1ZCNA

Human pin1 ng mutant
Total Genus 47
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
47
sequence length
155
structure length
143
Chain Sequence
b'LPPGWEKRMSNGRVYYFNHITNASQWERPSEPARVRCSHLLVKHSQSRRPSSWRQEKITRTKEEALELINGYIQKIKSGEEDFESLASQFSDCSSAKARGDLGAFSRGQMQKPFEDASFALRTGEMSGPVFTDSGIHIILRTE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Peptidyl-prolyl cis-trans isomerase NIMA-interacting 1
molecule tags Isomerase
source organism Homo sapiens
publication title Structure-function-folding relationship in a WW domain.
pubmed doi rcsb
total genus 47
structure length 143
sequence length 155
ec nomenclature ec 5.2.1.8: Peptidylprolyl isomerase.
pdb deposition date 2005-04-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00397 WW WW domain
A PF00639 Rotamase PPIC-type PPIASE domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.20.70.10 Mainly Beta Single Sheet Ubiquitin Ligase Nedd4; Chain: W; Ubiquitin Ligase Nedd4; Chain: W; 1zcnA01
3.10.50.40 Alpha Beta Roll Chitinase A; domain 3 Chitinase A; domain 3 1zcnA02
3O5JA 5J6EA 3WH0A 1T11A 1KT0A 4JFKA 1WR7A 1TCOC 2PPNA 4LAVA 2D9FA 2YSBA 1JNTA 1NSGA 1C9HA 4J4OA 4QT2A 4U84A 2LJ4A 2MLZA 2RUDA 4ODOA 1F8AB 2JXWA 4REXA 2RSEA 2VN1A 4TW8A 3PRDA 5DIVA 1Q6UA 3M85A 1N1AA 2LPVA 1JNSA 4ITZA 4LAWA 1F40A 1B6CA 2KXQA 1I5HW 1Q1CA 3VAWA 3M7NA 2FKEA 1KT1A 4C02B 1L1PA 2RE3A 5HTGA 1FKHA 3KAIA 2ZQVA 1YATA 1O6WA 1FKSA 3O5QA 1D7HA 2LKNA 3CNGA 3H9RB 3NRKA 3ODKA 3MDYB 4DRMA 5DITA 4DRNA 2KE0A 3UF8A 3L4HA 2KGJA 1FKDA 3O5MA 4ODQA 2ZR5A 3RGCA 3KAFA 4DRKA 2UZ5A 1A7XA 2XP8A 1EG4A 3O5PA 2DK7A 1J4IA 4ODKA 3B7XA 5HT1A 2XP9A 4DZ2A 2XP5A 4DRJA 2M2AA 1D7JA 5HWBA 4QIBA 2N87A 2LGOA 2XP3A 4GGQA 3UI5A 1FKBA 5HW8A 2LAJA 3LE4A 2AWGA 2DG9A 3TC5A 3KABA 2DG3A 2KO7A 2OFNA 1Q6IA 3CGNA 3O5LA 4W9PA 3O5OA 2RQSA 5GPGA 4ODPA 4DT4A 2MLXA 2MNTA 3O5RA 4G2PA 4LAXA 4FAPA 1Y0OA 2DK1A 3KAGA 2MLYA 1FKJA 2EZ5W 2MF9A 2DJYA 1NMWA 4G50A 2F2DA 2PV1A 2FAPA 3RFWA 2ZQUA 3TDBA 1D6OA 2PV2A 3O5DA 2YSIA 1FD9A 2ZQTA 4GIVA 2XP7A 3OOBA 2ZR4A 2JMFA 1FKIA 1PBKA 3CGMA 4JYSA 4LAYA 1K9QA 4U86A 4TYOA 5HW6A 3I6CA 4IPXA 4DRQA 4ODLA 2YSFA 1M5YA 4O2TA 1ZK6A 4TX0A 4MGVA 4W9OA 3JXVA 5D75A 1BL4A 4DRIA 1FKFA 2PBCA 2BA1A 1QPLA 2L2SA 2F4EA 5HKGA 1J6YA 1J4RA 2L4JA 2ZR6A 5B8IC 5HWCA 2ZQSA 1PINA 3KCEA 2RUCA 1ZCNA 3IK8A 1ROUA 3JYJA 1EYMA 4JFMA 2XPAA 2PPPA 2ITKA 2Q5AA 3KADA 1BKFA 2PPOA 1YW5A 1NMVA 4DROA 2M8JA 3O5IA 4DRPA 5BXJA 2DMVA 4MSPA 2IF4A 2M3OW 1ROTA 4R0XA 4TNSA 3NI6A 3O5GA 2F21A 3UI6A 3JYMA 1EG3A 4E5RA 1FAPA 1HXVA 3IKGA 2M8IA 2M1IA 4N19A 2VCDA 4IQ2A 5DIUA 4W9QA 2KFWA 4TW6A 4JFJA 3UI4A 2JZVA 2JV4A 2RURA 4FN2A 5HUAA 1EQ3A 1R9HA 4IQCA 2XP6A 3TCZA 2E45A 3KZ7A 4DIPA 4DRHA 4JFIA 3LUOA 4BF8A 2RUQA 2DWVA 1TK7A 2MPHA 2Y78A 4NNRA 3O5EA 2XPBA 3O5FA 3IHZA 1JMQA 4J4NA 1FKLA 2YSHA 2XP4A 2K8IA 2KI3A 2PV3A 4QT3A 4DH0A 1J4HA 5HW7A 1WMVA 1FKTA 1U79A 3IKDA 1FKKA 1K9RA 4ODNA 4DZ3A 3EY6A 1FJDA 3PA7A 1QPFA 1W26A 1JVWA 1QZ2A 2YSGA 1P5QA 3UQAA 3UQBA 1D7IA 2JX8A 3KACA 4TW7A 4JFLA 5I98A 1FKGA 5AHTA 2M08A 4ODMA 1Q6HA 2MDIA 3GPKA 3O5KA 3PRBA 2ZAJA 3NTPA 4U85A 3FAPA 2KR7A 4ODRA 3UQIA 1FKRA 5CQ2A 3KAHA 2DG4A
chains in the Genus database with same CATH superfamily
5J6EA 1UR9A 1WR7A 1TCOC 4LAVA 2D9FA 1NWTA 4ZPTR 4U84A 2RUDA 1ITXA 3ARYA 1HKKA 2DSVA 2RSEA 4TW8A 3PRDA 1Q6UA 1W9PA 4ITZA 3BXWA 1E6PA 2PI6A 1KT1A 2RE3A 1IX5A 3ARPA 3WD4A 3G6LA 3MQGA 2DSZA 3ODKA 1HKIA 1ZBKA 4DRNA 1HJVA 3FSBA 3ARXA 2KGJA 4ODQA 1OGGA 4ZPWR 3KAFA 2UZ5A 1LQ0A 2B5UB 2FDMA 4DRJA 2M2AA 4QIBA 2N87A 3ARWA 2XP3A 1W9UA 5HW8A 2OFNA 3TC5A 2DG3A 2YBUA 3CGNA 4ODPA 4P8WA 2MNTA 1EDQA 4Z2KA 4FAPA 2DK1A 3WKZA 1FKJA 3GTYX 1SYTA 3TDBA 4GIVA 3OOBA 1FKIA 1PBKA 4U86A 1LL6A 5HW6A 4DRQA 2DT1A 1M5YA 2ESCA 5DF0A 1BL4A 4Z2LA 2PBCA 1J4RA 5B8IC 5HWCA 1PINA 3KCEA 1ROUA 3JYJA 2XPAA 2ITKA 1BKFA 2PPOA 4Q7NA 1GRJA 4KQZA 3NI6A 1LL4A 4MNMA 4P8UA 3JYMA 4WKAA 3FY1A 5HBFA 4A0UA 4MNJA 4W9QA 3ARVA 5GQBA 4W5UA 2RURA 3KZ7A 3TCZA 2E45A 3WL0A 4DWSA 4S3KA 4BF8A 4P8XA 2Y78A 3O5EA 3O5FA 2YSHA 3IKDA 4LGXA 1FKKA 1K9RA 4MTVA 3QOKA 1W26A 3AS1A 1QZ2A 2WM0A 3FSCA 4JFLA 3GPKA 2MDIA 3NTPA 5CQ2A 2O9OA 1W1YA 3ALFA 1KT0A 1O6IA 2PPNA 3ARUA 4UDMA 1NSGA 1C9HA 4ODOA 3AQUA 1H0GA 2WLYA 2JXWA 2O92A 2VN1A 4NSBA 3M85A 1N1AA 2WK2A 2DT2A 1F40A 3WD0A 3M7NA 4IT6A 4URIA 4Z2GA 4ZS6A 1YATA 3WL1A 2KE0A 3RM8A 3ARSA 4DRKA 4HARA 2DK7A 3PRAA 2XP9A 3MQHA 1WAWA 1ZB5A 1RP5A 1JCHB 3CH9A 2P4VA 4XAKA 3CHDA 2LAJA 3KABA 2PN0A 2IUZA 3O5RA 4LAXA 4PTMA 3KAGA 5JH8A 2MF9A 2DJYA 1NMWA 4G50A 3RFWA 2PV1A 1EQ3A 2ZQUA 2PV2A 2YSIA 1FD9A 2ZQTA 4QZVB 4LAYA 2YAJB 4JYSA 1RD6A 4ODLA 2YSFA 4W9OA 1TFVA 5D75A 4A0TA 1FFQA 3RMEA 1QPLA 1ZU8A 2F4EA 2RUCA 1ZCNA 3IK8A 2PPPA 3LKXA 1X6LA 4S3JA 5U47A 4P8VA 4DROA 3ARRA 2IF4A 1ROTA 1WNOA 1EG3A 1FAPA 1HXVA 3IKGA 2M1IA 4N19A 1LJYA 1HKJA 5E5WA 4TW6A 5HUAA 2JV4A 4IQCA 4DRHA 1GUVA 2A3CA 2DPEA 4DWSB 1LL7A 1TK7A 2MPHA 3AS0A 3IHZA 1JMQA 3LKXB 2KI3A 3MCBB 5HW7A 1FKTA 3ARTA 3ARZA 1TR8A 4Z2JA 1P5QA 3OA5A 2JX8A 1NWSA 3KACA 4Q22A 4TW7A 5I98A 1JNDA 3PRBA 3GU0A 2ZAJA 2KR7A 1FKRA 3PQHA 4IPXA 4IT4A 3O5JA 5E66A 1ZBCA 1W1PA 1T11A 4JFKA 4ZPVR 3FS8A 3W4RA 2YSBA 2QRVA 1JNTA 2DSUA 1FLCA 1HJXA 2MLZA 1E44A 1F8AB 1XRVA 1LG1A 3CZ8A 4LAWA 1KFWA 1Q1CA 3VAWA 2FKEA 4C02B 1L1PA 1O6WA 3WQWA 3O5QA 3CNGA 3MDYB 4KR0B 1FKDA 3WD2A 2ZR5A 3WD1A 2XP8A 2AOSA 1J4IA 5HT1A 3B7XA 4DZ2A 1OWQA 3EIPA 1D7JA 2WAEA 2YBTA 5HWBA 2LGOA 3LE4A 2AWGA 2DG9A 2KO7A 4L72B 4R0XA 4W9PA 3O5LA 3O5OA 3WIJA 1WB0A 4DT4A 4G2PA 1HKMA 4WK9A 2EZ5W 4DH0A 1D6OA 2XP7A 2A3AA 5DEZA 1GPFA 3I6CA 4HBEA 2DT3A 4TX0A 3JXVA 5HKGA 2L4JA 3WQVA 3B9EA 4JFMA 2Q5AA 1YW5A 1ZL1A 2M8JA 3O5IA 2DMVA 4MSPA 4TNSA 3O5GA 2F21A 4ML4A 3ALGA 5E64A 2M8IA 1K9TA 1E15A 2VCDA 4IQ2A 2EULA 5DIUA 4JFJA 5GPRA 3UI4A 4FN2A 1NWRA 4DIPA 4WJXA 2B31A 2DWVA 4NNRA 2XPBA 1FKLA 2XP4A 2PV3A 4QT3A 2F23A 1J4HA 1WMVA 1FJDA 4DZ3A 4GLXA 4Z2IA 3PA7A 1UR8A 3B9DA 3UQAA 2YSGA 3UQBA 1FKGA 5AHTA 2M08A 4DWSC 4U85A 4ODRA 3UQIA 2G41A 3KAHA 3WH0A 1FFRA 3B8SA 3RM4A 1CTNA 4J4OA 1E6NA 2OLHA 4QT2A 2LJ4A 2WADA 4WIWA 3WD3A 4REXA 4NZCA 5DIVA 5DO2A 2LPVA 1JNSA 1B6CA 2KXQA 3FXYA 1I5HW 3AROA 5HTGA 1GOIA 1FKHA 3KAIA 2ZQVA 1E9LA 1FKSA 1D7HA 2LKNA 3H9RB 3NRKA 3B9AA 4DRMA 1XHGA 5DITA 4R5EA 3UF8A 3L4HA 3O5MA 1JNEA 3RGCA 1A7XA 3BMBA 1EG4A 1H0IA 3O5PA 3RM9A 5E65A 2XP5A 1ZBWA 1X6NA 2ETNA 4GGQA 1FKBA 1LG2A 1NH6A 1D2KA 5GPGA 1Q6IA 2RQSA 1W9VA 2MLXA 1Y0OA 2MLYA 2OWOA 2F2DA 2FAPA 3UI5A 3O5DA 2ZR4A 2JMFA 3CGMA 1W1VA 4TYOA 1K9QA 1VF8A 1EHNA 2DSWA 3CHFA 2G8ZA 4O2TA 3ARQA 1ZK6A 4MGVA 4DRIA 1EIBA 1FKFA 2WLZA 4MNLA 2BA1A 2L2SA 1J6YA 2ZR6A 1SR0A 2ZQSA 1NWUA 1E6RA 2DT0A 1EYMA 5E62A 4DWSD 3KADA 5BXJA 2A3EA 1NMVA 4DRPA 3CHEA 3AS2A 1E6ZA 2M3OW 4WKHA 3CHCA 3UI6A 4E5RA 2Y8NB 1W1TA 4MPKA 3MCBA 2QF8A 2KFWA 4Z2HA 2JZVA 4MNKA 1R9HA 2XP6A 4JFIA 1ZBVA 1HJWA 3LUOA 4AY1A 2RUQA 4ODKA 4J4NA 2K8IA 3AS3A 1U79A 4MAVA 4ODNA 3EY6A 1QPFA 1JVWA 3PR9A 1D7IA 4HBOA 3G6MA 4ODMA 1OGBA 1Q6HA 3O5KA 2A3BA 3FAPA 4WKFA 4L3NA 2DG4A
chains in the Genus database with same CATH topology
5J6EA 1UR9A 1WR7A 1TCOC 4LAVA 2D9FA 1NWTA 4ZPTR 4U84A 2RUDA 1ITXA 3ARYA 1HKKA 2DSVA 2RSEA 4TW8A 3PRDA 1Q6UA 1W9PA 4ITZA 3BXWA 1E6PA 2PI6A 1KT1A 2RE3A 1IX5A 3ARPA 3WD4A 3G6LA 3MQGA 2DSZA 3ODKA 1HKIA 1ZBKA 4DRNA 1HJVA 3FSBA 3ARXA 2KGJA 4ODQA 1OGGA 4ZPWR 3KAFA 2UZ5A 1LQ0A 2FDMA 4DRJA 2M2AA 4QIBA 2N87A 3ARWA 2XP3A 1W9UA 5HW8A 2OFNA 3TC5A 2DG3A 2YBUA 3CGNA 4ODPA 4P8WA 2MNTA 1EDQA 4Z2KA 4FAPA 2DK1A 3WKZA 1FKJA 1SYTA 3TDBA 4GIVA 3OOBA 1FKIA 1PBKA 4U86A 1LL6A 5HW6A 4DRQA 2DT1A 1M5YA 2ESCA 5DF0A 1BL4A 4Z2LA 2PBCA 1J4RA 5B8IC 5HWCA 1PINA 3KCEA 1ROUA 3JYJA 2XPAA 2ITKA 1BKFA 2PPOA 4Q7NA 4KQZA 3NI6A 1LL4A 4MNMA 4P8UA 3JYMA 4WKAA 3FY1A 5HBFA 4A0UA 4MNJA 4W9QA 3ARVA 5GQBA 4W5UA 2RURA 3KZ7A 3TCZA 2E45A 3WL0A 4DWSA 4S3KA 4BF8A 4P8XA 2Y78A 3O5EA 3O5FA 2YSHA 3IKDA 4LGXA 1FKKA 1K9RA 4MTVA 3QOKA 1W26A 3AS1A 1QZ2A 2WM0A 3FSCA 4JFLA 3GPKA 2MDIA 3NTPA 5CQ2A 2O9OA 1W1YA 3ALFA 1KT0A 1O6IA 2PPNA 3ARUA 1NSGA 1C9HA 4ODOA 3AQUA 1H0GA 2WLYA 2JXWA 2O92A 2VN1A 4NSBA 3M85A 1N1AA 2WK2A 2DT2A 1F40A 3WD0A 3M7NA 4IT6A 4URIA 4Z2GA 4ZS6A 1YATA 3WL1A 2KE0A 3RM8A 3ARSA 4DRKA 4HARA 2DK7A 3PRAA 2XP9A 3MQHA 1WAWA 1ZB5A 1RP5A 3CH9A 4XAKA 3CHDA 2LAJA 3KABA 2IUZA 3O5RA 4LAXA 4PTMA 3KAGA 5JH8A 2MF9A 2DJYA 1NMWA 4G50A 3RFWA 2PV1A 1EQ3A 2ZQUA 2PV2A 2YSIA 1FD9A 2ZQTA 4QZVB 4LAYA 2YAJB 4JYSA 1RD6A 4ODLA 2YSFA 4W9OA 1TFVA 5D75A 4A0TA 1FFQA 3RMEA 1QPLA 1ZU8A 2F4EA 2RUCA 1ZCNA 3IK8A 2PPPA 3LKXA 1X6LA 4S3JA 5U47A 4P8VA 4DROA 3ARRA 2IF4A 1ROTA 1WNOA 1EG3A 1FAPA 1HXVA 3IKGA 2M1IA 4N19A 1LJYA 1HKJA 5E5WA 4TW6A 5HUAA 2JV4A 4IQCA 4DRHA 1GUVA 2A3CA 2DPEA 4DWSB 1LL7A 1TK7A 2MPHA 3AS0A 3IHZA 1JMQA 3LKXB 2KI3A 3MCBB 5HW7A 1FKTA 3ARTA 3ARZA 1TR8A 4Z2JA 1P5QA 3OA5A 2JX8A 1NWSA 3KACA 4Q22A 4TW7A 5I98A 1JNDA 3PRBA 2ZAJA 2KR7A 1FKRA 3PQHA 4IPXA 4IT4A 3O5JA 5E66A 1ZBCA 1W1PA 1T11A 4JFKA 4ZPVR 3FS8A 3W4RA 2YSBA 2QRVA 1JNTA 2DSUA 1FLCA 1HJXA 2MLZA 1F8AB 1XRVA 1LG1A 3CZ8A 4LAWA 1KFWA 1Q1CA 3VAWA 2FKEA 4C02B 1L1PA 1O6WA 3WQWA 3O5QA 3CNGA 3MDYB 4KR0B 1FKDA 3WD2A 2ZR5A 3WD1A 2XP8A 2AOSA 1J4IA 5HT1A 3B7XA 4DZ2A 1OWQA 1D7JA 2WAEA 2YBTA 5HWBA 2LGOA 3LE4A 2AWGA 2DG9A 2KO7A 4L72B 4R0XA 4W9PA 3O5LA 3O5OA 3WIJA 1WB0A 4DT4A 4G2PA 1HKMA 4WK9A 2EZ5W 4DH0A 1D6OA 2XP7A 2A3AA 5DEZA 1GPFA 3I6CA 4HBEA 2DT3A 4TX0A 3JXVA 5HKGA 2L4JA 3WQVA 3B9EA 4JFMA 2Q5AA 1YW5A 1ZL1A 2M8JA 3O5IA 2DMVA 4MSPA 4TNSA 3O5GA 2F21A 4ML4A 3ALGA 5E64A 2M8IA 1K9TA 1E15A 2VCDA 4IQ2A 5DIUA 4JFJA 5GPRA 3UI4A 4FN2A 1NWRA 4DIPA 4WJXA 2B31A 2DWVA 4NNRA 2XPBA 1FKLA 2XP4A 2PV3A 4QT3A 1J4HA 1WMVA 1FJDA 4DZ3A 4GLXA 4Z2IA 3PA7A 1UR8A 3B9DA 3UQAA 2YSGA 3UQBA 1FKGA 5AHTA 2M08A 4DWSC 4U85A 4ODRA 3UQIA 2G41A 3KAHA 3WH0A 1FFRA 3B8SA 3RM4A 1CTNA 4J4OA 1E6NA 2OLHA 4QT2A 2LJ4A 2WADA 4WIWA 3WD3A 4REXA 4NZCA 5DIVA 5DO2A 2LPVA 1JNSA 1B6CA 2KXQA 3FXYA 1I5HW 3AROA 5HTGA 1GOIA 1FKHA 3KAIA 2ZQVA 1E9LA 1FKSA 1D7HA 2LKNA 3H9RB 3NRKA 3B9AA 4DRMA 1XHGA 5DITA 4R5EA 3UF8A 3L4HA 3O5MA 1JNEA 3RGCA 1A7XA 1EG4A 1H0IA 3O5PA 3RM9A 5E65A 2XP5A 1ZBWA 1X6NA 4GGQA 1FKBA 1LG2A 1NH6A 1D2KA 5GPGA 1Q6IA 2RQSA 1W9VA 2MLXA 1Y0OA 2MLYA 2OWOA 2F2DA 2FAPA 3UI5A 3O5DA 2ZR4A 2JMFA 3CGMA 1W1VA 4TYOA 1K9QA 1VF8A 1EHNA 2DSWA 3CHFA 2G8ZA 4O2TA 3ARQA 1ZK6A 4MGVA 4DRIA 1EIBA 1FKFA 2WLZA 4MNLA 2BA1A 2L2SA 1J6YA 2ZR6A 1SR0A 2ZQSA 1NWUA 1E6RA 2DT0A 1EYMA 5E62A 4DWSD 3KADA 5BXJA 2A3EA 1NMVA 4DRPA 3CHEA 3AS2A 1E6ZA 2M3OW 4WKHA 3CHCA 3UI6A 4E5RA 2Y8NB 1W1TA 4MPKA 3MCBA 2QF8A 2KFWA 4Z2HA 2JZVA 4MNKA 1R9HA 2XP6A 4JFIA 1ZBVA 1HJWA 3LUOA 4AY1A 2RUQA 4ODKA 4J4NA 2K8IA 3AS3A 1U79A 4MAVA 4ODNA 3EY6A 1QPFA 1JVWA 3PR9A 1D7IA 4HBOA 3G6MA 4ODMA 1OGBA 1Q6HA 3O5KA 2A3BA 3FAPA 4WKFA 4L3NA 2DG4A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3O5J A;  5J6E A;  3WH0 A;  1T11 A;  1KT0 A;  4JFK A;  1WR7 A;  1TCO C;  2PPN A;  4LAV A;  2D9F A;  2YSB A;  1JNT A;  1NSG A;  1C9H A;  4J4O A;  4QT2 A;  4U84 A;  2LJ4 A;  2MLZ A;  2RUD A;  4ODO A;  1F8A B;  2JXW A;  4REX A;  2RSE A;  2VN1 A;  4TW8 A;  3PRD A;  5DIV A;  1Q6U A;  3M85 A;  1N1A A;  2LPV A;  1JNS A;  4ITZ A;  4LAW A;  1F40 A;  1B6C A;  2KXQ A;  1I5H W;  1Q1C A;  3VAW A;  3M7N A;  2FKE A;  1KT1 A;  4C02 B;  1L1P A;  2RE3 A;  5HTG A;  1FKH A;  3KAI A;  2ZQV A;  1YAT A;  1O6W A;  1FKS A;  3O5Q A;  1D7H A;  2LKN A;  3CNG A;  3H9R B;  3NRK A;  3ODK A;  3MDY B;  4DRM A;  5DIT A;  4DRN A;  2KE0 A;  3UF8 A;  3L4H A;  2KGJ A;  1FKD A;  3O5M A;  4ODQ A;  2ZR5 A;  3RGC A;  3KAF A;  4DRK A;  2UZ5 A;  1A7X A;  2XP8 A;  1EG4 A;  3O5P A;  2DK7 A;  1J4I A;  4ODK A;  3B7X A;  5HT1 A;  2XP9 A;  4DZ2 A;  2XP5 A;  4DRJ A;  2M2A A;  1D7J A;  5HWB A;  4QIB A;  2N87 A;  2LGO A;  2XP3 A;  4GGQ A;  3UI5 A;  1FKB A;  5HW8 A;  2LAJ A;  3LE4 A;  2AWG A;  2DG9 A;  3TC5 A;  3KAB A;  2DG3 A;  2KO7 A;  2OFN A;  1Q6I A;  3CGN A;  3O5L A;  4W9P A;  3O5O A;  2RQS A;  5GPG A;  4ODP A;  4DT4 A;  2MLX A;  2MNT A;  3O5R A;  4G2P A;  4LAX A;  4FAP A;  1Y0O A;  2DK1 A;  3KAG A;  2MLY A;  1FKJ A;  2EZ5 W;  2MF9 A;  2DJY A;  1NMW A;  4G50 A;  2F2D A;  2PV1 A;  2FAP A;  3RFW A;  2ZQU A;  3TDB A;  1D6O A;  2PV2 A;  3O5D A;  2YSI A;  1FD9 A;  2ZQT A;  4GIV A;  2XP7 A;  3OOB A;  2ZR4 A;  2JMF A;  1FKI A;  1PBK A;  3CGM A;  4JYS A;  4LAY A;  1K9Q A;  4U86 A;  4TYO A;  5HW6 A;  3I6C A;  4IPX A;  4DRQ A;  4ODL A;  2YSF A;  1M5Y A;  4O2T A;  1ZK6 A;  4TX0 A;  4MGV A;  4W9O A;  3JXV A;  5D75 A;  1BL4 A;  4DRI A;  1FKF A;  2PBC A;  2BA1 A;  1QPL A;  2L2S A;  2F4E A;  5HKG A;  1J6Y A;  1J4R A;  2L4J A;  2ZR6 A;  5B8I C;  5HWC A;  2ZQS A;  1PIN A;  3KCE A;  2RUC A;  1ZCN A;  3IK8 A;  1ROU A;  3JYJ A;  1EYM A;  4JFM A;  2XPA A;  2PPP A;  2ITK A;  2Q5A A;  3KAD A;  1BKF A;  2PPO A;  1YW5 A;  1NMV A;  4DRO A;  2M8J A;  3O5I A;  4DRP A;  5BXJ A;  2DMV A;  4MSP A;  2IF4 A;  2M3O W;  1ROT A;  4R0X A;  4TNS A;  3NI6 A;  3O5G A;  2F21 A;  3UI6 A;  3JYM A;  1EG3 A;  4E5R A;  1FAP A;  1HXV A;  3IKG A;  2M8I A;  2M1I A;  4N19 A;  2VCD A;  4IQ2 A;  5DIU A;  4W9Q A;  2KFW A;  4TW6 A;  4JFJ A;  3UI4 A;  2JZV A;  2JV4 A;  2RUR A;  4FN2 A;  5HUA A;  1EQ3 A;  1R9H A;  4IQC A;  2XP6 A;  3TCZ A;  2E45 A;  3KZ7 A;  4DIP A;  4DRH A;  4JFI A;  3LUO A;  4BF8 A;  2RUQ A;  2DWV A;  1TK7 A;  2MPH A;  2Y78 A;  4NNR A;  3O5E A;  2XPB A;  3O5F A;  3IHZ A;  1JMQ A;  4J4N A;  1FKL A;  2YSH A;  2XP4 A;  2K8I A;  2KI3 A;  2PV3 A;  4QT3 A;  4DH0 A;  1J4H A;  5HW7 A;  1WMV A;  1FKT A;  1U79 A;  3IKD A;  1FKK A;  1K9R A;  4ODN A;  4DZ3 A;  3EY6 A;  1FJD A;  3PA7 A;  1QPF A;  1W26 A;  1JVW A;  1QZ2 A;  2YSG A;  1P5Q A;  3UQA A;  3UQB A;  1D7I A;  2JX8 A;  3KAC A;  4TW7 A;  4JFL A;  5I98 A;  1FKG A;  5AHT A;  2M08 A;  4ODM A;  1Q6H A;  2MDI A;  3GPK A;  3O5K A;  3PRB A;  2ZAJ A;  3NTP A;  4U85 A;  3FAP A;  2KR7 A;  4ODR A;  3UQI A;  1FKR A;  5CQ2 A;  3KAH A;  2DG4 A; 
#chains in the Genus database with same CATH topology
 5J6E A;  1UR9 A;  1WR7 A;  1TCO C;  4LAV A;  2D9F A;  1NWT A;  4ZPT R;  4U84 A;  2RUD A;  1ITX A;  3ARY A;  1HKK A;  2DSV A;  2RSE A;  4TW8 A;  3PRD A;  1Q6U A;  1W9P A;  4ITZ A;  3BXW A;  1E6P A;  2PI6 A;  1KT1 A;  2RE3 A;  1IX5 A;  3ARP A;  3WD4 A;  3G6L A;  3MQG A;  2DSZ A;  3ODK A;  1HKI A;  1ZBK A;  4DRN A;  1HJV A;  3FSB A;  3ARX A;  2KGJ A;  4ODQ A;  1OGG A;  4ZPW R;  3KAF A;  2UZ5 A;  1LQ0 A;  2B5U B;  2FDM A;  4DRJ A;  2M2A A;  4QIB A;  2N87 A;  3ARW A;  2XP3 A;  1W9U A;  5HW8 A;  2OFN A;  3TC5 A;  2DG3 A;  2YBU A;  3CGN A;  4ODP A;  4P8W A;  2MNT A;  1EDQ A;  4Z2K A;  4FAP A;  2DK1 A;  3WKZ A;  1FKJ A;  3GTY X;  1SYT A;  3TDB A;  4GIV A;  3OOB A;  1FKI A;  1PBK A;  4U86 A;  1LL6 A;  5HW6 A;  4DRQ A;  2DT1 A;  1M5Y A;  2ESC A;  5DF0 A;  1BL4 A;  4Z2L A;  2PBC A;  1J4R A;  5B8I C;  5HWC A;  1PIN A;  3KCE A;  1ROU A;  3JYJ A;  2XPA A;  2ITK A;  1BKF A;  2PPO A;  4Q7N A;  1GRJ A;  4KQZ A;  3NI6 A;  1LL4 A;  4MNM A;  4P8U A;  3JYM A;  4WKA A;  3FY1 A;  5HBF A;  4A0U A;  4MNJ A;  4W9Q A;  3ARV A;  5GQB A;  4W5U A;  2RUR A;  3KZ7 A;  3TCZ A;  2E45 A;  3WL0 A;  4DWS A;  4S3K A;  4BF8 A;  4P8X A;  2Y78 A;  3O5E A;  3O5F A;  2YSH A;  3IKD A;  4LGX A;  1FKK A;  1K9R A;  4MTV A;  3QOK A;  1W26 A;  3AS1 A;  1QZ2 A;  2WM0 A;  3FSC A;  4JFL A;  3GPK A;  2MDI A;  3NTP A;  5CQ2 A;  2O9O A;  1W1Y A;  3ALF A;  1KT0 A;  1O6I A;  2PPN A;  3ARU A;  4UDM A;  1NSG A;  1C9H A;  4ODO A;  3AQU A;  1H0G A;  2WLY A;  2JXW A;  2O92 A;  2VN1 A;  4NSB A;  3M85 A;  1N1A A;  2WK2 A;  2DT2 A;  1F40 A;  3WD0 A;  3M7N A;  4IT6 A;  4URI A;  4Z2G A;  4ZS6 A;  1YAT A;  3WL1 A;  2KE0 A;  3RM8 A;  3ARS A;  4DRK A;  4HAR A;  2DK7 A;  3PRA A;  2XP9 A;  3MQH A;  1WAW A;  1ZB5 A;  1RP5 A;  1JCH B;  3CH9 A;  2P4V A;  4XAK A;  3CHD A;  2LAJ A;  3KAB A;  2PN0 A;  2IUZ A;  3O5R A;  4LAX A;  4PTM A;  3KAG A;  5JH8 A;  2MF9 A;  2DJY A;  1NMW A;  4G50 A;  3RFW A;  2PV1 A;  1EQ3 A;  2ZQU A;  2PV2 A;  2YSI A;  1FD9 A;  2ZQT A;  4QZV B;  4LAY A;  2YAJ B;  4JYS A;  1RD6 A;  4ODL A;  2YSF A;  4W9O A;  1TFV A;  5D75 A;  4A0T A;  1FFQ A;  3RME A;  1QPL A;  1ZU8 A;  2F4E A;  2RUC A;  1ZCN A;  3IK8 A;  2PPP A;  3LKX A;  1X6L A;  4S3J A;  5U47 A;  4P8V A;  4DRO A;  3ARR A;  2IF4 A;  1ROT A;  1WNO A;  1EG3 A;  1FAP A;  1HXV A;  3IKG A;  2M1I A;  4N19 A;  1LJY A;  1HKJ A;  5E5W A;  4TW6 A;  5HUA A;  2JV4 A;  4IQC A;  4DRH A;  1GUV A;  2A3C A;  2DPE A;  4DWS B;  1LL7 A;  1TK7 A;  2MPH A;  3AS0 A;  3IHZ A;  1JMQ A;  3LKX B;  2KI3 A;  3MCB B;  5HW7 A;  1FKT A;  3ART A;  3ARZ A;  1TR8 A;  4Z2J A;  1P5Q A;  3OA5 A;  2JX8 A;  1NWS A;  3KAC A;  4Q22 A;  4TW7 A;  5I98 A;  1JND A;  3PRB A;  3GU0 A;  2ZAJ A;  2KR7 A;  1FKR A;  3PQH A;  4IPX A;  4IT4 A;  3O5J A;  5E66 A;  1ZBC A;  1W1P A;  1T11 A;  4JFK A;  4ZPV R;  3FS8 A;  3W4R A;  2YSB A;  2QRV A;  1JNT A;  2DSU A;  1FLC A;  1HJX A;  2MLZ A;  1E44 A;  1F8A B;  1XRV A;  1LG1 A;  3CZ8 A;  4LAW A;  1KFW A;  1Q1C A;  3VAW A;  2FKE A;  4C02 B;  1L1P A;  1O6W A;  3WQW A;  3O5Q A;  3CNG A;  3MDY B;  4KR0 B;  1FKD A;  3WD2 A;  2ZR5 A;  3WD1 A;  2XP8 A;  2AOS A;  1J4I A;  5HT1 A;  3B7X A;  4DZ2 A;  1OWQ A;  3EIP A;  1D7J A;  2WAE A;  2YBT A;  5HWB A;  2LGO A;  3LE4 A;  2AWG A;  2DG9 A;  2KO7 A;  4L72 B;  4R0X A;  4W9P A;  3O5L A;  3O5O A;  3WIJ A;  1WB0 A;  4DT4 A;  4G2P A;  1HKM A;  4WK9 A;  2EZ5 W;  4DH0 A;  1D6O A;  2XP7 A;  2A3A A;  5DEZ A;  1GPF A;  3I6C A;  4HBE A;  2DT3 A;  4TX0 A;  3JXV A;  5HKG A;  2L4J A;  3WQV A;  3B9E A;  4JFM A;  2Q5A A;  1YW5 A;  1ZL1 A;  2M8J A;  3O5I A;  2DMV A;  4MSP A;  4TNS A;  3O5G A;  2F21 A;  4ML4 A;  3ALG A;  5E64 A;  2M8I A;  1K9T A;  1E15 A;  2VCD A;  4IQ2 A;  2EUL A;  5DIU A;  4JFJ A;  5GPR A;  3UI4 A;  4FN2 A;  1NWR A;  4DIP A;  4WJX A;  2B31 A;  2DWV A;  4NNR A;  2XPB A;  1FKL A;  2XP4 A;  2PV3 A;  4QT3 A;  2F23 A;  1J4H A;  1WMV A;  1FJD A;  4DZ3 A;  4GLX A;  4Z2I A;  3PA7 A;  1UR8 A;  3B9D A;  3UQA A;  2YSG A;  3UQB A;  1FKG A;  5AHT A;  2M08 A;  4DWS C;  4U85 A;  4ODR A;  3UQI A;  2G41 A;  3KAH A;  3WH0 A;  1FFR A;  3B8S A;  3RM4 A;  1CTN A;  4J4O A;  1E6N A;  2OLH A;  4QT2 A;  2LJ4 A;  2WAD A;  4WIW A;  3WD3 A;  4REX A;  4NZC A;  5DIV A;  5DO2 A;  2LPV A;  1JNS A;  1B6C A;  2KXQ A;  3FXY A;  1I5H W;  3ARO A;  5HTG A;  1GOI A;  1FKH A;  3KAI A;  2ZQV A;  1E9L A;  1FKS A;  1D7H A;  2LKN A;  3H9R B;  3NRK A;  3B9A A;  4DRM A;  1XHG A;  5DIT A;  4R5E A;  3UF8 A;  3L4H A;  3O5M A;  1JNE A;  3RGC A;  1A7X A;  3BMB A;  1EG4 A;  1H0I A;  3O5P A;  3RM9 A;  5E65 A;  2XP5 A;  1ZBW A;  1X6N A;  2ETN A;  4GGQ A;  1FKB A;  1LG2 A;  1NH6 A;  1D2K A;  5GPG A;  1Q6I A;  2RQS A;  1W9V A;  2MLX A;  1Y0O A;  2MLY A;  2OWO A;  2F2D A;  2FAP A;  3UI5 A;  3O5D A;  2ZR4 A;  2JMF A;  3CGM A;  1W1V A;  4TYO A;  1K9Q A;  1VF8 A;  1EHN A;  2DSW A;  3CHF A;  2G8Z A;  4O2T A;  3ARQ A;  1ZK6 A;  4MGV A;  4DRI A;  1EIB A;  1FKF A;  2WLZ A;  4MNL A;  2BA1 A;  2L2S A;  1J6Y A;  2ZR6 A;  1SR0 A;  2ZQS A;  1NWU A;  1E6R A;  2DT0 A;  1EYM A;  5E62 A;  4DWS D;  3KAD A;  5BXJ A;  2A3E A;  1NMV A;  4DRP A;  3CHE A;  3AS2 A;  1E6Z A;  2M3O W;  4WKH A;  3CHC A;  3UI6 A;  4E5R A;  2Y8N B;  1W1T A;  4MPK A;  3MCB A;  2QF8 A;  2KFW A;  4Z2H A;  2JZV A;  4MNK A;  1R9H A;  2XP6 A;  4JFI A;  1ZBV A;  1HJW A;  3LUO A;  4AY1 A;  2RUQ A;  4ODK A;  4J4N A;  2K8I A;  3AS3 A;  1U79 A;  4MAV A;  4ODN A;  3EY6 A;  1QPF A;  1JVW A;  3PR9 A;  1D7I A;  4HBO A;  3G6M A;  4ODM A;  1OGB A;  1Q6H A;  3O5K A;  2A3B A;  3FAP A;  4WKF A;  4L3N A;  2DG4 A; 
#chains in the Genus database with same CATH homology
 5J6E A;  1UR9 A;  1WR7 A;  1TCO C;  4LAV A;  2D9F A;  1NWT A;  4ZPT R;  4U84 A;  2RUD A;  1ITX A;  3ARY A;  1HKK A;  2DSV A;  2RSE A;  4TW8 A;  3PRD A;  1Q6U A;  1W9P A;  4ITZ A;  3BXW A;  1E6P A;  2PI6 A;  1KT1 A;  2RE3 A;  1IX5 A;  3ARP A;  3WD4 A;  3G6L A;  3MQG A;  2DSZ A;  3ODK A;  1HKI A;  1ZBK A;  4DRN A;  1HJV A;  3FSB A;  3ARX A;  2KGJ A;  4ODQ A;  1OGG A;  4ZPW R;  3KAF A;  2UZ5 A;  1LQ0 A;  2FDM A;  4DRJ A;  2M2A A;  4QIB A;  2N87 A;  3ARW A;  2XP3 A;  1W9U A;  5HW8 A;  2OFN A;  3TC5 A;  2DG3 A;  2YBU A;  3CGN A;  4ODP A;  4P8W A;  2MNT A;  1EDQ A;  4Z2K A;  4FAP A;  2DK1 A;  3WKZ A;  1FKJ A;  1SYT A;  3TDB A;  4GIV A;  3OOB A;  1FKI A;  1PBK A;  4U86 A;  1LL6 A;  5HW6 A;  4DRQ A;  2DT1 A;  1M5Y A;  2ESC A;  5DF0 A;  1BL4 A;  4Z2L A;  2PBC A;  1J4R A;  5B8I C;  5HWC A;  1PIN A;  3KCE A;  1ROU A;  3JYJ A;  2XPA A;  2ITK A;  1BKF A;  2PPO A;  4Q7N A;  4KQZ A;  3NI6 A;  1LL4 A;  4MNM A;  4P8U A;  3JYM A;  4WKA A;  3FY1 A;  5HBF A;  4A0U A;  4MNJ A;  4W9Q A;  3ARV A;  5GQB A;  4W5U A;  2RUR A;  3KZ7 A;  3TCZ A;  2E45 A;  3WL0 A;  4DWS A;  4S3K A;  4BF8 A;  4P8X A;  2Y78 A;  3O5E A;  3O5F A;  2YSH A;  3IKD A;  4LGX A;  1FKK A;  1K9R A;  4MTV A;  3QOK A;  1W26 A;  3AS1 A;  1QZ2 A;  2WM0 A;  3FSC A;  4JFL A;  3GPK A;  2MDI A;  3NTP A;  5CQ2 A;  2O9O A;  1W1Y A;  3ALF A;  1KT0 A;  1O6I A;  2PPN A;  3ARU A;  1NSG A;  1C9H A;  4ODO A;  3AQU A;  1H0G A;  2WLY A;  2JXW A;  2O92 A;  2VN1 A;  4NSB A;  3M85 A;  1N1A A;  2WK2 A;  2DT2 A;  1F40 A;  3WD0 A;  3M7N A;  4IT6 A;  4URI A;  4Z2G A;  4ZS6 A;  1YAT A;  3WL1 A;  2KE0 A;  3RM8 A;  3ARS A;  4DRK A;  4HAR A;  2DK7 A;  3PRA A;  2XP9 A;  3MQH A;  1WAW A;  1ZB5 A;  1RP5 A;  3CH9 A;  4XAK A;  3CHD A;  2LAJ A;  3KAB A;  2IUZ A;  3O5R A;  4LAX A;  4PTM A;  3KAG A;  5JH8 A;  2MF9 A;  2DJY A;  1NMW A;  4G50 A;  3RFW A;  2PV1 A;  1EQ3 A;  2ZQU A;  2PV2 A;  2YSI A;  1FD9 A;  2ZQT A;  4QZV B;  4LAY A;  2YAJ B;  4JYS A;  1RD6 A;  4ODL A;  2YSF A;  4W9O A;  1TFV A;  5D75 A;  4A0T A;  1FFQ A;  3RME A;  1QPL A;  1ZU8 A;  2F4E A;  2RUC A;  1ZCN A;  3IK8 A;  2PPP A;  3LKX A;  1X6L A;  4S3J A;  5U47 A;  4P8V A;  4DRO A;  3ARR A;  2IF4 A;  1ROT A;  1WNO A;  1EG3 A;  1FAP A;  1HXV A;  3IKG A;  2M1I A;  4N19 A;  1LJY A;  1HKJ A;  5E5W A;  4TW6 A;  5HUA A;  2JV4 A;  4IQC A;  4DRH A;  1GUV A;  2A3C A;  2DPE A;  4DWS B;  1LL7 A;  1TK7 A;  2MPH A;  3AS0 A;  3IHZ A;  1JMQ A;  3LKX B;  2KI3 A;  3MCB B;  5HW7 A;  1FKT A;  3ART A;  3ARZ A;  1TR8 A;  4Z2J A;  1P5Q A;  3OA5 A;  2JX8 A;  1NWS A;  3KAC A;  4Q22 A;  4TW7 A;  5I98 A;  1JND A;  3PRB A;  2ZAJ A;  2KR7 A;  1FKR A;  3PQH A;  4IPX A;  4IT4 A;  3O5J A;  5E66 A;  1ZBC A;  1W1P A;  1T11 A;  4JFK A;  4ZPV R;  3FS8 A;  3W4R A;  2YSB A;  2QRV A;  1JNT A;  2DSU A;  1FLC A;  1HJX A;  2MLZ A;  1F8A B;  1XRV A;  1LG1 A;  3CZ8 A;  4LAW A;  1KFW A;  1Q1C A;  3VAW A;  2FKE A;  4C02 B;  1L1P A;  1O6W A;  3WQW A;  3O5Q A;  3CNG A;  3MDY B;  4KR0 B;  1FKD A;  3WD2 A;  2ZR5 A;  3WD1 A;  2XP8 A;  2AOS A;  1J4I A;  5HT1 A;  3B7X A;  4DZ2 A;  1OWQ A;  1D7J A;  2WAE A;  2YBT A;  5HWB A;  2LGO A;  3LE4 A;  2AWG A;  2DG9 A;  2KO7 A;  4L72 B;  4R0X A;  4W9P A;  3O5L A;  3O5O A;  3WIJ A;  1WB0 A;  4DT4 A;  4G2P A;  1HKM A;  4WK9 A;  2EZ5 W;  4DH0 A;  1D6O A;  2XP7 A;  2A3A A;  5DEZ A;  1GPF A;  3I6C A;  4HBE A;  2DT3 A;  4TX0 A;  3JXV A;  5HKG A;  2L4J A;  3WQV A;  3B9E A;  4JFM A;  2Q5A A;  1YW5 A;  1ZL1 A;  2M8J A;  3O5I A;  2DMV A;  4MSP A;  4TNS A;  3O5G A;  2F21 A;  4ML4 A;  3ALG A;  5E64 A;  2M8I A;  1K9T A;  1E15 A;  2VCD A;  4IQ2 A;  5DIU A;  4JFJ A;  5GPR A;  3UI4 A;  4FN2 A;  1NWR A;  4DIP A;  4WJX A;  2B31 A;  2DWV A;  4NNR A;  2XPB A;  1FKL A;  2XP4 A;  2PV3 A;  4QT3 A;  1J4H A;  1WMV A;  1FJD A;  4DZ3 A;  4GLX A;  4Z2I A;  3PA7 A;  1UR8 A;  3B9D A;  3UQA A;  2YSG A;  3UQB A;  1FKG A;  5AHT A;  2M08 A;  4DWS C;  4U85 A;  4ODR A;  3UQI A;  2G41 A;  3KAH A;  3WH0 A;  1FFR A;  3B8S A;  3RM4 A;  1CTN A;  4J4O A;  1E6N A;  2OLH A;  4QT2 A;  2LJ4 A;  2WAD A;  4WIW A;  3WD3 A;  4REX A;  4NZC A;  5DIV A;  5DO2 A;  2LPV A;  1JNS A;  1B6C A;  2KXQ A;  3FXY A;  1I5H W;  3ARO A;  5HTG A;  1GOI A;  1FKH A;  3KAI A;  2ZQV A;  1E9L A;  1FKS A;  1D7H A;  2LKN A;  3H9R B;  3NRK A;  3B9A A;  4DRM A;  1XHG A;  5DIT A;  4R5E A;  3UF8 A;  3L4H A;  3O5M A;  1JNE A;  3RGC A;  1A7X A;  1EG4 A;  1H0I A;  3O5P A;  3RM9 A;  5E65 A;  2XP5 A;  1ZBW A;  1X6N A;  4GGQ A;  1FKB A;  1LG2 A;  1NH6 A;  1D2K A;  5GPG A;  1Q6I A;  2RQS A;  1W9V A;  2MLX A;  1Y0O A;  2MLY A;  2OWO A;  2F2D A;  2FAP A;  3UI5 A;  3O5D A;  2ZR4 A;  2JMF A;  3CGM A;  1W1V A;  4TYO A;  1K9Q A;  1VF8 A;  1EHN A;  2DSW A;  3CHF A;  2G8Z A;  4O2T A;  3ARQ A;  1ZK6 A;  4MGV A;  4DRI A;  1EIB A;  1FKF A;  2WLZ A;  4MNL A;  2BA1 A;  2L2S A;  1J6Y A;  2ZR6 A;  1SR0 A;  2ZQS A;  1NWU A;  1E6R A;  2DT0 A;  1EYM A;  5E62 A;  4DWS D;  3KAD A;  5BXJ A;  2A3E A;  1NMV A;  4DRP A;  3CHE A;  3AS2 A;  1E6Z A;  2M3O W;  4WKH A;  3CHC A;  3UI6 A;  4E5R A;  2Y8N B;  1W1T A;  4MPK A;  3MCB A;  2QF8 A;  2KFW A;  4Z2H A;  2JZV A;  4MNK A;  1R9H A;  2XP6 A;  4JFI A;  1ZBV A;  1HJW A;  3LUO A;  4AY1 A;  2RUQ A;  4ODK A;  4J4N A;  2K8I A;  3AS3 A;  1U79 A;  4MAV A;  4ODN A;  3EY6 A;  1QPF A;  1JVW A;  3PR9 A;  1D7I A;  4HBO A;  3G6M A;  4ODM A;  1OGB A;  1Q6H A;  3O5K A;  2A3B A;  3FAP A;  4WKF A;  4L3N A;  2DG4 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...