2BA1A

Archaeal exosome core
Total Genus 36
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
36
sequence length
179
structure length
179
Chain Sequence
MRFVMPGDRIGSAEEYVKGEGVYEEGGELFAAVAGKLIIKDRVAKVESISPIPEIVKGDVVLGRVVDLRNSIALIEVSSKKGENRGPSNRGIGILHVSNVDEGYVKEISEAVGYLDILKARVIGDNLRLSTKEEEMGVLRALCSNCKTEMVREGDILKCPECGRVEKRKISTDYGKGEW
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural framework for the mechanism of archaeal exosomes in RNA processing.
pubmed doi rcsb
source organism Archaeoglobus fulgidus
molecule tags Rna binding protein
molecule keywords Archaeal exosome RNA binding protein CSL4
total genus 36
structure length 179
sequence length 179
chains with identical sequence B, C
ec nomenclature
pdb deposition date 2005-10-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF10447 EXOSC1 Exosome component EXOSC1/CSL4
A PF14382 ECR1_N Exosome complex exonuclease RRP4 N-terminal region
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.20.70.10 Mainly Beta Single Sheet Ubiquitin Ligase Nedd4; Chain: W; Ubiquitin Ligase Nedd4; Chain: W; 2ba1A03
2.40.50.100 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 2ba1A01
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 2ba1A02
3U4ZA 1A62A 1Y1WG 1MKHA 4KMUC 3ZJYC 1N32L 5C4XG 4JI1L 1HNWQ 1PH7A 2ZTEA 1JJGA 3CCQA 3U9SA 1Z6HA 4KKTA 1I3QH 3S2DH 4LF4Q 1Y69U 2JA7H 1EIYB 3NTPA 3UDFA 4DK1A 1Q1EA 2D0PA 2NVXH 3J81j 1U0LA 3KFUA 1PYSB 2V1CC 2VQEQ 2NN6H 4PMWA 1CFMA 4DNRB 2B63G 5FJ8G 2AWOA 2IT1A 1X54A 4LF9Q 4BXXG 1EG3A 1VQBA 2IHEA 2UXBQ 4DR4L 1BVSA 3MFYA 4R4IA 3I4MG 3HOXG 2M8JA 1IBKL 2UU9Q 2IY5B 4C2MH 1SROA 2I5LX 3E9IA 4KHPQ 3J7A5 2L4JA 4JI4L 3HOUG 2EIFA 1S72A 3M4PA 3I73A 5M3FH 2E2IH 4IQZA 2YSHA 3ER0A 1OXVA 4DV7Q 2F1MA 4J15A 2ZAJA 2LXKA 1VQEA 2I5MX 1X9NA 1XTDA 3I7FA 3AFPA 4H13C 3VR3A 5M5WH 3CMEA 2A6HD 2WFWA 4JBMA 3BDOA 1KRTA 4U86A 3HOYG 4DNTB 2ZM6L 4B3SQ 5GAGC 4QQBX 1E3PA 4C3HH 1YJ9A 1Q7YC 2ES2A 3IRBA 4LF5L 1N36L 5K36G 2Z6KC 1B9NA 1VQMA 2GN5A 5LMUL 1H95A 1KXLA 3W3AA 1PH5A 1Q81C 2XPBA 4GN3B 2CCZA 1E22A 2JEAI 4DAMA 4OX9Q 1BDOA 4JI3Q 2RHSB 3MEFA 4YCUA 4DV0L 5BN5A 2KBNA 1O7LA 1N33L 1G291 3ULLA 3ICEA 2AUKA 1YBYA 5A35A 2DGYA 4KLKA 1PH8A 4GLAC 2OWOA 2JX8A 4KN4C 1T9HA 1SMXA 1LABA 4QJFA 2UUBQ 1Z9FA 1OXSC 4A3DG 4YY3Q 4LF9L 2ZJPA 3PUXA 1TWFH 3CPWA 3A7LA 1WYDA 1GUNA 2JE6I 2JA6H 2K5HA 3TS2A 4A3CG 3HKSA 2N3SA 2F52A 1IBLL 2F4VL 4GKKL 4C3IH 2BA0A 2A6EC 3L0OA 2VY3A 1FGUA 2YSIA 1NY4A 1NJIC 3CCJA 3OW2A 1F8AB 1KIXA 2H5XA 3UE0A 2UUAL 1KL9A 1EIFA 1S3OA 2D0OA 3GTLH 3TC5A 1K0RA 2O5JC 3H15A 4R4OA 2GVBA 4JBKA 1TXYA 2KHIA 2JXWA 1OXUA 4HJ9A 3L4HA 1UEBA 2ZR5A 4LF8L 3NENA 2Z6KA 4WJ4A 4HR7B 4DV6Q 2BDOA 3CQZH 4G7HC 1VS0A 4Y52H 4TQUS 3CMAA 4A3LG 2L15A 1SN8A 1TWGH 3EQLC 3PUWA 3GTKH 2Q8IB 3M4YA 2DNEA 1K73C 2A69C 1H9RA 1QUQB 1E2WA 4LW1A 3I4NH 1OTCA 3CP0A 1I6VC 4G7OC 3CXCA 1HNWL 3AFQA 3PF5A 3A74A 1GUOA 1FYCA 1VQ9A 4JV5Q 2EVBA 1SMYC 4L5RC 2HIVA 3OTOQ 4JI7Q 2KCMA 5BR8L 3OOCA 1YJNA 1M1KC 2PNHA 5EAYA 3PF4A 3VR6A 4OO1H 1EFWA 3J80c 3U58A 1Q46A 1AE3A 5IP9G 2F3IA 3ERSX 4A3FH 3ND9A 1HR0W 1YZ6A 1PMRA 2YTVA 1YI2A 3D31A 3STBC 4DV1Q 1UE7A 3G48A 1SFOH 1E1TA 2CWAA 2VUMG 3DLLA 5KNCA 4X64Q 1SE8A 1YHQA 5AHTA 5IP7G 4JYAL 1N34L 2B29A 3J80i 4IFDI 4A76A 1E1OA 2JJQA 4LF8Q 2HQLA 1DCZA 3EN2A 3HKZE 2E2JH 3HOVG 3CC4A 4BBRG 5IY0A 3GTQH 3CCUA 2XGTA 1VQNA 1PVOA 3KJPA 4HIMA 1QZHA 1PA6A 1VF7A 5ELNA 3JAMi 3RZDH 1YNXA 1JT8A 1TWAH 3CD6A 2NZOA 2JA8H 3KLRA 1YW5A 3J81i 4GZYC 4ME3A 3QIAA 2A68C 1I50H 3T53B 3MXNB 2QA4A 3H3VH 4DR5L 3GTOH 2JA8G 1XMQQ 3GD7A 2YTXA 4A3EH 3PGZA 5IT9c 1OXXK 1HR0Q 4BY1H 2A1AA 4OO1I 3JAMc 2RE3A 4LF6Q 2M3OW 4BBRH 5C0XJ 3HOVH 4C3JH 1XPRA 1E7ZA 2IHFA 2OTLA 3M3YH 1K9QA 2E76C 4JI8Q 4YWMA 4JI8L 3HOWH 4DKAC 2O5IC 5M5YH 1G6PA 3LNNA 1UE5A 3CCVA 3I4LA 4LF6L 5AJ3Q 1DGSA 1WFQA 4DK3C 5M5XH 3K8AA 2K4KA 4GOPB 3CCEA 1Q8KA 1XJVA 1H9KA 1WCMG 1GD7A 3L7ZC 1N34Q 4GKKQ 1OXTA 1NMVA 4KI0A 3CPFA 1XMQL 4RCNA 4POGA 5IP9H 5M3MH 2LAJA 2R92G 2ZQUA 4UP9A 3PV0A 3GTGH 3K0XA 3IFTA 3VR5A 3KABA 4JI0L 2K14A 2R92H 1YNJC 4YWKA 2YSGA 5M3MG 4JYAQ 5ELOA 4K0KL 2AWNA 1GJXA 2DUDA 1K3RA 1WCMH 3VR4A 1VQLA 1EWIA 5JJKA 4LFBQ 2R7ZG 3WWVA 3FPPA 2A69D 5KNDA 3BJUA 4JI3L 3STBD 3TQYA 3W5OA 4PZ7A 4OX9L 3HOWG 2DJYA 1XNQQ 1K83H 5IWAL 1B7YB 1WOCA 3K81C 2ASBA 4B3MQ 5BN4A 4JG2A 2ZR4A 1CSQA 1TU2B 5CQ2A 5H1SE 3KDFB 1JB7A 3KLWA 1A8VA 2ZQTA 3RR5A 4JI0Q 2C35B 4LUVA 4B3TL 1HH2P 4JI7L 3A5ZB 5BN3A 3BZCA 4DV7L 1I94L 2Y0SG 4YHHL 1G51A 3KAIA 1NBWA 4DNIA 2XP4A 4HIDA 1E2VA 1UWVA 4R1JA 1IW7D 3H0GH 2BH8A 2NVTH 2KHJA 1E24A 4QGUA 3PIPA 3PO2H 1X6OA 1DXMA 3CRLC 1K9MC 2B8FA 1UE6A 5IP7H 4DR7Q 4GLVB 3M85A 2DK7A 2ALYB 2KXQA 2XP6A 3GDEA 4G7ZC 2BA1A 3F2CA 4DR6L 4WJ3M 1V9PA 1R9TH 2UXBL 3J81c 1PINA 4MNOA 5C0XG 4JC0A 1IBLQ 4DR6Q 4OGQC 3S17H 2HIXA 3TRZA 4LF4L 1VQAA 4DV2Q 3KCEA 4A3BH 1H9MA 1YHAA 1PHJA 5IYBG 4B3RL 4GN5A 3CC2A 1VQDA 2CQOA 3RNUA 3I4NG 5IYBH 4Y7NH 1XMOQ 4R4TA 2JEBI 3I4OA 2NVQH 1YHBA 1VQJA 4A3BG 4HIKA 4A3LH 3J7ZC 2JMFA 4XTCS 1UE1A 4LF7Q 3UDIA 2EJGC 5C0XI 5LMNW 1HZ9A 1KC8C 3TS0A 3OPOA 5LMNL 5GAHC 1CKNB 1Y1VH 1EG4A 2PCFB 2AKWB 1L1OB 4GNXA 1Q90A 1X56A 4JOIC 4PZ8A 3HOUH 2QGQA 2BH2A 4DV4Q 2YV5A 4MZ9A 3M7NA 1HNZL 3PCOB 1Q82C 4A93G 3HOZH 4LFAL 3PO2G 1TWHH 4X6AH 3W1GA 3GTJH 3CC7A 3H0GG 3N6RA 1HQMC 5AJ3L 2ZJQA 1FL0A 5GADC 5FJ8H 1Z7TA 4KKUA 3PSIA 3HOZG 2QEXA 2RHQB 3CRKC 2EQSA 4A93H 2LMCB 2AMCB 3G6EA 2PQAB 4NPSA 2ZTDA 5LMNQ 4JCVE 1MIUA 1Q1BA 4DV2L 4AYBE 4JK1C 1LM0A 3S1RH 3CCRA 1LYLA 4LF7L 2K32A 1HZBA 4RG1A 3E9HA 2WP8J 4DR4Q 3GQBA 1K8MA 1Y1VG 4DR1L 2UXDQ 1HZAA 3CCMA 1HCZA 4IJHA 4IJLA 1Y8PB 1ZKOA 3S1QH 1IW7C 3LGJA 2PI2E 1Q86C 3RN5A 1HJPA 2Q2UA 4JI6L 2I5HA 1XPUA 2A19A 1HZCA 1JJ2A 1ZYRC 4IFDJ 1PYBA 1BBWA 4O0AA 4NXMQ 1VQKA 1CTMA 1C0AA 2ZT9C 3VA7A 3NE5B 4P71A 1MJEA 2NVYH 2Q2TA 2N78A 1GUSA 1HTPA 5C0XH 1X65A 3BZKA 1K8OA 1VQCA 3FP9A 1VF5C 3AYHB 5M3FG 4HJ5A 2E2HH 1AH9A 3CNGA 1V1QA 2LXJA 4OWXB 1A6XA 4GOPC 2E8GA 4A4IA 1KRSA 1GHJA 1I5HW 1Y8NB 3I2ZA 1B9MA 4PV1C 4P74A 1QJOA 1XNQL 3HOXH 4PZ6A 2YSFA 3H3VI 3F8TA 1LTLA 1S40A 1IBMQ 1VQ4A 1QVFA 1HNZQ 1NTGA 4JOIA 1EYGA 1VQ5A 3S1MH 4XIGS 2B63H 2NN6G 2K75A 4A3EG 2WB1E 1QZGA 1IZ6A 2VS1A 3PUZA 2DWVA 2F4VQ 2WAQE 3F2DA 4OONA 4L5SA 3GTMH 4IO9A 4LUOA 3NELA 4P75A 4YCWA 2JA7G 2PI2A 2YU9H 4X65Q 4BY7H 5IWAQ 3NBHB 1SRUA 5HY6A 3KF6B 1PFSA 1CI3M 1VQFA 1EWHA 3CW2C 2IX0A 4APVA 5C4XH 1IXRA 2PQAA 1EOVA 3SGIA 2PPBC 2Q5AA 2OQ0A 4EX5A 5FLXc 2E74C 2VUMH 1V43A 2R7ZH 4DUZQ 2D5DA 4DAYB 1M90C 3WH0A 4A3FG 3SDZA 2B8GA 4L8JA 4OO1G 3RLOA 4GN4B 1PH3A 2FXQA 4NXNQ 4UPAA 4U84A 1GUGA 2R7DA 1O7IA 4A3IG 3CCSA 1VQOA 2N49A 3S16H 1N8RC 1VQPA 4I7ZC 2K5NA 2R7FA 4KN7C 1ASZA 2JQOA 2HHHL 3NEMA 2PNRC 2E45A 1EQQA 3KAFA 3T51B 4HJ8A 1N9WA 1D8LA 2Q2IA 5IE8A 1FR3A 4AQYQ 1W3SA 4LFCQ 4JI4Q 3L2PA 2MDIA 2UUCQ 1WJJA 4LF5Q 1X3FA 4MTNA 3A8IE 5JJLA 2KENA 2OQKA 4H02A 2ZR6A 4P72A 1SLJA 2ATWA 2PMZE 4BY1G 3G71A 2UXCL 1C7YA 2JK8A 4HJ7A 1Z47A 2XTIA 4KKSA 2XPAA 3CCLA 3LWUA 1EQRA 2JV4A 2ZQVA 4R4QA 1XMOL 1PH6A 2F21A 5BR8Q 1H9SB 2MQHA 1E2ZA 3PO3H 4O2DA 3VR2A 2RCNA 4A3MH 1BBUA 4TVAB 3KF8B 2DNCA 1GKHA 1J6QA 1L2FA 3K7AH 2JA5G 1ZCNA 4DV1L 2A6ED 1N33Q 1IBML 3I72A 2Y0SE 3FKIH 5HGQA 4POFA 3D0FA 1L1OC 4X65L 2I0QA 4H0LC 1JMCA 3I55A 2CWPA 1XNRL 3M4OH 1O6WA 4R4CA 3ND8A 1RL2A 2E5LL 2B3GA 2HHHQ 2MO0A 3FHWA 4QL5A 3I56A 4GNXC 1FJGQ 2XP5A 4B3SL 2NZHA 2K52A 4EQ5A 1D7QA 5K36H 1HNXQ 2EJFC 4E5RA 4DV3Q 1IBKQ 4DR1Q 3KDFA 4DPGA 2UUCL 1DD2A 2CW0C 4A3KG 4IOCA 2E5LQ 2UUAQ 3K80C 3U4VA 4UP8A 5FLMH 4A3GH 4AIMA 2MFIA 5IYDH 4DUZL 4GLXA 4B3TQ 2CKZB 1FJGL 3UE1A 2ZQSA 4LK1C 2JA9A 2K50A 3FMCA 1Y14B 3KOJA 1Y8OB 2EZ5W 4JI2L 1TWCH 3SE0A 1YVCA 1X3EA 4DUYQ 3A5UA 1NMGA 3PUVA 4GS3A 1YNNC 3WDNA 1I94Q 3DM3A 5DLQE 2DN8A 4GNXB 1VQGA 1PH2A 3PUYA 1ASYA 1L1OA 1VQIA 4DK0A 4DR7L 4JI6Q 4GOPA 3A0JA 3T1HQ 3AEVA 4BXXH 4IOAA 1N36Q 4YCVA 4A3CH 2JA6G 2DMVA 3RN2A 1XNRQ 4ALPA 2IX1A 3F2BA 2KCTA 2E75C 4A75A 4QY7A 4A3DH 1H9JA 2RF4A 2UXDL 1H9SA 2ID0A 4LWCA 4BBSG 2MO1A 4HIOA 4LFCL 2A68D 3T1YL 3RLNA 4AQYL 3AB9A 2VW9A 3KAGA 3AQQA 1CUKA 3MXUA 1WMVA 5GQOA 1VQHA 2XP9A 4K0KQ 5J3BA 3GO5A 1Y1WH 1CKMA 4IPHA 1PH4A 2UXCQ 3HFZB 3F1ZA 1LACA 3KF6A 5JEAH 1VQ8A 5JEAG 1O78A 2AHOB 3KADA 3K7UC 4JI5Q 1IYVA 1SR3A 2MNAA 3Q8DA 1VQ7A 1GM5A 4UY8C 3B6YA 1CKNA 3CAMA 4DV6L 4P73A 1VQ6A 4H44C 5C3EG 1LUZA 3EIVA 4OXPA 3OOBA 3HOYH 4U85A 2UU9L 1YJWA 4X66L 2VZAA 2V4DA 4KHPL 5GROA 4BBSH 4NB3A 4X62Q 2A6HC 4DR2L 4DV0Q 4YY3L 1HR0L 1VDZA 4LJZC 4JI1Q 4QIWE 1T5EA 1P8LA 2R6GA 4A3JG 1GO3E 4IPCA 4JBJA 4A3MG 1XPOA 3PO3G 4DV4L 3I4MH 1AE2A 3QJYA 4NXNL 1KQSA 1GUTA 2JXMB 3TZUA 2D62A 1MJCA 3CF5A 4IFDH 1QUQA 4RMFA 2NN6I 4BA1I 3HKZG 4KHZA 3TEHB 3KAHA 1I5FA 5IYCG 1QVCA 4PG3A 3TCZA 3KJOA 3M4QA 1L0WA 1KAWA 1GHKA 4X62L 4DR2Q 4LFBL 1I6HH 3S14H 5IYDG 3E0EA 1K8AC 4A3GG 5FLMG 3RZOH 3BG3A 3M9BA 1QVGA 2EDGA 4DR3L 2GVAA 3TREA 4A3KH 4DK6C 3QG1A 4DR3Q 4X66Q 3OYYA 2VNUD 4BA2I 2ZM6Q 2Z0SA 1X55A 4A3IH 1NMFA 3A8JE 1U5KA 1TKWB 5C44H 1HPCA 4YHHQ 4NXML 1FVIA 4DR5Q 1HNXL 3BU2A 1V8QA 2K5VA 2A8VA 4AH6A 1PV4A 3TDBA 1B70B 1EUJA 1J5EQ 1ONLA 2YYZA 2XP8A 2BE5D 3UDXA 1JMQA 2CFMA 1B8AA 3H94A 3FKIG 4GKJQ 2K33A 4LUZA 1GVPA 2ZJRA 2WAQG 4IPGA 1A63A 4L5TA 1YEZA 2WB1G 2VQEL 1K9RA 3T1YQ 2JA5H 2VL6A 2UUBL 4JI5L 2XP7A 2Q2HA 1JJCB 4BY7G 4LNQA 3RLFA 1YIJA 5C4JH 2N8NA 3W1BA 1IL2A 1JE5A 1PH1A 3T1HL 5IYCH 4REXA 2LSSA 5E7NA 3A7AB 4JBWA 4UP7A 3S2HH 2R93H 3T56B 3PIOA 2R93G 4IPDA 3EBEA 3HGBA 1CKOA 1CSPA 4IFDG 1X3GA 4JV5L 1IYUA 5LMUQ 3DXJC 1VCIA 2EJMA 2EXDA 2ZTCA 2XP3A 4LFAQ 3IKJA 4FDBA 1RIPA 3G4SA 3P20A 4X64L 3LE4A 1TK7A 5JEAJ 2L5TA 4GKJL 4A3JH 3ULJA 1PH9A 4JI2Q 1WR7A 4DV5Q 3S24A 4OWTB 1C9OA 3KYHC 1N32Q 3D4RA 1J5EL 1WI5A 2VQFQ 2OCEA 3OTOL 1W2BA 3S1NH 4B3ML 5JJIA 4TKOB 2AUJD 2YTYA 1A0IA 1Q12A 1KHIA 3GTPH 1NE3A 2QF7A 3UDGA 1IYJB 1KD1C 2KCCA 4DV3L 2ITKA 3OW7A 4DUYL 3S15H 1YITA 2K7VA 5C3EH 4HJAA 3A8KE 3U50C 2BE5C 2D2CC 5C44G 4B3RQ 3ODKA 5GAEC 3VDYA 2HT1A 3ULPA 2DK1A 4DV5L 4AYBG 3JC66 2KA7A 1P16A 4YWLA 2YSBA 4QIBA 2M8IA 4L5QA 1K8GA 1BKBA 2VQFL 4OWWB 5KNBA 2OTJA
chains in the Genus database with same CATH superfamily
1SYCA 3U4ZA 1A62A 1Y1WG 2NVYB 4DAYA 1MKHA 3A55A 4KMUC 3ZJYC 1N32L 3Q0AA 5C4XG 1D1KA 4JI1L 1CA5A 1HNWQ 1PH7A 2ZTEA 3K5OA 1FNVA 1JJGA 4J1MA 3CCQA 4J6HA 3U9SA 2F0UA 1LT5D 5EKLA 4QUCA 5C4JB 2EYLA 5JOBA 1Z6HA 1HRJA 3HOWB 4KKTA 1I3QH 3S2DH 4LF4Q 1Y69U 1V1PA 2JA7H 1EIYB 2ZXPA 4B9XA 3NTPA 4FVMA 3UDFA 4DK1A 1Q1EA 2D0PA 4XXEA 2NVXH 2YU9B 3J81j 1U0LA 3KFUA 1IKLA 1TS2A 1PYSB 2V1CC 2VQEQ 2NN6H 4PMWA 4DN4M 2PQEA 1CFMA 4DNRB 2B63G 2JA5B 1WTOA 5ISRA 3CKIB 2FMCA 3R8BA 5FJ8G 3S17B 2AWOA 2IT1A 5I2XA 1X54A 2WAEA 1SDFA 5LL6X 5E5WA 4LF9Q 2JA6B 1EG3A 4BXXG 3FDTA 4RCOA 3FSCA 4R8NA 1VQBA 2IHEA 1Q8IA 1STNA 2UXBQ 4DR4L 1BVSA 3MFYA 3DEPA 4R4IA 3I4MG 3HOXG 2M8JA 3SXHA 1RHPA 1IBKL 1BO0A 1EYDA 2UU9Q 2HDLA 2MGSA 2M00A 2IY5B 4C2MH 3PMFA 1TWGB 1SROA 3BDCA 2I5LX 3RZDB 5IIFA 3E9IA 4KHPQ 2EYPA 2RSNA 2L4JA 3J7A5 2F0LA 4JI4L 3HOUG 2TMPA 2EIFA 5CV8A 1IHZA 1TS3A 3FRPB 4DAPA 1S72A 5EPLA 3G7LA 3M4PA 3I73A 3K58A 5M3FH 2E2IH 3ER0A 2YSHA 4IQZA 1OXVA 4DV7Q 2CHBD 4OWWB 2F1MA 4OELB 4UDUC 4J15A 2ZAJA 2LXKA 2B2TA 2NYZD 1VQEA 2I5MX 1X9NA 1XTDA 1O80A 3I7FA 5C3EB 2C5CA 3AFPA 4H13C 4N9TA 4HTHA 3VR3A 3E5SA 5M5WH 3CMEA 3TP8A 4TSSA 2A6HD 2WFWA 4JBMA 3A56A 3BDOA 1KRTA 4A3GB 3KUPA 2RCFA 4U86A 3HOYG 5C5LA 1SJHD 4DNTB 4QMGA 3E6ZX 3O13A 3SEBA 2ZM6L 4B08A 3ITPA 4B3SQ 2RVLA 5GAGC 1E3PA 4QQBX 4C3HH 1YJ9A 5E4WC 2A73B 1Q7YC 2ES2A 3VYRA 3TP5A 3IRBA 4LF5L 4UAIA 1N36L 3E3XA 3X3NA 1I4GA 5K36G 1W6JA 2Z6KC 4R8IA 1PDQA 1B9NA 1S5ED 3S1NB 1VQMA 2GN5A 2QDLA 5LMUL 1H95A 1KXLA 3MXGA 1II3A 1NAPA 2K1BA 3W3AA 1PH5A 1ILQA 1Q81C 2XPBA 5I4DA 4GN3B 2CCZA 1E22A 3W2DA 2JEAI 4DAMA 4OX9Q 1BDOA 2RQXA 5CMDA 4JI3Q 3I4MB 5CV6A 5T1GA 4HSPA 2RHSB 5C6AA 3MEFA 4YCUA 4DV0L 5BN5A 2KBNA 1O7LA 3D6CA 1N33L 1G291 4RGMA 1CZGA 3EA6A 3ULLA 3ICEA 2AUKA 1R4QB 1YBYA 4DXGA 2DGYA 5A35A 3BVZA 4KLKA 3MQGA 3I91A 1PH8A 4GLAC 2OWOA 3EVQA 2JX8A 1ESRA 4KN4C 1T9HA 1SMXA 1LABA 2TSSA 4QJFA 2UUBQ 1Z9FA 1S5FD 2VUMB 1OXSC 3CU7A 4A3DG 4YY3Q 2J7ZA 4FYDA 4LF9L 2I07B 2ZJPA 3PUXA 1O7ZA 5M9OA 1TWFH 3CPWA 1AFPA 4KY6A 3T13A 3A7LA 1WYDA 1GUNA 1AN8A 2JE6I 1ML0D 2JA6H 5C3WA 2K5HA 5JAVA 3TS2A 4A3CG 3HKSA 2N3SA 2F52A 5M3FB 1IBLL 2F4VL 4GKKL 4C3IH 4ZK9B 4C3JB 1MBYA 2BA0A 2F0OA 2A6EC 3L0OA 2VY3A 4K5VA 1FGUA 3HOYB 2YSIA 2E2HB 4QF4A 3C3LA 1NY4A 3K59A 3NTHA 1NJIC 1TWAB 4Z9CB 1AZQA 3CCJA 1JB3A 3OW2A 1MHWC 1BF4A 4FF3A 1F8AB 1KIXA 2H5XA 3UE0A 2UUAL 5CORA 1B1ZA 1KL9A 1EIFA 1S3OA 2D0OA 3GTLH 1WD1A 3TC5A 1K0RA 2O5JC 1D6EC 5I9OA 3H15A 4R4OA 2GVBA 4CBVA 2E2JB 5NUCA 4FXDA 4JBKA 2KCNA 4ODGA 5CV4A 4HSVA 1TXYA 1FNWA 2KHIA 1MD2D 2JXWA 1OXUA 1T5XD 3L4HA 1I4RA 4HJ9A 1UEBA 4X3SA 2ZR5A 2PMZB 1PFMA 4LF8L 3NENA 4BBRB 2Z6KA 4RHRA 4WJ4A 4HR7B 4XDXA 4DV6Q 2BDOA 3CQZH 2QKIC 4A0TA 4G7HC 3DEOA 4N8X1 1VS0A 4Y52H 1BCPC 4TQUS 3CMAA 4XQNA 4A3LG 3OWFA 2L15A 1SN8A 5IT9E 3D4WA 5E65A 1TWGH 1F9RA 3EQLC 3PUWA 3GTKH 2Q8IB 2WINB 2X6LA 3M4YA 4RGNA 2DNEA 1K73C 4DA2A 1QUQB 1H9RA 2A69C 1WCMB 1E2WA 1PTOH 4LW1A 2K6AA 3I4NH 4RA8A 1X32A 1F9QA 1OTCA 3GP7A 3CP0A 3R2TA 1I6VC 2LS01 4G7OC 3MZ5A 3CXCA 3TN2A 1HNWL 2B2YA 3AFQA 3PF5A 3A74A 2DJFC 1GUOA 4OEMB 2GA4B 3GTPB 1FYCA 1VQ9A 4JV5Q 5FO9B 2EVBA 1SMYC 2HIVA 3OTOQ 4JI7Q 4L5RC 3BDLA 2KCMA 5BR8L 5M3MB 3OOCA 1STAA 1YJNA 1M1KC 2PNHA 2EYOA 5L37A 4C1NK 4BY1B 5CBEE 5EAYA 3PF4A 3VR6A 4PMBA 1I6HB 1EFWA 4OO1H 1I4HA 1HFGA 3J80c 3U58A 2K05A 1Q46A 1AE3A 2WKCA 5IP9G 3BZDB 2WIIB 2CH4W 2F3IA 3ERSX 4A3FH 3ND9A 1LTAD 1HR0W 1YZ6A 1PMRA 2YTVA 4C3HB 5KYIA 1SYEA 4CGYB 1YI2A 3D31A 3STBC 4DV1Q 1UE7A 3G48A 5EGTA 4XYOA 3RZOB 1SFOH 1E1TA 2CWAA 3OIQA 3DLLA 2VUMG 2F0EA 5KNCA 4X64Q 4ZUJA 1E0BA 1SE8A 2K01A 1YHQA 5AHTA 5IP7G 4JYAL 5LHY1 1N34L 2F0VA 2B29A 3J80i 3HRZC 2ENBA 1QE6A 2PZUA 4A76A 4IFDI 1E1OA 2BOSA 3I90A 2JJQA 1KTKA 5C44B 4Q5VA 4HMJA 4LF8Q 2HQLA 1DCZA 1XWEA 5F2DA 2I46A 5C4XB 3EN2A 4C3JG 1K0SA 3HKZE 1D2BA 2E2JH 3HOVG 2NTTA 3CC4A 3V2TA 4BBRG 5IY0A 3GTQH 3CCUA 2XGTA 1VQNA 2M9VA 1PVOA 5DEHA 3NQIA 3MTSA 3KJPA 2XWBB 1KLGD 4HIMA 1QZHA 1PA6A 1VF7A 4FNFA 5ELNA 3JAMi 1LTTD 4KHVA 3RZDH 1YNXA 1JT8A 1EY6A 3S14B 3TDQA 1TWAH 3CD6A 2DY8A 2NZOA 2JA8H 3KLRA 1YW5A 3J81i 1STYA 4ME3A 4GZYC 2Z4IA 4QCLA 3QIAA 2A68C 2HCCA 3AU7A 1I50H 4BWGB 1F2LA 2PYKA 3T53B 3MXNB 2QA4A 3H3VH 4DR5L 3GTOH 2JA8G 5IGCA 1XMQQ 3GD7A 2YTXA 4A3EH 3PGZA 2CVRA 2WKDA 5IT9c 1OXXK 5E64A 1HR0Q 4BY1H 5C3XA 4ABNA 2A1AA 4OO1I 4RAUC 2Q8TA 3JAMc 2RE3A 2B39A 4LF6Q 2M3OW 2K03A 4BBRH 5CBAE 5C0XJ 1QNUA 1HTLD 3HOVH 1QOHA 4ILWA 1GXDC 4C3JH 1XPRA 1E7ZA 2IHFA 3J81L 2OTLA 3M3YH 1K9QA 2E76C 2MJ8A 4JI8Q 1HQRD 4YWMA 4RH6A 1BCPF 4G4KA 4JI8L 3HOWH 4DKAC 2O5IC 5M5YH 1WD0A 1G6PA 3LNNA 3P1HA 1UE5A 2L1BA 3CCVA 2F0MA 3I4LA 4LF6L 5AJ3Q 2L12A 1S4ZA 1DGSA 1WFQA 4DK3C 3NBIA 5M5XH 3K8AA 2K4KA 4GOPB 1KDAA 5EBCA 3CCEA 1ZYRD 3UI2A 1Q8KA 3NXWA 1XJVA 1H9KA 1WCMG 1GD7A 3L7ZC 1N34Q 4GKKQ 1OXTA 1NMVA 3CPFA 4KI0A 1XMQL 2F3WA 4RCNA 4POGA 1JICA 5IP9H 5M3MH 2LAJA 2R92G 2WADA 2ZQUA 4UP9A 3PV0A 5HURA 4NW2A 1JQYD 3GTGH 4M8AA 3K0XA 3IFTA 4EVOA 1PYWD 3VR5A 3KABA 5C4ZA 1SYFA 4JI0L 2K14A 2R92H 1YNJC 4YWKA 1PTOC 2YSGA 5M3MG 4JYAQ 1QB5D 5ELOA 3GTKB 4K0KL 2AWNA 2FFKB 4FF2A 1GJXA 1EY9A 2DUDA 1K3RA 1ESFA 1WCMH 3VR4A 1VQLA 1MSHA 4DFAA 1D1IA 1EWIA 5JJKA 2B2WC 3DUZA 2EXZA 1BNZA 2C9OA 5FLXE 4LFBQ 2R7ZG 1I4XA 3K5LA 2KEEA 3WWVA 4NDXA 1ZEQX 3FPPA 1B44D 5FOBB 5KRUA 1U4LA 2A69D 5KNDA 3BJUA 4JI3L 3STBD 3TQYA 3C1EA 3W5OA 1LTGD 4PZ7A 4OX9L 3HOWG 2DJYA 1XNQQ 1EY7A 4WJWA 1K83H 5IWAL 1EU4A 2DJGC 4K2LA 1B7YB 1WOCA 3K81C 2ASBA 3E0JA 4X3UA 1TIID 4B3MQ 5BN4A 2RDFA 3ERQA 4JG2A 1CSQA 2ZR4A 2L55A 5M5WB 3T16A 1TU2B 4ID6A 5CQ2A 5H1SE 3KDFB 4MHEA 1ICFB 1JB7A 3KLWA 2A74C 1A8VA 2EOTA 3VYSA 2ZQTA 3RR5A 4K8IA 4JI0Q 2C35B 4LUVA 4A3JB 1U4PA 4B3TL 3SK4A 5CGKA 3HOUB 5JVH3 1HH2P 4JI7L 3A5ZB 5BN3A 3BZCA 4DV7L 4ZQ3A 2IX3A 2ICIA 2OT2A 4I65A 4QB4A 1I94L 2Y0SG 3L9AX 1G51A 4YHHL 4TRDA 4HMIA 1EWCA 3KAIA 3NTKA 3KLSA 1F77A 1NBWA 4DNIA 2XP4A 4HIDA 1CQFA 4RKLA 1E2VA 1UWVA 4R1JA 1IW7D 5I6YA 3H0GH 2BH8A 2K04A 3D8GA 1LV9A 4RWSC 2NVTH 4O42A 1FGBD 2KHJA 1E24A 4IALA 4QGUA 1L0YB 3PIPA 4EGVA 5CV7A 2G5DA 3PO2H 3AMUA 4FF4A 1X6OA 5CYUA 3GTJB 1BQQT 1DXMA 2HQEA 1EOTA 3CRLC 4KY5A 1K9MC 2B8FA 1UE6A 5IP7H 4CKCA 4DR7Q 4GLVB 3M85A 1C48A 2DK7A 3OMCA 3GTOB 1JWSD 3I70A 4NMZA 2ALYB 2Z8LA 3MCBB 1XTCD 4CHTB 2KXQA 2XP6A 3GDEA 3KBXA 3F2CA 2BA1A 3J7YW 4G7ZC 4DR6L 4WJ3M 1V9PA 2HCIA 1R9TH 2UXBL 3J81c 1PINA 4MNOA 4JC0A 5C0XG 1IBLQ 4DR6Q 4OGQC 3DHQA 3BS1A 3S17H 1DZ1A 2HIXA 3TRZA 3M3YB 3FPUB 4LF4L 1VQAA 3H6MA 4DV2Q 4CDCC 1EEID 1TY2A 3KCEA 2B2TC 4NP5A 3NP8A 4A3BH 3VYUA 1H9MA 1YHAA 2VB2X 1PHJA 3EJIA 5IYBG 1I4QA 1BOSA 1F9SA 4B3RL 3HP3A 4GN5A 3CC2A 1A15A 1VQDA 2CQOA 2F03A 3RNUA 3I4NG 5IYBH 4Y7NH 1QWYA 1XMOQ 4R4TA 2JEBI 3I4OA 2NVQH 5ELEA 4FO2A 1YHBA 5CR3A 1VQJA 3NK9A 4A3BG 4XQQA 4HIKA 4A3LH 3J7ZC 2NVTB 2JMFA 4XTCS 3KBGA 3OHXC 1UE1A 4LF7Q 3UDIA 4PNYA 2D9UA 2EJGC 2F4IA 5C0XI 5LMNW 4IUVA 1Y1WB 4KK7A 1HZ9A 4V0BA 1KC8C 3TS0A 4XYQA 3OPOA 5LMNL 5GAHC 4AYBB 1CKNB 4CDFC 1Y1VH 4A3KB 1B2TA 1EG4A 2PCFB 2AKWB 2MP1A 1L1OB 3S2HB 2FHTA 1ENFA 3X3MA 1NR4A 4PMCA 4GNXA 1Q90A 2F0SA 5G3LD 4RKBA 1X56A 1UEAB 2Z9HA 4JOIC 4PZ8A 3HOUH 1A3UA 2QGQA 2BH2A 4DV4Q 1SE3A 1BCPB 2YV5A 5KYLA 4MZ9A 3Q22A 3M7NA 1HNZL 3PCOB 3A54A 4WORA 5J22A 1Q82C 4A93G 5I6WA 1CQVA 5EJWA 3NTIA 1SE4A 4ME5A 2XSCA 3HOZH 1KNEA 1VMCA 4LFAL 3PO2G 1GUWA 2KUMA 2AQ1B 1TWHH 1LTBD 4X6AH 3U9OA 3W1GA 2RDGA 3GTJH 3H0GB 3CC7A 1AW7A 3H0GG 3N6RA 3CQZB 1HQMC 1XYIA 5AJ3L 2ZJQA 1PFNA 1EU3A 1FL0A 2F0HA 2XRSD 2IPKD 1TY0A 2VXWA 5GADC 4KY7A 1Z7TA 5FJ8H 3KK7A 2RA4A 1PZID 3K57A 4KKUA 3PSIA 3HOZG 2QEXA 2RHQB 3CRKC 2EQSA 2R3ZA 4Y7NB 4A93H 2LMCB 2AMCB 2Z6BA 3G6EA 2PQAB 2JN4A 4FP5D 4ZYSA 4NPSA 2ZTDA 4MN3A 5ELDA 5LMNQ 1B4OA 4JCVE 1MIUA 1Q1BA 4DV2L 4AYBE 2CH4A 4JK1C 3LKXB 1VMPA 1LM0A 4KJOA 3S1RH 3CCRA 1TS5A 1LYLA 4EQOA 3BVMA 1G2TA 4LF7L 1LTRD 1HZBA 2K32A 4RG1A 3E9HA 2WP8J 5TSSA 3NWSA 4HCEA 4DR4Q 3GTMB 1WTPA 3GQBA 1K8MA 1Y1VB 1Y1VG 2L4NA 4DR1L 2UXDQ 2N88A 1HZAA 1JOOA 4QIWB 3G6JB 3CCMA 4V190 1HCZA 2SNMA 5E4XA 4IJHA 4IJLA 1Y8PB 1HUMA 1ZKOA 1SAPA 3S1QH 2KEDA 1IW7C 2WB1B 5FO7B 3LGJA 2PI2E 2XNAC 1Q86C 4EQPA 4YIJA 3RN5A 1HJPA 2Q2UA 2O2LD 5KGUA 4JI6L 2I5HA 1XPUA 5IGEA 2F0QA 1ILPA 1O7YA 2A19A 3J7AV 1HZCA 1JJ2A 1ZYRC 3GV6A 1BR9A 4IFDJ 1MSGA 4L6TB 1JWUD 1SBBB 1PYBA 1BBWA 2F0KA 4O0AA 5HGTA 4NXMQ 1JC7A 4F7XA 1VQKA 2EYFA 2NUCA 3RUZA 1CTMA 1SNCA 3M4OB 1C0AA 2ZT9C 1DONA 3HOVB 3EROA 1STEA 1C4QA 3VA7A 3NE5B 4P71A 5G3LF 1MJEA 2NVYH 1V1OA 2Q2TA 1NR2A 2N78A 1B3AA 1GUSA 1HTPA 1X65A 3BZKA 3FP9A 1VQCA 3AYHB 5C0XH 1VF5C 1K8OA 3BYTB 5M3FG 5DNFA 4HJ5A 3MWYW 3OSOA 4A3IB 2E2HH 3S1RB 4IZ8A 1PRTC 1AH9A 3CNGA 1V1QA 5C4HA 2LXJA 4RGTA 3SHLA 3WOEA 4OWXB 1A6XA 1B53A 4GOPC 2E8GA 3D3RA 2H1EA 4K2KA 5IGDA 4A4IA 1KRSA 1GHJA 1I5HW 1Y8NB 2Q8RE 2F0WA 1B9MA 3I2ZA 4PV1C 4P74A 1QJOA 2R7ZB 2RBMA 1XNQL 3HOXH 4IUNA 4PZ6A 2YSFA 2RSOA 4CDEC 3H3VI 1D5ZC 2LKVA 1MGSA 3F8TA 1LTLA 1HA5A 2F0GA 1S40A 1IBMQ 1VQ4A 1YNJD 2IWHA 1QVFA 1HNZQ 1NTGA 1PRTD 4JOIA 1EYGA 1VQ5A 3S1MH 4XIGS 2B63H 1DOMA 4HEDA 1JORA 2NN6G 2K75A 4A3EG 2WB1E 1QZGA 1IZ6A 2VS1A 3PUZA 2DWVA 3HG9A 3NHHA 2F4VQ 1WTVA 2WAQE 1I4PA 2E2DC 3F2DA 4OONA 1FLCA 1PTOB 4L5SA 3MA2B 3GTMH 1FNUA 1FD7D 4A0UA 1A3VA 3WOFA 4L63B 2P5ZX 4IO9A 4LUOA 1ENCA 3NELA 4P2CB 4P75A 4YCWA 4DF7A 5IGFA 2JA7G 2PI2A 2L9HA 3MFGA 2YU9H 3DMUA 2IL8A 3HZXA 4X65Q 4BY7H 4BS9A 3BVGA 5IWAQ 3NBHB 1NUCA 1JOKA 2IJ0A 1AP0A 1SRUA 5HY6A 2MUYA 3KF6B 3PO3B 2KOLA 2OEOA 4XQJA 1PFSA 1CI3M 1VQFA 1EWHA 3CW2C 2IX0A 3V05A 4APVA 5C4XH 1IXRA 4IURA 2PQAA 1PRTB 1A2UA 3GTQB 1EOVA 2F0IA 3SGIA 2K5WA 2PPBC 2Q5AA 1JR0D 2OQ0A 3NSWA 1V1PB 1TVXA 2QCPX 3J81E 2E2IB 4EX5A 1ENAA 3MEHA 5FLXc 1SFOB 3Q24A 2E74C 4JVZA 2VUMH 1V43A 3K6OA 2R7ZH 4DUZQ 2NVQB 2F0FA 4Q0FA 5EPJA 3F2UA 2D5DA 3CHBD 4DAYB 1M90C 2PZWA 2A5HA 3J7AF 3WH0A 4A3FG 3SDZA 4C1NI 2B8GA 4CJ0B 3QOLA 1SNPA 4ZUIA 4L8JA 4OO1G 2B2UA 3RLOA 4GN4B 1PH3A 2FXQA 4NXNQ 4JPBW 1HHVA 2BCOA 1UAPA 4UPAA 4U84A 1GUGA 3L3OC 2R92B 1KDCA 3FKIB 2R7DA 4HCSA 1O7IA 1B3QA 5ELBA 1NNXA 1KABA 4A3IG 3VYTA 3ONAB 3CCSA 1VQOA 2N49A 1M8AA 4IN3A 3S16H 1N8RC 1HFNA 1VQPA 1S5BD 4DGZA 1IL8A 2K5NA 4I7ZC 4LAAA 2R7FA 4KN7C 1ASZA 2JQOA 2HHHL 2K28A 3NEMA 2PNRC 2E45A 3HS0C 1EQQA 3KAFA 2FJ2A 1Q3LA 3T51B 1QNKA 4HJ8A 1EYCA 1N9WA 4I7AA 1D8LA 2Q2IA 5IE8A 1FR3A 4AQYQ 1TQOA 2O4XA 1W3SA 4LFCQ 4JI4Q 3L2PA 2MDIA 2VB3X 2UUCQ 1WJJA 1RTNA 4LF5Q 3Q23A 1X3FA 4N9PA 1STHA 3A8IE 4MTNA 2KENA 3H3VC 5JJLA 1RTOA 2OQKA 4H02A 4A3BB 2ZR6A 4KD3A 1SNOA 4P72A 1SLJA 2LY7A 2OF1A 2ATWA 1F2ZA 2NB0A 1PXUA 2PMZE 4BY1G 3G71A 2UXCL 1C7YA 2JK8A 4HJ7A 4J8QA 1EY8A 1KNAA 4O1NA 1Z47A 2JYOA 3T4AC 4BY7B 3V96A 2NWGA 2XTIA 4KKSA 2XPAA 1BBXC 3CCLA 1EQRA 3LWUA 2JV4A 2ZQVA 5D3IB 4R4QA 2FINB 1XMOL 2RDHA 1PH6A 2F21A 1WTHA 3MHBA 5E66A 4K8JA 5BR8Q 1H9SB 2MQHA 1CHPD 3HOXB 1E2ZA 3PO3H 4KTAA 1S5DD 4O2DA 3VR2A 2RCNA 4A3MH 1BBUA 1TWCB 3MCBA 2JA7B 4TVAB 3KF8B 2DNCA 2JSOA 2F0TA 5K5PA 1QG7A 2SOBA 1OO9B 2QRVA 3GTGB 1GKHA 1CM9A 1EY5A 1LLRD 1J6QA 1L2FA 1A3TA 3K7AH 4IUUA 1ZCNA 4NKLA 1WTWA 5EKIA 2JA5G 2EY6A 2B63B 4DV1L 2A6ED 3URYA 5E1FA 1N33Q 2X6GA 2F0PA 1RODA 1TS4A 1IBML 2MHVA 1A2TA 2Y0SE 1PZJD 3I72A 1SMYD 3FKIH 4XT3B 5HGQA 2EY1A 4POFA 1UNSA 2R93B 1EQTA 1S5CD 3VA5A 3BYYB 3D0FA 1LT4D 5EPKA 1L1OC 1PLFA 4X65L 2I0QA 3TSSA 4H0LC 1JMCA 5JVG3 1PTOF 3SK5A 3I55A 2CWPA 5KIXA 1XNRL 3M4OH 1O6WA 4R4CA 3ND8A 1RL2A 1HUNA 3R2IA 4E6IA 2E5LL 2B3GA 2EY5A 2F0JA 2HHHQ 2MO0A 3OMGA 3FHWA 4QL5A 3I56A 4GNXC 1FJGQ 3I3CA 2XP5A 1J9OA 4B3SL 2NZHA 3S16B 2K52A 4EQ5A 1D7QA 2HDMA 3H91A 3K5NA 1HXYD 5IGGA 1F2YA 5K36H 1HNXQ 1JE4A 2EJFC 4E5RA 4DV3Q 1IBKQ 4DR1Q 3KDFA 4DPGA 4G57A 2UUCL 1DOKA 2B2VA 4ZRZA 3D4DA 2B2UC 1DD2A 3PQHA 4B9WA 5I9PA 2CW0C 4A3KG 2Y8NB 4C3HG 1U4MA 4IOCA 2E5LQ 4A3MB 2UUAQ 3K80C 3U4VA 5U47A 4UP8A 5FLMH 2XIWA 4A3GH 1CHQD 4AIMA 2MFIA 4N8FA 5IYDH 1LTID 4DUZL 4GLXA 4B3TQ 2CKZB 1FJGL 2N55A 2Y0SB 3MXPA 3UE1A 4F87A 3SK6A 1SNDA 5CC4A 3QO2A 2ZQSA 1J8IA 4LK1C 2JA9A 4C2MB 2K50A 3FMCA 1Y14B 3KOJA 1EQVA 1Y8OB 2XRQD 2EZ5W 4JI2L 1TWCH 4ZKCB 2Z1CA 3PO2B 3SE0A 1EZ8A 4IUPA 1YVCA 1X3EA 4K6LA 1BCPD 1EIHA 4DUYQ 1TR5A 3A5UA 1BUVT 1NMGA 5FKAC 3PUVA 1U9RA 4FXKC 4GS3A 1NCVA 1YNNC 3WDNA 1I94Q 1SEBD 3DM3A 2QDBA 1G8ZD 3HOZB 5DLQE 2DN8A 4GNXB 1VQGA 1PH2A 3PUYA 1ASYA 1GOZA 5FK9C 1L1OA 1TWHB 1VQIA 4DK0A 4DR7L 1CZWA 2JA8B 1EL0A 1F9PA 2J4XA 3TP6A 4JI6Q 4C3IG 1SYBA 1LTSD 4CJ1B 4GOPA 3RD4A 3A0JA 3T1HQ 3LKXA 1SE2A 1I50B 3AEVA 3K0YA 4BXXH 4IOAA 1N36Q 3SVMA 4YCVA 4A3CH 3QWNA 2JA6G 2DMVA 3RN2A 1XNRQ 2JP1A 4CJ2C 4ALPA 2IX1A 3F2BA 2KCTA 2E75C 4A75A 1DOLA 2NVXB 4UHVA 4QY7A 4A3DH 1H9JA 1EIGA 2RF4A 2AQ3B 1H9SA 2UXDL 1EEFD 2ID0A 4LWCA 5JPMC 3P75A 5FLXL 4BBSB 4BBSG 1L0XB 2MO1A 4HIOA 4LFCL 2A68D 3FS8A 3T1YL 4LMQD 4C56C 3RLNA 2L0CA 4F8MA 4AQYL 3AB9A 2QILA 2VW9A 3KAGA 4F88A 4A3EB 5IODA 3NQTA 1ZXTA 3TP7A 3AQQA 4RFBA 2NZ1D 1CUKA 2F0DA 3MXUA 1WMVA 5GQOA 1VQHA 2AQ2B 2XP9A 1AEXA 3MXNA 4K0KQ 1K28A 5J3BA 3GO5A 1Y1WH 1CKMA 3S1QB 2XN9C 4IPHA 1PH4A 2DY7A 2UXCQ 1RP5A 4X3KA 1SNMA 3IFDA 3HFZB 3F1ZA 1LACA 2PO4A 3KF6A 4IUTA 1YNND 2WAQB 3NBHA 5JEAH 1VQ8A 4QUFA 5JEAG 1O78A 2AHOB 3KADA 1K83B 3K7UC 3DWAA 4JI5Q 1IYVA 1MI2A 1SR3A 2MNAA 3Q8DA 3TZDA 4ZKBB 1VQ7A 2X69A 1GM5A 4UY8C 1ET6A 3B6YA 1CKNA 3CAMA 3EFXD 5M5XB 1G2SA 4FF1A 2HD3A 4DV6L 4OL7A 4HAEA 4P73A 1VQ6A 4H44C 4DAVA 5C3EG 5EKKA 1LUZA 3EIVA 4OXPA 4JW0A 3OOBA 3HOYH 3S9WA 3PIP3 4U85A 3DWPA 2EPBA 2UU9L 1YJWA 3R3OA 3C46A 2QEJC 4X66L 5KEEA 1SSOA 2VZAA 4XT1B 2V4DA 4KHPL 4U68A 3P7JA 5GROA 4BBSH 4NB3A 1CT1D 4X62Q 2A6HC 4OIKA 4DR2L 2KQ3A 4DV0Q 5D3DA 4K5XA 4YY3L 1HR0L 1VDZA 1CA6A 1SJED 3R93A 4CKBA 3PIO3 4LJZC 4JI1Q 4QIWE 1PFBA 1T5EA 1P8LA 2KECA 2R6GA 1XX8A 3ZYYX 1GO3E 4IPCA 4A3JG 5LL6S 4PQXA 4JBJA 4A3MG 1XPOA 4KD4A 5J39A 3PO3G 3MAQA 1U4RA 3PQIA 4DV4L 3I4MH 1AE2A 3MQHA 3QJYA 4NXNL 1KQSA 2EYMA 2K5DA 2M2LA 1GUTA 3NUCA 2JXMB 3TZUA 2D62A 1I3QB 1MJCA 3CF5A 2EE1A 1QUQA 4IFDH 4RMFA 1B50A 1PTOD 2NN6I 2B2WA 2L11A 3HKZG 3D6WA 4KHZA 4BA1I 3LX0A 3TEHB 3GTLB 2PZTA 2ZXOA 3KAHA 1AZPA 1I5FA 2IW3A 5IYCG 1QVCA 4PG3A 1TWFB 3TCZA 3FEWX 1RKNA 1XXGA 1TT2A 3KJOA 1BXTA 1WVLA 1STBA 3GV3A 3M4QA 1L0WA 3N52A 1KAWA 1GHKA 2G9DA 4X62L 3QR8A 4MIUA 1RCVD 4DR2Q 4LFBL 1I6HH 1EFID 2G9HD 3S14H 5IYDG 2FMMA 2OXPA 3E0EA 1K8AC 4A3GG 5T1IA 5FLMG 3RZOH 3BG3A 3S15B 2LFNA 3M9BA 1QVGA 2EDGA 4DR3L 2GVAA 3TREA 2B2VC 4A3KH 2SEBD 4DK6C 5COYA 4ULLA 4HN7A 3OIPA 3QG1A 2KJXA 4DR3Q 4X66Q 1KAAA 3LWEA 5CV5A 4CKEA 5DM73 3OYYA 3TBIB 1KLUD 2VNUD 4EQNA 4BA2I 4K14A 1JOQA 2ZM6Q 1G6ZA 2Z0SA 3C2PA 3MVVA 1X55A 1STGA 3OWEB 1PZKD 4A3IH 1NMFA 1LT3D 1RF2D 5D65A 3A8JE 1U5KA 1SXTA 1TKWB 5C44H 1HPCA 4ZCKA 1EY0A 4YHHQ 4R9WA 1HA6A 4IUQA 4OIJA 4NXML 5IOCA 1FVIA 4DR5Q 1RDPD 1HNXL 4KJNA 1F2MA 3BU2A 4H7BA 1V8QA 2ZXRA 3IAYA 2K5VA 5M5YB 2A8VA 4AH6A 3K5MA 3TDBA 1PV4A 2MPMA 4DU9A 3DWQA 4A3FB 1B70B 1EUJA 1J5EQ 3IL8A 3C1FA 5A2QL 1ONLA 3H09A 2YYZA 5AFWA 2XP8A 1IKMA 2BE5D 5JPNC 3UDXA 1JMQA 1PRTF 4K5WA 2CFMA 1B8AA 1KDBA 5C5MA 3FSBA 3I8ZA 5A2QE 3HKZB 3FKIG 3H94A 3TMEA 2K33A 4GKJQ 3S1MB 4LUZA 1GVPA 2ZJRA 2WAQG 4IPGA 2F0NA 2PW7A 3J80E 1A63A 4L5TA 4CDDC 5FO8B 1YEZA 2WB1G 5EBDA 1K9RA 3MC0B 2VQEL 3T1YQ 2JA5H 2EYHA 1R9TB 2EYJA 3NPPA 1DM0B 2SNSA 1M4VA 1WTXA 5ELFA 2VL6A 2UUBL 3J80L 4JI5L 2XVSA 1LT6D 1DYQA 2ICEC 4MTKA 2HUGA 2XP7A 2Q2HA 1JJCB 4K6DA 4BY7G 2PW5A 4LNQA 3RLFA 1YIJA 4A93B 5C4JH 1TR8A 2YAJB 1EYAA 1CK1A 3K7AB 2N8NA 3W1BA 1IL2A 1JE5A 5I2YA 1PH1A 3T1HL 5IYCH 5E3FA 2QW7A 3SR1A 4REXA 2LSSA 4A3DB 5E7NA 3A7AB 3SK8A 5IT9L 4JBWA 5E62A 2F3VA 2SDFA 3KF8A 4UP7A 3S2HH 1EZ6A 2R93H 3T56B 3PIOA 1K3BC 5D14A 2R93G 1X3PA 1EY4A 4IPDA 3EBEA 5EQ0A 4OHJA 3HGBA 1CSPA 1CKOA 1ET9A 1WTQA 4IFDG 1X3GA 4JV5L 2KVMA 1IYUA 5LMUQ 3DXJC 1DJRD 3NWTA 1VCIA 2K5QA 2EJMA 2EXDA 2ZTCA 2XP3A 4LFAQ 3IKJA 3S2DB 4FDBA 1RIPA 3G4SA 4ZLTF 1QILA 3P20A 4X64L 1SNQA 1G91A 3LE4A 1TK7A 1LO5D 2RKSA 2WACA 4C3IB 2NBFA 5JEAJ 1JWMD 4RHSA 1D5XC 2L5TA 4GKJL 4A3JH 3ULJA 1PH9A 4JI2Q 1WR7A 2Z4HA 5JJZA 5ELCA 2J0TD 1ICWA 4DV5Q 3S24A 4OWTB 1C9OA 4ZAIA 2B2YC 3KYHC 1N32Q 3D4RA 1W6KA 1X3QA 1J5EL 1C8CA 1WI5A 3HEJA 2VQFQ 2OCEA 3Q6SA 1D5MC 3FVQA 5DAUA 3OTOL 1W2BA 3S1NH 4B3ML 5JJIA 4TKOB 2AUJD 1RJTA 2YTYA 1QCBD 2EZVA 5CV9A 1A0IA 1Q12A 1KHIA 4FXGC 3RMHA 4WRDA 3GTPH 1NE3A 1SYDA 2QF7A 3UDGA 1IYJB 1KD1C 3M7GA 2KCCA 1JCKB 2CQAA 4DV3L 4DXFA 2KHSA 4KV6A 2ITKA 3OW7A 4DUYL 3QB3A 3S15H 2NTSA 1YITA 2K7VA 3QOJA 1UUPA 5C3EH 4HJAA 3DM1A 3A8KE 2CW0D 3U50C 2XWJB 2BE5C 3JAML 2H4OA 2D2CC 4S3SA 3KLSX 5C44G 1NSNS 1WTRA 3ODKA 4B3RQ 1RD9D 4U673 5GAEC 3VDYA 2HT1A 5J1ZA 5IGBA 2BDNA 3ULPA 5DM63 2WV6D 3I4NB 2DK1A 4DV5L 4AYBG 3JC66 3JAME 1R4PB 2KA7A 4WFN3 1P16A 4YWLA 2YSBA 4QIBA 4X3TA 2M8IA 2EY2A 4L5QA 4RGOS 4M1UB 1K8GA 1BKBA 1SYGA 2VQFL 2R61A 5KNBA 2OTJA
chains in the Genus database with same CATH topology
1SYCA 3U4ZA 1A62A 1Y1WG 2NVYB 4DAYA 1MKHA 3A55A 4KMUC 3ZJYC 1N32L 3Q0AA 5C4XG 1D1KA 4JI1L 1CA5A 1HNWQ 1PH7A 2ZTEA 3K5OA 1FNVA 1JJGA 4J1MA 3CCQA 4J6HA 3U9SA 2F0UA 1LT5D 5EKLA 4QUCA 5C4JB 2EYLA 5JOBA 1Z6HA 1HRJA 3HOWB 4KKTA 1I3QH 3S2DH 4LF4Q 1Y69U 1V1PA 2JA7H 1EIYB 2ZXPA 4B9XA 3NTPA 4FVMA 3UDFA 4DK1A 1Q1EA 4XXEA 2YU9B 2D0PA 2NVXH 3J81j 1U0LA 3KFUA 1IKLA 1TS2A 1PYSB 2V1CC 2VQEQ 2NN6H 4DN4M 4PMWA 2PQEA 1CFMA 4DNRB 2JA5B 2B63G 1WTOA 5ISRA 3CKIB 2FMCA 3R8BA 3S17B 5FJ8G 2AWOA 2IT1A 5I2XA 1X54A 2WAEA 1SDFA 5LL6X 5E5WA 4LF9Q 2JA6B 1EG3A 4BXXG 3FDTA 4RCOA 3FSCA 4R8NA 1VQBA 2IHEA 1Q8IA 1STNA 2UXBQ 4DR4L 1BVSA 3MFYA 3DEPA 4R4IA 3I4MG 3HOXG 2M8JA 3SXHA 1RHPA 1IBKL 1BO0A 1EYDA 2UU9Q 2HDLA 2MGSA 2M00A 2IY5B 4C2MH 3PMFA 1TWGB 1SROA 3BDCA 3RZDB 2I5LX 5IIFA 3E9IA 4KHPQ 2EYPA 2RSNA 2L4JA 3J7A5 2F0LA 4JI4L 3HOUG 2TMPA 5CV8A 2EIFA 1IHZA 1TS3A 3FRPB 4DAPA 1S72A 5EPLA 3G7LA 3M4PA 3I73A 3K58A 5M3FH 2E2IH 4IQZA 2YSHA 3ER0A 1OXVA 4DV7Q 2CHBD 4OWWB 2F1MA 4UDUC 4J15A 2ZAJA 2LXKA 2B2TA 2NYZD 1VQEA 2I5MX 1X9NA 1XTDA 1O80A 3I7FA 5C3EB 2C5CA 3AFPA 4H13C 4N9TA 4HTHA 3VR3A 3E5SA 5M5WH 3CMEA 3TP8A 4TSSA 2A6HD 2WFWA 4JBMA 3A56A 3BDOA 1KRTA 4A3GB 3KUPA 4U86A 3HOYG 5C5LA 1SJHD 4DNTB 4QMGA 3E6ZX 3O13A 3SEBA 2ZM6L 4B08A 3ITPA 4B3SQ 2RVLA 5GAGC 1E3PA 4QQBX 4C3HH 1YJ9A 5E4WC 2A73B 1Q7YC 2ES2A 3VYRA 3TP5A 3IRBA 4LF5L 4UAIA 1N36L 3X3NA 1I4GA 5K36G 1W6JA 2Z6KC 4R8IA 1PDQA 1B9NA 1S5ED 3S1NB 1VQMA 2GN5A 5LMUL 1H95A 1KXLA 3MXGA 1II3A 1NAPA 2K1BA 3W3AA 1PH5A 1ILQA 1Q81C 2XPBA 5I4DA 4GN3B 2CCZA 3W2DA 1E22A 2JEAI 4DAMA 4OX9Q 1BDOA 2RQXA 5CMDA 4JI3Q 3I4MB 5CV6A 5T1GA 4HSPA 2RHSB 5C6AA 3MEFA 4YCUA 4DV0L 5BN5A 2KBNA 1O7LA 3D6CA 1N33L 1G291 4RGMA 1CZGA 3EA6A 3ULLA 3ICEA 2AUKA 1R4QB 1YBYA 4DXGA 5A35A 2DGYA 3BVZA 4KLKA 3MQGA 3I91A 1PH8A 4GLAC 2OWOA 3EVQA 2JX8A 1ESRA 4KN4C 1T9HA 1SMXA 1LABA 2TSSA 4QJFA 2VUMB 1Z9FA 1S5FD 2UUBQ 1OXSC 3CU7A 4A3DG 4YY3Q 2J7ZA 4FYDA 4LF9L 2I07B 2ZJPA 3PUXA 1O7ZA 5M9OA 1TWFH 3CPWA 1AFPA 4KY6A 3T13A 3A7LA 1WYDA 1GUNA 1AN8A 2JE6I 1ML0D 2JA6H 5C3WA 2K5HA 5JAVA 3TS2A 4A3CG 3HKSA 2N3SA 2F52A 5M3FB 1IBLL 2F4VL 4GKKL 4C3IH 4ZK9B 4C3JB 1MBYA 2BA0A 2F0OA 2A6EC 3L0OA 2VY3A 4K5VA 1FGUA 3HOYB 2YSIA 2E2HB 4QF4A 3C3LA 1NY4A 3K59A 3NTHA 1NJIC 1TWAB 4Z9CB 1AZQA 3CCJA 1JB3A 1BF4A 3OW2A 4FF3A 1F8AB 1KIXA 2H5XA 3UE0A 2UUAL 5CORA 1B1ZA 1KL9A 1EIFA 1S3OA 2D0OA 3GTLH 1WD1A 3TC5A 1K0RA 2O5JC 1D6EC 5I9OA 3H15A 4R4OA 2GVBA 4CBVA 2E2JB 5NUCA 4FXDA 4JBKA 5CV4A 4ODGA 2KCNA 4HSVA 1TXYA 1FNWA 2KHIA 1MD2D 2JXWA 1OXUA 1T5XD 3L4HA 1I4RA 4HJ9A 1UEBA 4X3SA 2ZR5A 2PMZB 1PFMA 4LF8L 3NENA 4BBRB 4RHRA 2Z6KA 4WJ4A 4HR7B 4XDXA 4DV6Q 2BDOA 3CQZH 2QKIC 4A0TA 4G7HC 3DEOA 1VS0A 4Y52H 1BCPC 4TQUS 3CMAA 4XQNA 4A3LG 3OWFA 5IT9E 1SN8A 2L15A 3D4WA 5E65A 1TWGH 1F9RA 3EQLC 3PUWA 3GTKH 2Q8IB 2WINB 2X6LA 3M4YA 4RGNA 2DNEA 1K73C 4DA2A 2A69C 1H9RA 1QUQB 1WCMB 1E2WA 1PTOH 4LW1A 2K6AA 3I4NH 4RA8A 1X32A 1F9QA 1OTCA 3GP7A 3CP0A 3R2TA 1I6VC 2LS01 4G7OC 3MZ5A 3CXCA 3TN2A 1HNWL 2B2YA 3AFQA 3PF5A 3A74A 1GUOA 3GTPB 2GA4B 1FYCA 1VQ9A 4JV5Q 5FO9B 2EVBA 1SMYC 2HIVA 3OTOQ 4JI7Q 4L5RC 3BDLA 2KCMA 5BR8L 5M3MB 3OOCA 1STAA 1YJNA 1M1KC 2PNHA 2EYOA 4BY1B 4C1NK 5CBEE 5EAYA 3PF4A 3VR6A 4PMBA 1I6HB 4OO1H 1EFWA 1I4HA 1HFGA 3J80c 3U58A 2K05A 1Q46A 1AE3A 2WKCA 5IP9G 3BZDB 2WIIB 2F3IA 3ERSX 4A3FH 3ND9A 1LTAD 1HR0W 1YZ6A 1PMRA 2YTVA 4C3HB 5KYIA 1SYEA 4CGYB 1YI2A 3D31A 3STBC 4DV1Q 1UE7A 3G48A 5EGTA 4XYOA 3RZOB 1SFOH 1E1TA 2CWAA 3OIQA 3DLLA 2VUMG 2F0EA 5KNCA 4X64Q 4ZUJA 1E0BA 1SE8A 2K01A 1YHQA 5AHTA 5IP7G 4JYAL 5LHY1 1N34L 2F0VA 2B29A 3J80i 3HRZC 2ENBA 1QE6A 2PZUA 4IFDI 4A76A 2BOSA 1E1OA 3I90A 2JJQA 1KTKA 5C44B 4Q5VA 4HMJA 4LF8Q 2HQLA 1DCZA 1XWEA 5F2DA 2I46A 5C4XB 3EN2A 4C3JG 3HKZE 1D2BA 2E2JH 3HOVG 2NTTA 3CC4A 3V2TA 4BBRG 5IY0A 3GTQH 3CCUA 2XGTA 1VQNA 2M9VA 1PVOA 5DEHA 3NQIA 3MTSA 3KJPA 2XWBB 1KLGD 4HIMA 1QZHA 1PA6A 1VF7A 4FNFA 5ELNA 3JAMi 1LTTD 4KHVA 3RZDH 1YNXA 1JT8A 1EY6A 3S14B 3TDQA 1TWAH 3CD6A 2DY8A 2NZOA 2JA8H 3KLRA 1YW5A 3J81i 1STYA 4GZYC 4ME3A 2Z4IA 4QCLA 3QIAA 2A68C 2HCCA 3AU7A 1I50H 4BWGB 1F2LA 2PYKA 3T53B 3MXNB 2QA4A 3H3VH 4DR5L 3GTOH 2JA8G 5IGCA 1XMQQ 3GD7A 2YTXA 4A3EH 3PGZA 2CVRA 2WKDA 5IT9c 1OXXK 5E64A 1HR0Q 4BY1H 5C3XA 4ABNA 4OO1I 2A1AA 4RAUC 2Q8TA 3JAMc 2RE3A 2B39A 4LF6Q 2M3OW 2K03A 5CBAE 5C0XJ 4BBRH 1QNUA 1HTLD 3HOVH 1QOHA 4ILWA 1GXDC 4C3JH 1XPRA 1E7ZA 2IHFA 3J81L 2OTLA 3M3YH 1K9QA 2E76C 2MJ8A 4JI8Q 1HQRD 4YWMA 4RH6A 1BCPF 4G4KA 4JI8L 3HOWH 4DKAC 2O5IC 5M5YH 1WD0A 1G6PA 3LNNA 3P1HA 1UE5A 2L1BA 3CCVA 2F0MA 3I4LA 4LF6L 5AJ3Q 2L12A 1S4ZA 1DGSA 1WFQA 4DK3C 3NBIA 5M5XH 3K8AA 2K4KA 4GOPB 1KDAA 5EBCA 3CCEA 1ZYRD 3UI2A 1Q8KA 3NXWA 1XJVA 1H9KA 1WCMG 1GD7A 3L7ZC 1N34Q 4GKKQ 1OXTA 1NMVA 4KI0A 3CPFA 1XMQL 2F3WA 4RCNA 4POGA 1JICA 5IP9H 5M3MH 2LAJA 2R92G 2WADA 2ZQUA 4UP9A 3PV0A 5HURA 4NW2A 1JQYD 3GTGH 4M8AA 3K0XA 3IFTA 4EVOA 1PYWD 3VR5A 3KABA 5C4ZA 1SYFA 4JI0L 2K14A 2R92H 1YNJC 4YWKA 1PTOC 2YSGA 5M3MG 4JYAQ 1QB5D 3GTKB 5ELOA 4K0KL 2AWNA 2FFKB 4FF2A 1GJXA 1EY9A 2DUDA 1K3RA 1ESFA 1WCMH 3VR4A 1VQLA 1MSHA 4DFAA 1D1IA 1EWIA 5JJKA 2B2WC 3DUZA 2EXZA 1BNZA 2C9OA 5FLXE 4LFBQ 2R7ZG 1I4XA 3K5LA 2KEEA 3WWVA 4NDXA 1ZEQX 3FPPA 1B44D 5FOBB 5KRUA 1U4LA 2A69D 5KNDA 3BJUA 4JI3L 3STBD 3TQYA 3C1EA 3W5OA 1LTGD 4PZ7A 4OX9L 3HOWG 2DJYA 1XNQQ 1EY7A 4WJWA 1K83H 5IWAL 1EU4A 4K2LA 1B7YB 1WOCA 3K81C 2ASBA 3E0JA 4X3UA 1TIID 4B3MQ 5BN4A 2RDFA 3ERQA 4JG2A 2ZR4A 1CSQA 2L55A 5M5WB 3T16A 1TU2B 4ID6A 5CQ2A 5H1SE 4MHEA 3KDFB 1JB7A 3KLWA 2A74C 1A8VA 2EOTA 3VYSA 2ZQTA 3RR5A 4K8IA 4JI0Q 2C35B 4LUVA 4A3JB 1U4PA 4B3TL 3SK4A 5CGKA 3HOUB 5JVH3 1HH2P 4JI7L 3A5ZB 5BN3A 3BZCA 4DV7L 4ZQ3A 2IX3A 2ICIA 2OT2A 4I65A 4QB4A 1I94L 2Y0SG 3L9AX 1G51A 4YHHL 4TRDA 4HMIA 1EWCA 3KAIA 3NTKA 3KLSA 1F77A 1NBWA 4DNIA 2XP4A 4HIDA 1CQFA 4RKLA 1E2VA 1UWVA 4R1JA 1IW7D 5I6YA 3H0GH 2BH8A 2K04A 3D8GA 1LV9A 4RWSC 2NVTH 4O42A 1FGBD 2KHJA 1E24A 4IALA 4QGUA 1L0YB 3PIPA 4EGVA 5CV7A 3PO2H 3AMUA 4FF4A 5CYUA 1X6OA 3GTJB 1BQQT 1DXMA 2HQEA 1EOTA 3CRLC 4KY5A 1K9MC 2B8FA 1UE6A 5IP7H 4CKCA 4DR7Q 4GLVB 3M85A 1C48A 2DK7A 3OMCA 3GTOB 1JWSD 3I70A 4NMZA 2ALYB 2Z8LA 3MCBB 1XTCD 4CHTB 2KXQA 2XP6A 3GDEA 3KBXA 4G7ZC 2BA1A 3J7YW 3F2CA 4DR6L 4WJ3M 1V9PA 2HCIA 1R9TH 2UXBL 3J81c 1PINA 4MNOA 5C0XG 4JC0A 1IBLQ 4DR6Q 4OGQC 3DHQA 3BS1A 1DZ1A 3S17H 2HIXA 3M3YB 3TRZA 3FPUB 4LF4L 1VQAA 3H6MA 4DV2Q 1EEID 1TY2A 3KCEA 2B2TC 4NP5A 3NP8A 4A3BH 3VYUA 1H9MA 1YHAA 2VB2X 1PHJA 3EJIA 5IYBG 1I4QA 1BOSA 1F9SA 4B3RL 3HP3A 4GN5A 3CC2A 1A15A 1VQDA 2CQOA 2F03A 3RNUA 3I4NG 5IYBH 4Y7NH 1QWYA 1XMOQ 4R4TA 2JEBI 3I4OA 2NVQH 5ELEA 4FO2A 1YHBA 5CR3A 1VQJA 3NK9A 4A3BG 4XQQA 4HIKA 4A3LH 3J7ZC 2NVTB 2JMFA 4XTCS 3KBGA 3OHXC 1UE1A 4LF7Q 3UDIA 4PNYA 2D9UA 2EJGC 2F4IA 5C0XI 5LMNW 4IUVA 1Y1WB 4KK7A 4V0BA 1HZ9A 1KC8C 3TS0A 4XYQA 3OPOA 5LMNL 5GAHC 4AYBB 1CKNB 1Y1VH 4A3KB 1B2TA 1EG4A 2MP1A 2PCFB 2AKWB 3S2HB 1L1OB 2FHTA 1ENFA 3X3MA 1NR4A 4PMCA 4GNXA 1Q90A 2F0SA 5G3LD 4RKBA 1X56A 1UEAB 4JOIC 4PZ8A 3HOUH 1A3UA 2QGQA 2BH2A 4DV4Q 1SE3A 1BCPB 2YV5A 5KYLA 4MZ9A 3Q22A 3M7NA 1HNZL 3PCOB 3A54A 4WORA 5J22A 1Q82C 4A93G 5I6WA 1CQVA 5EJWA 3NTIA 1SE4A 4ME5A 2XSCA 3HOZH 1KNEA 1VMCA 4LFAL 3PO2G 1GUWA 2KUMA 2AQ1B 1TWHH 1LTBD 4X6AH 3U9OA 3W1GA 2RDGA 3GTJH 3H0GB 3CC7A 1AW7A 3H0GG 3N6RA 3CQZB 1HQMC 1XYIA 5AJ3L 2ZJQA 1PFNA 1EU3A 2XRSD 2F0HA 1FL0A 2IPKD 1TY0A 2VXWA 5GADC 4KY7A 1Z7TA 5FJ8H 3KK7A 2RA4A 1PZID 3K57A 4KKUA 3PSIA 3HOZG 2QEXA 2RHQB 3CRKC 2R3ZA 2EQSA 4Y7NB 4A93H 2LMCB 2AMCB 3G6EA 2PQAB 4FP5D 4ZYSA 4NPSA 2ZTDA 4MN3A 5ELDA 5LMNQ 1B4OA 4JCVE 1MIUA 1Q1BA 4DV2L 4AYBE 4JK1C 3LKXB 1VMPA 1LM0A 4KJOA 3S1RH 3CCRA 1TS5A 1LYLA 4EQOA 3BVMA 1G2TA 4LF7L 1LTRD 2K32A 1HZBA 4RG1A 3E9HA 2WP8J 5TSSA 3NWSA 4HCEA 4DR4Q 3GTMB 1WTPA 3GQBA 1K8MA 1Y1VB 1Y1VG 2L4NA 4DR1L 2UXDQ 2N88A 1HZAA 1JOOA 4QIWB 3G6JB 4V190 3CCMA 1HCZA 2SNMA 5E4XA 4IJHA 4IJLA 1Y8PB 1HUMA 1ZKOA 1SAPA 3S1QH 2KEDA 1IW7C 2WB1B 5FO7B 3LGJA 2PI2E 2XNAC 1Q86C 4EQPA 4YIJA 3RN5A 1HJPA 2Q2UA 2O2LD 5KGUA 4JI6L 2I5HA 1XPUA 5IGEA 2F0QA 1ILPA 1O7YA 2A19A 3J7AV 1HZCA 1JJ2A 1ZYRC 3GV6A 1BR9A 4IFDJ 1MSGA 4L6TB 1JWUD 1SBBB 1PYBA 1BBWA 2F0KA 4O0AA 5HGTA 4NXMQ 1JC7A 4F7XA 1VQKA 2EYFA 2NUCA 3RUZA 1CTMA 1SNCA 3M4OB 1C0AA 2ZT9C 1DONA 3HOVB 3EROA 1STEA 1C4QA 3VA7A 3NE5B 4P71A 5G3LF 1MJEA 2NVYH 1V1OA 2Q2TA 1NR2A 2N78A 1B3AA 1GUSA 1HTPA 5C0XH 1X65A 3AYHB 1K8OA 1VQCA 3BZKA 1VF5C 3FP9A 3BYTB 5M3FG 5DNFA 4HJ5A 3MWYW 3OSOA 4A3IB 2E2HH 3S1RB 4IZ8A 1PRTC 1AH9A 3CNGA 1V1QA 5C4HA 4RGTA 3WOEA 3SHLA 2LXJA 4OWXB 1A6XA 1B53A 4GOPC 3D3RA 2E8GA 2H1EA 4K2KA 5IGDA 4A4IA 1KRSA 1GHJA 1I5HW 1Y8NB 2Q8RE 2F0WA 1B9MA 3I2ZA 4PV1C 4P74A 1QJOA 2R7ZB 2RBMA 1XNQL 3HOXH 4IUNA 4PZ6A 2YSFA 2RSOA 3H3VI 1D5ZC 2LKVA 1MGSA 3F8TA 2F0GA 1HA5A 1LTLA 1S40A 1IBMQ 1VQ4A 1YNJD 2IWHA 1QVFA 1HNZQ 1NTGA 1PRTD 4JOIA 1EYGA 1VQ5A 3S1MH 4XIGS 2B63H 1DOMA 4HEDA 1JORA 2NN6G 2K75A 4A3EG 2WB1E 1QZGA 1IZ6A 2VS1A 3PUZA 2DWVA 3HG9A 3NHHA 2F4VQ 1WTVA 2WAQE 1I4PA 2E2DC 3F2DA 4OONA 1FLCA 1PTOB 4L5SA 3MA2B 3GTMH 1FNUA 1FD7D 4A0UA 1A3VA 3WOFA 4L63B 4IO9A 4LUOA 1ENCA 3NELA 4P2CB 5IGFA 4DF7A 4P75A 4YCWA 2JA7G 2PI2A 2L9HA 3MFGA 2YU9H 3DMUA 2IL8A 3HZXA 4X65Q 4BY7H 4BS9A 3BVGA 5IWAQ 1AP0A 1NUCA 1JOKA 2IJ0A 3NBHB 1SRUA 5HY6A 2MUYA 3KF6B 3PO3B 2KOLA 2OEOA 4XQJA 1PFSA 1CI3M 1VQFA 1EWHA 3CW2C 2IX0A 3V05A 4APVA 5C4XH 1IXRA 4IURA 2PQAA 1PRTB 1A2UA 3GTQB 2F0IA 1EOVA 3SGIA 2K5WA 2PPBC 2Q5AA 1JR0D 2OQ0A 3NSWA 1V1PB 1TVXA 2QCPX 3J81E 2E2IB 4EX5A 1ENAA 3MEHA 5FLXc 1SFOB 3Q24A 2E74C 2VUMH 1V43A 3K6OA 2NVQB 4DUZQ 2R7ZH 2F0FA 4Q0FA 5EPJA 3F2UA 2D5DA 3CHBD 4DAYB 1M90C 2PZWA 2A5HA 3J7AF 3WH0A 4A3FG 3SDZA 4C1NI 2B8GA 4CJ0B 3QOLA 1SNPA 4ZUIA 4L8JA 4OO1G 2B2UA 3RLOA 4GN4B 1PH3A 2FXQA 4NXNQ 1HHVA 2BCOA 1UAPA 4UPAA 4U84A 1GUGA 3L3OC 2R92B 1KDCA 3FKIB 2R7DA 4HCSA 1O7IA 5ELBA 1KABA 4A3IG 3VYTA 3ONAB 3CCSA 1VQOA 2N49A 1M8AA 4IN3A 3S16H 1N8RC 1HFNA 1VQPA 1S5BD 4DGZA 1IL8A 4I7ZC 2K5NA 4LAAA 2R7FA 4KN7C 1ASZA 2JQOA 2HHHL 2K28A 3NEMA 2PNRC 2E45A 3HS0C 1EQQA 3KAFA 2FJ2A 1Q3LA 3T51B 1QNKA 4HJ8A 1EYCA 1N9WA 1D8LA 2Q2IA 5IE8A 1FR3A 4AQYQ 1TQOA 2O4XA 1W3SA 4LFCQ 4JI4Q 3L2PA 2MDIA 2VB3X 2UUCQ 1WJJA 1RTNA 4LF5Q 3Q23A 1X3FA 4N9PA 1STHA 3A8IE 4MTNA 2KENA 3H3VC 5JJLA 1RTOA 2OQKA 4H02A 4A3BB 2ZR6A 4KD3A 1SNOA 4P72A 1SLJA 2LY7A 2OF1A 2ATWA 1F2ZA 2NB0A 1PXUA 2PMZE 4BY1G 3G71A 2UXCL 1C7YA 2JK8A 4HJ7A 4J8QA 1EY8A 1KNAA 4O1NA 1Z47A 2JYOA 3T4AC 4BY7B 3V96A 2NWGA 2XTIA 4KKSA 2XPAA 1BBXC 3CCLA 3LWUA 1EQRA 2JV4A 2ZQVA 5D3IB 4R4QA 2FINB 1XMOL 2RDHA 1PH6A 2F21A 3MHBA 5E66A 4K8JA 5BR8Q 1H9SB 2MQHA 1CHPD 3HOXB 1E2ZA 3PO3H 4KTAA 1S5DD 4O2DA 3VR2A 2RCNA 4A3MH 1BBUA 1TWCB 3MCBA 2JA7B 4TVAB 3KF8B 2DNCA 2JSOA 2F0TA 5K5PA 1QG7A 2SOBA 1OO9B 2QRVA 3GTGB 1GKHA 1CM9A 1EY5A 1LLRD 1J6QA 4NKLA 1A3TA 4IUUA 2B63B 1ZCNA 1WTWA 1L2FA 5EKIA 3K7AH 2EY6A 2JA5G 4DV1L 2A6ED 3URYA 5E1FA 1N33Q 2X6GA 2F0PA 1RODA 1TS4A 1IBML 2MHVA 1A2TA 3I72A 1PZJD 2Y0SE 1SMYD 4XT3B 3FKIH 5HGQA 2EY1A 4POFA 1UNSA 2R93B 1EQTA 1S5CD 3VA5A 3BYYB 3D0FA 1LT4D 5EPKA 1L1OC 1PLFA 4X65L 2I0QA 3TSSA 4H0LC 1JMCA 5JVG3 1PTOF 3SK5A 3I55A 2CWPA 5KIXA 1XNRL 3M4OH 1O6WA 4R4CA 3ND8A 1HUNA 1RL2A 3R2IA 4E6IA 2E5LL 2B3GA 2EY5A 2F0JA 2HHHQ 2MO0A 3OMGA 3FHWA 4QL5A 3I56A 4GNXC 1FJGQ 3I3CA 2XP5A 1J9OA 4B3SL 2NZHA 3S16B 2K52A 4EQ5A 1D7QA 2HDMA 3H91A 3K5NA 1HXYD 5IGGA 1F2YA 5K36H 1HNXQ 1JE4A 2EJFC 4E5RA 4DV3Q 1IBKQ 4DR1Q 3KDFA 4DPGA 4G57A 2UUCL 1DOKA 2B2VA 4ZRZA 3D4DA 2B2UC 1DD2A 3PQHA 4B9WA 5I9PA 2CW0C 4A3KG 2Y8NB 4C3HG 1U4MA 4IOCA 2E5LQ 4A3MB 2UUAQ 3K80C 3U4VA 5U47A 4UP8A 5FLMH 2XIWA 4A3GH 1CHQD 4AIMA 2MFIA 5IYDH 1LTID 4DUZL 4GLXA 4B3TQ 2CKZB 1FJGL 2N55A 2Y0SB 3MXPA 3UE1A 4F87A 3SK6A 1SNDA 5CC4A 3QO2A 2ZQSA 1J8IA 4LK1C 2JA9A 4C2MB 2K50A 3FMCA 1Y14B 3KOJA 1EQVA 1Y8OB 2XRQD 2EZ5W 4JI2L 1TWCH 4ZKCB 2Z1CA 3PO2B 3SE0A 1EZ8A 4IUPA 1YVCA 4K6LA 1X3EA 1BCPD 1EIHA 4DUYQ 1TR5A 3A5UA 1BUVT 1NMGA 5FKAC 3PUVA 1U9RA 4FXKC 4GS3A 1NCVA 1YNNC 3WDNA 1I94Q 1SEBD 3DM3A 2QDBA 1G8ZD 3HOZB 5DLQE 2DN8A 4GNXB 1VQGA 1PH2A 3PUYA 1ASYA 1GOZA 5FK9C 1L1OA 1TWHB 1VQIA 4DK0A 4DR7L 1CZWA 2JA8B 1EL0A 1F9PA 2J4XA 3TP6A 4JI6Q 4C3IG 1SYBA 1LTSD 4CJ1B 4GOPA 3RD4A 3A0JA 3T1HQ 3LKXA 1SE2A 1I50B 3AEVA 3K0YA 4BXXH 4IOAA 1N36Q 3SVMA 4YCVA 4A3CH 3QWNA 2JA6G 2DMVA 3RN2A 1XNRQ 2JP1A 4CJ2C 4ALPA 2IX1A 3F2BA 2KCTA 2E75C 4A75A 1DOLA 2NVXB 4QY7A 4A3DH 1H9JA 1EIGA 2RF4A 2AQ3B 1H9SA 2UXDL 1EEFD 2ID0A 4LWCA 5JPMC 3P75A 5FLXL 4BBSB 4BBSG 1L0XB 2MO1A 4HIOA 4LFCL 2A68D 3FS8A 3T1YL 4LMQD 4C56C 4F8MA 2L0CA 3RLNA 4AQYL 3AB9A 2QILA 2VW9A 3KAGA 4F88A 4A3EB 5IODA 3NQTA 1ZXTA 3TP7A 3AQQA 4RFBA 2NZ1D 1CUKA 2F0DA 3MXUA 1WMVA 5GQOA 1VQHA 2AQ2B 2XP9A 1AEXA 3MXNA 4K0KQ 5J3BA 3GO5A 1Y1WH 1CKMA 3S1QB 2XN9C 4IPHA 1PH4A 2DY7A 2UXCQ 1RP5A 4X3KA 1SNMA 3IFDA 3HFZB 3F1ZA 1LACA 2PO4A 3KF6A 4IUTA 1YNND 2WAQB 3NBHA 5JEAH 1VQ8A 4QUFA 5JEAG 1O78A 2AHOB 3KADA 1K83B 3K7UC 3DWAA 4JI5Q 1IYVA 1MI2A 1SR3A 2MNAA 3TZDA 4ZKBB 3Q8DA 1VQ7A 2X69A 1GM5A 4UY8C 1ET6A 3B6YA 1CKNA 3CAMA 3EFXD 5M5XB 1G2SA 4FF1A 4DV6L 4OL7A 4HAEA 4P73A 1VQ6A 4H44C 4DAVA 5C3EG 5EKKA 1LUZA 3EIVA 4OXPA 3OOBA 3HOYH 3S9WA 3PIP3 4U85A 3DWPA 2EPBA 2UU9L 1YJWA 3R3OA 3C46A 2QEJC 4X66L 5KEEA 1SSOA 2VZAA 4XT1B 2V4DA 4KHPL 4U68A 3P7JA 5GROA 4BBSH 4NB3A 1CT1D 4X62Q 2A6HC 4OIKA 4DR2L 2KQ3A 4DV0Q 5D3DA 4K5XA 4YY3L 1HR0L 1VDZA 1CA6A 1SJED 3R93A 4CKBA 3PIO3 4LJZC 4JI1Q 4QIWE 1PFBA 1T5EA 1P8LA 2KECA 2R6GA 1XX8A 3ZYYX 1GO3E 4IPCA 4A3JG 5LL6S 4PQXA 4JBJA 4A3MG 1XPOA 4KD4A 5J39A 3PO3G 3MAQA 1U4RA 4DV4L 3I4MH 1AE2A 3MQHA 3QJYA 4NXNL 1KQSA 2EYMA 2K5DA 2M2LA 1GUTA 3NUCA 2JXMB 3TZUA 2D62A 1I3QB 1MJCA 3CF5A 2EE1A 4IFDH 1QUQA 4RMFA 1B50A 1PTOD 2NN6I 2B2WA 2L11A 4BA1I 3D6WA 4KHZA 3HKZG 3LX0A 3TEHB 3GTLB 2PZTA 2ZXOA 3KAHA 1AZPA 1I5FA 2IW3A 5IYCG 1QVCA 4PG3A 1TWFB 3TCZA 3FEWX 1RKNA 1XXGA 1TT2A 3KJOA 1BXTA 1WVLA 1STBA 3GV3A 3M4QA 1L0WA 3N52A 1KAWA 1GHKA 2G9DA 4X62L 4MIUA 1RCVD 4DR2Q 4LFBL 1I6HH 1EFID 2G9HD 3S14H 5IYDG 2FMMA 2OXPA 3E0EA 1K8AC 4A3GG 5T1IA 5FLMG 3RZOH 3BG3A 3S15B 2LFNA 3M9BA 1QVGA 2EDGA 4DR3L 2GVAA 3TREA 2B2VC 4A3KH 2SEBD 4DK6C 5COYA 4ULLA 4HN7A 3OIPA 3QG1A 2KJXA 4DR3Q 4X66Q 1KAAA 3LWEA 5CV5A 4CKEA 5DM73 3TBIB 3OYYA 1KLUD 2VNUD 4EQNA 4BA2I 4K14A 1JOQA 1G6ZA 2ZM6Q 3C2PA 2Z0SA 3MVVA 1X55A 1STGA 3OWEB 1PZKD 4A3IH 1NMFA 1LT3D 1RF2D 5D65A 3A8JE 1U5KA 1SXTA 1TKWB 5C44H 1HPCA 1EY0A 4YHHQ 4R9WA 1HA6A 4IUQA 4OIJA 4NXML 5IOCA 1FVIA 4DR5Q 1RDPD 1HNXL 4KJNA 1F2MA 3BU2A 4H7BA 1V8QA 2ZXRA 3IAYA 2K5VA 5M5YB 2A8VA 4AH6A 3K5MA 3TDBA 1PV4A 2MPMA 4DU9A 3DWQA 4A3FB 1B70B 1EUJA 1J5EQ 3IL8A 3C1FA 5A2QL 1ONLA 3H09A 2YYZA 5AFWA 2XP8A 1IKMA 2BE5D 5JPNC 3UDXA 1JMQA 1PRTF 4K5WA 2CFMA 1B8AA 1KDBA 5C5MA 3FSBA 3I8ZA 5A2QE 3HKZB 3H94A 3FKIG 3TMEA 2K33A 4GKJQ 3S1MB 4LUZA 1GVPA 2ZJRA 2WAQG 4IPGA 2F0NA 2PW7A 3J80E 1A63A 5FO8B 4L5TA 1YEZA 5EBDA 2WB1G 1K9RA 3MC0B 2VQEL 3T1YQ 2JA5H 2EYHA 1R9TB 2EYJA 3NPPA<