;  4ODP A;  3B9A A;  4IPX A;  3NTP A;  1FKD A;  2A3B A;  5BXJ A;  3ARZ A;  4DZ2 A;  4FAP A;  2YSF A;  1HJW A;  4DRM A;  2DJY A;  2KXQ A;  3ODK A;  1WMV A;  3TCZ A;  5E5W A;  1FKG A;  4Z2I A;  3B7X A;  4DRQ A;  4LAW A;  1CTN A;  1UR8 A;  5DIT A;  1GUV A;  1UR9 A;  1FKK A;  3GPK A;  4QIB A;  1F8A B;  4DWS D;  4GGQ A;  1E15 A;  3ARV A;  1EHN A;  2DSZ A;  4HBE A;  5DO2 A;  1E9L A;  3ART A;  4JYS A;  4LAV A;  3FSB A;  4MSP A;  5I98 A;  1OWQ A;  3WD3 A;  1FAP A;  2O9O A;  2YAJ B;  2PI6 A;  2ZAJ A;  4WJX A;  3O5I A;  3OA5 A;  1T11 A;  4N19 A;  1ZBC A;  1ZBK A;  2LJ4 A;  4QZV B;  3UQA A;  3M85 A;  2KI3 A;  1NWR A;  1FKS A;  2MDI A;  2L4J A;  1K9T A;  1FLC A;  2M3O W;  3NI6 A;  1D7H A;  3TDB A;  4IT4 A;  3WKZ A;  2KFW A;  1FJD A;  2DT0 A;  2ZR5 A;  1D7I A;  4U85 A;  3LE4 A;  1E6Z A;  3FS8 A;  5HUA A;  2VCD A;  2M2A A;  4U84 A;  1KT1 A;  1SR0 A;  2F21 A;  2DWV A;  1XHG A;  3WH0 A;  3QOK A;  1KT0 A;  3ARP A;  1XRV A;  2PPO A;  1Y0O A;  2AWG A;  2QRV A;  1RD6 A;  3W4R A;  3PRB A;  5U47 A;  1LL6 A;  2KO7 A;  1NWT A;  4DRI A;  1EDQ A;  3O5J A;  5DEZ A;  3UF8 A;  2XP3 A;  2UZ5 A;  2ZQV A;  2JV4 A;  2WM0 A;  4U86 A;  2OFN A;  1L1P A;  5E66 A;  4JFJ A;  4W9Q A;  2WAD A;  1HKK A;  5HT1 A;  4A0U A;  4KQZ A;  3O5L A;  4DRK A;  1I5H W;  3CZ8 A;  4TW8 A;  4P8W A;  3KAD A;  3PR9 A;  1KFW A;  3RME A;  4WKA A;  1FFR A;  2LGO A;  1FKT A;  3CHC A;  3LUO A;  4IT6 A;  4Z2H A;  4S3K A;  3WIJ A;  3KAH A;  4ITZ A;  1ZB5 A;  4DRO A;  1EQ3 A;  2WAE A;  2DG9 A;  1ZBV A;  3B9E A;  4P8U A;  2XP9 A;  3O5R A;  1W9V A;  1ZU8 A;  1J4I A;  4L72 B;  2JZV A;  5GQB A;  1H0I A;  4MNL A;  2MPH A;  1R9H A;  1YAT A;  3L4H A;  2MF9 A;  4ODN A;  2PV1 A;  2KR7 A;  3AQU A;  3CGN A;  4QT3 A;  3MCB B;  2A3E A;  4REX A;  1NMW A;  1TR8 A;  3KCE A;  1W1Y A;  3KAF A;  2DG3 A;  1OGB A;  4DIP A;  4DRJ A;  1BL4 A;  2DK7 A;  2XP4 A;  2ZQT A;  3ARR A;  5HBF A;  5DIV A;  4Z2G A;  1EG4 A;  2M08 A;  1QPF A;  2M8I A;  1GPF A;  1M5Y A;  1NWS A;  3CH9 A;  3FY1 A;  3JYM A;  3KAG A;  1F40 A;  2M8J A;  1ZCN A;  2DSV A;  4DH0 A;  3WD2 A;  3CHE A;  5HW7 A;  2F2D A;  1TCO C;  4J4O A;  1FD9 A;  4GIV A;  4LAY A;  3RGC A;  4DT4 A;  1HKM A;  1JMQ A;  4MNK A;  3UI5 A;  2DT1 A;  3ALG A;  3RFW A;  3O5D A;  2DPE A;  4FN2 A;  4WKF A;  3AS0 A;  3IHZ A;  4JFI A;  4W9O A;  2FKE A;  4Z2J A;  1JNT A;  1B6C A;  4ODL A;  1J4R A;  2RE3 A;  1FFQ A;  4TW7 A;  3KAB A;  2LKN A;  4MAV A;  4JFL A;  1RP5 A;  1HKI A;  1ZBW A;  3B8S A;  2XPA A;  2L2S A;  1Q6H A;  2YSB A;  2A3C A;  2G41 A;  1C9H A;  1EIB A;  2DMV A;  2IF4 A;  1ITX A;  1HKJ A;  1FKJ A;  1PBK A;  2RUC A;  2DSW A;  4A0T A;  3UI6 A;  3PRD A;  1O6W A;  4C02 B;  2QF8 A;  3WD4 A;  5J6E A;  1J4H A;  4S3J A;  1QPL A;  5B8I C;  4KR0 B;  5E62 A;  3RM9 A;  1EG3 A;  2B31 A;  4NZC A;  3WL1 A;  1ROU A;  5DF0 A;  3MDY B;  4O2T A;  2XPB A;  3B9D A;  3PA7 A;  1HJX A;  4TNS A;  3WQW A;  1WAW A;  1TFV A;  1FKI A;  3O5O A;  1X6N A;  2KE0 A;  3ALF A;  3NRK A;  2D9F A;  1ROT A;  4TYO A;  1Q6I A;  1IX5 A;  3G6M A;  3PRA A;  2O92 A;  5CQ2 A;  1E6N A;  1FKH A;  1D6O A;  3CHD A;  3MQH A;  5E65 A;  5HWB A;  3IK8 A;  4Q22 A;  4XAK A;  1E6P A;  2WLY A;  2N87 A;  1LL7 A;  4GLX A;  3ARO A;  1GOI A;  1P5Q A;  1JND A;  1LG2 A;  1FKL A;  5HW6 A;  3O5K A;  3FXY A;  1W1V A;  2ESC A;  1TK7 A;  4MPK A;  3ARU A;  4AY1 A;  3WD0 A;  2PV3 A;  2YBT A;  1HJV A;  3O5M A;  2Y78 A;  3KAI A;  4ZPW R;  4E5R A;  1LQ0 A;  1NWU A;  3O5E A;  2RUR A;  4G50 A;  4WKH A;  2AOS A;  3RM4 A;  1K9R A;  1JVW A;  3M7N A;  2LAJ A;  2PPP A;  4PTM A;  5JH8 A;  3AS3 A;  3IKG A;  4QT2 A;  4ODQ A;  4ODK A;  4DZ3 A;  5HTG A;  2XP5 A;  4ODO A;  4BF8 A;  2RUQ A;  4DRH A;  3WL0 A;  2ZQS A;  2RQS A;  4IQ2 A;  4NSB A;  1NMV A;  4R5E A;  4Z2K A;  1W26 A;  4DWS B;  1FKR A;  2VN1 A;  3MQG A;  4DWS C;  1HXV A;  3CGM A;  1X6L A;  1JNS A;  2G8Z A;  3JXV A;  2OLH A;  4P8V A;  2XP7 A;  2DG4 A;  2ZR6 A;  2ITK A;  2F4E A;  3LKX B;  3FSC A;  4MNJ A;  4L3N A;  1J6Y A;  2E45 A;  2JXW A;  1FKB A;  4LGX A;  4LAX A;  1W1T A;  2WK2 A;  3MCB A;  2ZQU A;  2ZR4 A;  2K8I A;  3ARQ A;  3LKX A;  4MGV A;  1W9P A;  3O5F A;  5DIU A;  3OOB A;  2DK1 A;  3KZ7 A;  3PQH A;  1QZ2 A;  1U79 A;  3WD1 A;  2OWO A;  3AS1 A;  1PIN A;  5GPG A;  1A7X A;  2WLZ A;  4HBO A;  2RUD A;  1N1A A;  3CNG A;  3UQI A;  3ARX A;  1ZK6 A;  2YSH A;  2EZ5 W;  3O5G A;  1WR7 A;  4R0X A;  4W5U A;  5HW8 A;  1BKF A;  4WK9 A;  4G2P A;  2YSI A;  2MNT A;  4DWS A;  4ODM A;  2JMF A;  5D75 A;  5GPR A;  3JYJ A;  4Q7N A;  3O5Q A;  3KAC A;  2RSE A;  1EYM A;  4HAR A;  3IKD A;  1W9U A;  4IQC A;  4DRP A;  2DSU A;  4ZPT R;  4ZS6 A;  3EY6 A;  2YBU A;  2YSG A;  2Y8N B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...