2BA1A

Archaeal exosome core
Total Genus 36
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
36
sequence length
179
structure length
179
Chain Sequence
b'MRFVMPGDRIGSAEEYVKGEGVYEEGGELFAAVAGKLIIKDRVAKVESISPIPEIVKGDVVLGRVVDLRNSIALIEVSSKKGENRGPSNRGIGILHVSNVDEGYVKEISEAVGYLDILKARVIGDNLRLSTKEEEMGVLRALCSNCKTEMVREGDILKCPECGRVEKRKISTDYGKGEW'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Archaeal exosome RNA binding protein CSL4
publication title Structural framework for the mechanism of archaeal exosomes in RNA processing.
pubmed doi rcsb
source organism Archaeoglobus fulgidus
molecule tags Rna binding protein
total genus 36
structure length 179
sequence length 179
chains with identical sequence B, C
ec nomenclature
pdb deposition date 2005-10-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF10447 EXOSC1 Exosome component EXOSC1/CSL4
A PF14382 ECR1_N Exosome complex exonuclease RRP4 N-terminal region
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.20.70.10 Mainly Beta Single Sheet Ubiquitin Ligase Nedd4; Chain: W; Ubiquitin Ligase Nedd4; Chain: W; 2ba1A03
2.40.50.100 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 2ba1A01
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 2ba1A02
1RL2A 1SROA 4NXNL 2XP8A 5KNDA 1V9PA 4KKUA 5JEAG 4DK0A 2JMFA 1ASYA 1Q12A 1GJXA 3S14H 2BH8A 4NXNQ 3AEVA 3U9SA 3PF5A 3RLFA 1X54A 3HKZE 3M9BA 1PH2A 2K75A 1MJCA 1ONLA 4P74A 4IJLA 1HQMC 4P71A 1Z47A 4R4QA 4YY3L 2AMCB 5FJ8H 4JK1C 3HOWH 2ZR4A 3CCEA 2Q2TA 4GOPC 3PGZA 1NJIC 1PINA 4YY3Q 3JAMc 1E2WA 2JA6G 1LUZA 1X65A 4DV5L 2M8IA 2PI2A 3FKIH 3ULLA 4DPGA 3W1GA 2PNRC 1WI5A 2PQAB 3CPWA 1EQQA 2K33A 3BG3A 5DLQE 4DV5Q 4JV5L 2OTJA 5IYBG 1VF5C 3G4SA 3J7ZC 4A3EG 4X6AH 1MJEA 1L1OA 3HOYG 1E2VA 1PH7A 4JV5Q 2I0QA 2KCMA 2ZJRA 3RZOH 3DXJC 3B6YA 3CMEA 1JE5A 3VR4A 2QGQA 4IPHA 4B3ML 2MDIA 1UE6A 2JK8A 4KLKA 1JJ2A 1B70B 2K52A 1GO3E 3AFPA 3I2ZA 1D8LA 1X56A 2JX8A 3GTPH 2KENA 4IOAA 4X65L 3NTPA 1VQ5A 4KKSA 3S17H 1CSQA 4YCUA 1HH2P 4B3MQ 2PI2E 1QVGA 1YIJA 4JG2A 1A8VA 5K36H 4AQYQ 3E9IA 5BN4A 1SMXA 4X65Q 3CQZH 1TWGH 4DV2L 1HR0L 2KHJA 2B8GA 4JI5L 2K7VA 1YW5A 3OPOA 4DV2Q 2YTXA 1A0IA 4E5RA 3HOZH 1HR0Q 3ULPA 1Q86C 5BN5A 2CKZB 4FDBA 2E76C 3K0XA 4DR2L 1EIYB 4JI5Q 3I4OA 1VDZA 2JXWA 2L5TA 3FP9A 2A69C 1JB7A 1CKMA 4C3JH 5C3EG 1V1QA 4U86A 1EWHA 3PSIA 3I73A 3I4MH 4DNIA 1QZHA 4H02A 1VQFA 4DR2Q 1EIFA 1EG4A 4BXXH 1H9SA 2N78A 3T1YL 3H0GH 1NBWA 5JJLA 3A8KE 3CPFA 3KDFA 1GD7A 2E74C 2VS1A 2JA8G 3L7ZC 4YHHL 4AYBG 2L4JA 4L5SA 3QJYA 3QIAA 3T1YQ 4LUVA 2D5DA 3EBEA 5CQ2A 1ZKOA 4JBKA 1OXSC 1N36Q 1WJJA 1T9HA 2DGYA 1BKBA 1PH6A 1VS0A 4YHHQ 1TU2B 3AYHB 2JQOA 5M3FG 1HZCA 4DV3Q 4IFDG 2K5VA 1K8AC 5JEAH 2ALYB 1XPUA 5GAEC 1AE3A 4A3GG 1HJPA 4A3KH 2YTVA 3SGIA 2ZR6A 3U58A 5IYDG 5IY0A 1JJGA 2NN6G 2N49A 3PIPA 1TWHH 2YV5A 1E3PA 1DXMA 3LGJA 3IKJA 1E24A 2E75C 4LFAL 3M4PA 4KHPQ 4A3MG 1VQHA 4DUYL 2V1CC 3HKSA 4JOIC 1HZBA 1H9MA 1Y14B 1VQNA 3J7A5 4LFAQ 4P72A 2ZQVA 2NVYH 3D4RA 4JI2L 4A75A 1HR0W 4LUOA 4DUYQ 2UU9L 2VUMH 3RLNA 1Y1VG 4L5RC 3STBD 3BZCA 4O2DA 2OQKA 1KAWA 2ATWA 2JA6H 1H9JA 3NBHB 1FJGL 2RE3A 4R4TA 1UE7A 5IWAL 2UU9Q 3SE0A 2JJQA 2YSFA 3F2DA 1E1TA 1TK7A 4PMWA 1VQAA 4QIBA 1Q82C 3JAMi 4AIMA 1FJGQ 4GKKL 4YCVA 5IWAQ 3TS2A 1VQIA 3Q8DA 1PHJA 3A5UA 1VCIA 4A3EH 2ES2A 2MFIA 3UDFA 3KAGA 2WAQG 3HOYH 4GKKQ 4DR7L 2Q5AA 1YJWA 3T51B 1XMQL 2JV4A 4OGQC 4DK6C 4JI6L 4WJ3M 3GQBA 3OOCA 2CWAA 2HT1A 4DR7Q 1XMQQ 3D31A 3W3AA 3QG1A 2XP3A 2ZTDA 2EDGA 1OTCA 2L15A 3A0JA 2NZHA 1W3SA 1KIXA 4H44C 3G6EA 4GN4B 3W5OA 3I4NG 3KADA 3PUXA 3E0EA 1GUGA 2DNCA 2KCTA 1PH3A 2YSIA 3H3VH 1YITA 3KF6A 2AUJD 3S1NH 1LACA 4BA2I 3TDBA 1VQ9A 4HR7B 3F2BA 1K8MA 1CKNA 1P8LA 1N8RC 1PVOA 2M3OW 4JI0L 2O5JC 5ELNA 5C3EH 4LUZA 4LFCQ 1YHAA 1U0LA 1IW7C 3L0OA 3FPPA 1SN8A 4HIDA 1VQEA 2K50A 1B7YB 2EZ5W 2OWOA 1OXTA 4YWKA 2VQEL 4JI0Q 4IPCA 3VDYA 2CCZA 2E2JH 2AWNA 4WJ4A 1IYVA 2JA5G 4DV6L 1UWVA 2R93H 2DNEA 4H0LC 2JA8H 1X6OA 3L2PA 2UUAQ 1IZ6A 3PO2G 4KN7C 4A93G 3WWVA 2JA7G 3FHWA 4RMFA 4DV6Q 3N6RA 1O78A 3NELA 1GUNA 1P16A 2CFMA 5M3FH 4DV4L 3JC66 3UE1A 1K9MC 4IFDH 4A3BG 4POFA 1I94L 2YTYA 4A3GH 3AFQA 1IBKL 2E2HH 1QUQB 4GNXC 4DV4Q 3BJUA 5IYDH 2F52A 1IYUA 2NN6H 1I94Q 4AYBE 1OXUA 4I7ZC 3M4YA 2Z6KC 4RG1A 1IBKQ 2RCNA 4TQUS 3KCEA 2UXDL 4A3MH 4P73A 1UE1A 4DK1A 3TREA 4JYAL 2I5LX 2E5LL 4GLAC 4GOPA 4GZYC 2QEXA 3ULJA 3DLLA 4A3LG 3KLRA 2UXDQ 3UE0A 1Q8KA 1LM0A 1CFMA 4JYAQ 2E5LQ 1PH5A 2XTIA 3K80C 1DCZA 4LF9L 2IX1A 1G291 5C0XJ 4DKAC 1SRUA 3MXUA 1PV4A 1PH8A 4XTCS 1YVCA 5GQOA 2A6HC 3I55A 5M3MH 1CTMA 2DN8A 2AUKA 2RHQB 1BBWA 2K5HA 2ZM6L 2NVTH 1NMVA 1Y1WG 2CQOA 1Z6HA 3GTLH 4JI1L 2DMVA 4A3IG 2BA0A 1VQGA 5IP9G 1PA6A 1N9WA 3A8JE 2ZM6Q 3GTOH 3WH0A 3PO3G 4JI1Q 2K14A 2PMZE 3CCSA 3ERSX 1I6VC 4GLVB 3BDOA 2AKWB 2DUDA 5JJIA 3ICEA 4MZ9A 3GTMH 4A3DG 4QY7A 4GLXA 1OXVA 1QVCA 2ASBA 4PZ7A 4XIGS 2D0OA 2RHSB 3M4OH 1MKHA 3G71A 3DM3A 3OYYA 1YHQA 1IBLL 3RNUA 1K9RA 5M5XH 4HJ9A 1NMGA 1K0RA 1VQJA 2WAQE 3I4NH 1G51A 4NB3A 2A8VA 5GAHC 2ZR5A 3EQLC 3D0FA 1B8AA 3OW2A 3I72A 1L2FA 4HJ8A 4PZ6A 1PYSB 4DAYB 1K8OA 5GAGC 2YYZA 4JBMA 5KNCA 3FMCA 1Q1BA 1D7QA 2PQAA 4GN5A 1S3OA 3BU2A 1TWCH 1Y69U 1N33L 1N32L 3A74A 4RCNA 2R7FA 5IP7G 4A4IA 1FGUA 1R9TH 1Q1EA 4BBRG 4A3CH 1N33Q 2HIVA 2OTLA 1N32Q 4POGA 2LAJA 2A69D 2ZT9C 1F8AB 4LJZC 3RZDH 2A19A 1QVFA 1KRTA 1L0WA 2EJGC 2JA5H 3CMAA 3S1QH 4OO1I 1GUTA 4NPSA 3S1RH 1V8QA 3PO2H 4A93H 3NE5B 1JJCB 1I5FA 3NEMA 2JA7H 1EQRA 4IJHA 3HGBA 1X9NA 1DD2A 1VQ7A 4OO1G 2ZQSA 4A3BH 1K9QA 1PYBA 2KXQA 3CC7A 3S24A 2AHOB 4OXPA 2WP8J 1OXXK 4BBSG 4C3IH 1CSPA 2DK1A 4LF7L 4YWMA 3IRBA 1JT8A 1GVPA 3KAHA 4JOIA 2BE5C 3T53B 3CCMA 3KYHC 5FLXc 4LF7Q 4DV7L 3CCLA 4U84A 2OQ0A 3H94A 4HJAA 3GD7A 4EX5A 1Q7YC 2YSHA 4A3LH 4DV7Q 4DR3L 1I5HW 1HNXL 3KAFA 4X62L 4BY1G 4PZ8A 3VR5A 3A7LA 3PV0A 1I50H 2F1MA 4UP9A 3CW2C 1HNXQ 1Y8OB 4IPGA 3CD6A 2D2CC 4X62Q 1VQ8A 3CF5A 1U5KA 2JEAI 2ZTCA 3W1BA 2Q8IB 3CCJA 1KD1C 1VF7A 1TWFH 1Y1WH 2H5XA 4HJ5A 2B8FA 4A3IH 4JI2Q 3KFUA 3T56B 1BBUA 2XP4A 1IL2A 1WYDA 3G48A 2JE6I 2ID0A 2XPBA 4C3HH 2VY3A 4IPDA 3PO3H 5AJ3L 1ASZA 4C2MH 4A3DH 2I5HA 1GUOA 1YJNA 1BDOA 5IYBH 3K81C 1EG3A 3HOWG 1M1KC 1FVIA 3J80c 2HIXA 1VQPA 3E9HA 1GKHA 1LTLA 2PNHA 4L8JA 1BVSA 2LSSA 5FLMG 2UUCL 2Q2UA 4QGUA 2MO1A 3TS0A 2BDOA 3S15H 3H15A 5A35A 2UUCQ 3J81i 4GS3A 1A62A 4JI6Q 2JXMB 4JC0A 4GKJL 5AHTA 1TKWB 1JMCA 2EJFC 4GNXB 3RR5A 2WB1G 5LMUL 1N34L 1IXRA 1KQSA 5IP7H 5JEAJ 4YWLA 2IHEA 4GKJQ 1WMVA 2VNUD 4X64L 2XPAA 5LMUQ 5IT9c 3MXNB 1I3QH 2LXKA 3KLWA 1C7YA 2PCFB 3NENA 5IE8A 3F8TA 3I56A 4HJ7A 4LF4L 1IW7D 4X64Q 3HOVG 5M5WH 3AB9A 1Z9FA 2ZJPA 5GROA 1NTGA 1HZ9A 4LF4Q 4H13C 2NZOA 2UXCL 1J5EL 3VR6A 1HNZL 3TZUA 2PPBC 4OO1H 2XP7A 4IQZA 3J81j 5GADC 1JMQA 4LF5L 4A3FG 2VQEQ 4KN4C 1X3FA 2UXCQ 4U85A 1J5EQ 4BBSH 4R4IA 3BZKA 3HFZB 3CCVA 1HNZQ 2BA1A 2Z6KA 1FR3A 5C44G 3S2DH 4UY8C 4G7HC 4LF5Q 3A5ZB 2JA9A 1EUJA 1UEBA 3PUZA 2XP9A 1YNNC 4REXA 2HHHL 2LMCB 4LWCA 1V43A 3ODKA 2CWPA 3OW7A 2VL6A 1FYCA 1YZ6A 2A68C 4BA1I 1VQLA 2R6GA 4P75A 3CXCA 1H9RA 4ME3A 4PG3A 2HHHQ 3PF4A 1I6HH 2DJYA 4OWXB 4BY1H 1S40A 4IO9A 5HGQA 3A8IE 3GTGH 4DR4L 4YCWA 3GTJH 2EIFA 1QZGA 3S1MH 2ZAJA 3GTQH 3SDZA 2DWVA 4JCVE 4R4CA 1K8GA 4LF6L 1KL9A 4G7OC 1Y1VH 4DR4Q 2A6HD 2WFWA 5HY6A 4A3KG 2K32A 4KI0A 2F4VL 1A6XA 4LF6Q 2A6ED 4HIKA 4A76A 4TVAB 5LMNL 4LF9Q 2B63G 2ZQUA 1VQBA 1L1OB 3CAMA 1XNRL 1QUQA 2A6EC 1O6WA 4GN3B 2IHFA 2F4VQ 5IYCG 2LXJA 5C4JH 2E45A 2BH2A 3U4VA 5LMNQ 2Y0SG 2R92G 2EVBA 3KJPA 1NE3A 1XNRQ 2VUMG 4JI7L 1A63A 2HQLA 3CC4A 5FLMH 2O5IC 4BY7G 1CI3M 3LWUA 1GHKA 3J80i 1Y8PB 5BR8L 3CNGA 4JI7Q 4JI8L 2NVQH 4R1JA 2ZQTA 1AE2A 5BR8Q 3J81c 4DUZL 3WDNA 1X3EA 4JI8Q 4IFDJ 1HCZA 2Q2HA 3PCOB 2K5NA 1WCMG 2IX0A 1GUSA 1IBLQ 2R7ZG 4DUZQ 3TQYA 3S16H 1PFSA 4DR6L 2RF4A 4Y52H 2Q2IA 1Q81C 3PIOA 3CRKC 2B3GA 3MFYA 1XNQL 5C0XI 4AQYL 1IYJB 3LE4A 4DR6Q 3L4HA 2YU9H 3CCQA 1K3RA 1H9SB 3HOVH 3H3VI 3MEFA 3KDFB 5E7NA 2WB1E 1XNQQ 3TEHB 1FL0A 1L1OC 3VA7A 4HIMA 4MTNA 1EFWA 4EQ5A 2UXBL 5C0XG 1O7LA 3K8AA 1YNXA 2ZTEA 1XPRA 3CCRA 4UPAA 2ITKA 1NY4A 1E7ZA 2YSBA 5EAYA 5LMNW 2N3SA 4L5QA 4A3FH 1X3GA 3F1ZA 1YEZA 2UXBQ 1CUKA 4A3JG 1SLJA 1TWAH 5C44H 1YHBA 4DNTB 3S2HH 3KOJA 2ZJQA 4HIOA 4DR5L 2EJMA 2V4DA 4DV1L 3OOBA 2C35B 1VQ6A 1ZCNA 1IBML 3HOUG 2AWOA 1HTPA 3RN5A 2KA7A 1VQDA 3UDIA 3F2CA 4JI4L 4OX9L 1SE8A 2VZAA 2I5MX 4DR5Q 3M3YH 4QL5A 1WOCA 4DV1Q 4O0AA 2EQSA 3ND9A 2BE5D 1UE5A 1IBMQ 2R93G 1N36L 2VW9A 4APVA 4IFDI 1J6QA 1XPOA 1RIPA 4JI4Q 4OX9Q 4J15A 3UDXA 4DV3L 5J3BA 2R7DA 4OWWB 1EYGA 1Y8NB 1Q46A 1YJ9A 2NN6I 1VQOA 3CRLC 1EWIA 4OONA 3HOXG 3KAIA 2GN5A 1SFOH 4KMUC 1LABA 4KHZA 3ER0A 3CCUA 1B9MA 3HKZG 1GHJA 1K83H 1Z7TA 2DK7A 2D62A 3GO5A 2F21A 2D0PA 1S72A 5C4XG 3K7UC 4KHPL 1M90C 1PH4A 3ND8A 4PV1C 2N8NA 4KKTA 4DR3Q 2KHIA 3RLOA 4JI3L 2B63H 3M7NA 1XTDA 3TRZA 3EN2A 4B3RL 2JEBI 4G7ZC 5H1SE 2CW0C 4DV0L 5IYCH 3AQQA 1C0AA 5IP9H 4ALPA 4JI3Q 3UDGA 2R92H 4JBWA 2MQHA 4B3RQ 4DV0Q 5BN3A 2GVAA 1ZYRC 1E1OA 4K0KL 4BY7H 1YI2A 1LYLA 2K4KA 2NVXH 3KF8B 5FJ8G 3STBC 1GM5A 5AJ3Q 1H95A 5M3MG 2IT1A 1DGSA 3I4LA 1SMYC 4K0KQ 1C9OA 3TCZA 2QA4A 4R4OA 3U4ZA 2XP5A 2YSGA 1YNJC 3PUYA 2Y0SE 4NXML 1QJOA 3KF6B 3GTKH 3FKIG 3I7FA 1WCMH 3CP0A 2R7ZH 1XMOL 1PMRA 1CKNB 3M4QA 1X55A 1XJVA 4NXMQ 1VQCA 1E22A 1O7IA 3K7AH 1HPCA 4LNQA 4DNRB 3P20A 3EIVA 2FXQA 1TXYA 1XMOQ 4IOCA 2XP6A 4UP7A 1K73C 2MO0A 4BBRH 1W2BA 2F3IA 4LFBL 2XGTA 3KJOA 2EXDA 4QIWE 1N34Q 4DAMA 1AH9A 1NMFA 4X66L 5C0XH 3OTOL 4LFBQ 3IFTA 1VQ4A 4LW1A 3U50C 1CKOA 1KXLA 4LFCL 2M8JA 1SR3A 2Z0SA 5KNBA 1KRSA 4B3TL 4X66Q 5K36G 2E8GA 2KCCA 3OTOQ 4A3JH 4LF8L 2GVBA 3VR2A 3ZJYC 3VR3A 3KABA 1KHIA 2VQFL 4AH6A 4QQBX 4LK1C 2E2IH 2UUBL 4B3TQ 1HNWL 3HOUH 4TKOB 4GNXA 4LF8Q 4A3CG 2QF7A 4JBJA 5JJKA 3PUVA 1YBYA 4DR1L 2UUAL 2KBNA 4L5TA 2VQFQ 3HOZG 2A1AA 2B29A 1VQKA 4B3SL 2UUBQ 5ELOA 1HNWQ 4Y7NH 4GOPB 1KC8C 3TC5A 1Q90A 4QJFA 1VQMA 4DR1Q 1E2ZA 2IY5B 1PH9A 4B3SQ 3I4MG 2A68D 4OWTB 4MNOA 1G6PA 3RN2A 3T1HL 4BXXG 2MNAA 1B9NA 3M85A 3HOXH 3H0GG 5M5YH 1H9KA 3CC2A 1WR7A 3LNNA 1HZAA 1MIUA 1PH1A 4UP8A 3T1HQ 3PUWA 5C4XH 1T5EA 1EOVA 1WFQA 3GDEA 3A7AB 2OCEA 4DK3C
chains in the Genus database with same CATH superfamily
4RFBA 2LKVA 1RL2A 1SROA 4NXNL 2XP8A 1V9PA 5KNDA 3SR1A 1F77A 4KKUA 3SEBA 2RQXA 5JEAG 3BVGA 1JWMD 1D5XC 4DK0A 2JMFA 1EY7A 1ASYA 1Q12A 3S14H 1GJXA 5D65A 2BH8A 3M4OB 1GOZA 4JW0A 4RH6A 1BOSA 4A0TA 4NXNQ 3AEVA 3U9SA 3DWPA 3PF5A 5M5XB 3RLFA 1X54A 2WV6D 3HKZE 3M9BA 1PH2A 2NTTA 2K75A 1MJCA 5EPJA 3QR8A 1ONLA 1KABA 1I4HA 3PIP3 3I4NB 4P74A 1F9RA 4IJLA 3K5MA 1HQMC 4P71A 1K3BC 1Z47A 4NP5A 4R4QA 3MVVA 3D6WA 4YY3L 2AMCB 5FJ8H 3E3XA 4JK1C 3HOWH 4ODGA 2ZR4A 4F8MA 1S5ED 3CCEA 2Q2TA 2F0NA 4GOPC 4LAAA 3PGZA 1TWCB 1NJIC 1FNWA 1I4QA 1PINA 4K8JA 4YY3Q 1RODA 5CV9A 4IUUA 4J1MA 2F4IA 1R9TB 1AW7A 3JAMc 2F0MA 1E2WA 5EPLA 2JA6G 4DGZA 1LUZA 2RSOA 1X65A 4DV5L 2M8IA 2PI2A 3FKIH 3ULLA 3Q6SA 4DPGA 3W1GA 2PNRC 1WI5A 2PQAB 2X6GA 3CPWA 3TP7A 1EOTA 2CHBD 1EQQA 1EY4A 2K33A 4X3TA 3BG3A 1B50A 2BDNA 3RZDB 2K04A 5DLQE 1TIID 1A2UA 5G3LF 2JA5B 2DY8A 4DV5Q 3S1QB 4JV5L 3G7LA 2RCFA 2OTJA 3GP7A 5IYBG 3S1RB 1VF5C 3G4SA 3PO2B 4A93B 3J7ZC 4A3EG 4X6AH 1AFPA 4WFN3 1MJEA 1L1OA 1LO5D 2JA7B 3HOYG 4HMJA 1RTNA 1E2VA 2L0CA 3OIQA 3C3LA 1PH7A 1E0BA 3BS1A 4JV5Q 2I0QA 2HDMA 2K1BA 1UUPA 2K05A 2KCMA 2ZJRA 1X3QA 3RZOH 5FLXE 3B6YA 3DXJC 3CMEA 1JE5A 3OHXC 1JCKB 3KBXA 2QGQA 4IPHA 3VR4A 4B3ML 2MDIA 1UE6A 2JK8A 4KLKA 1JJ2A 1S5DD 1RCVD 1B70B 4A3BB 5KGUA 2H4OA 2PW5A 2K52A 1HA5A 1GO3E 5CC4A 3AFPA 1UEAB 3I2ZA 4N9PA 4EQPA 1D8LA 1X56A 2JX8A 5JOBA 3GTPH 1HA6A 2KENA 1NCVA 4C3IB 4IOAA 1EZ8A 3EA6A 4X65L 1TVXA 2F0HA 3NTPA 1VQ5A 4KKSA 3S17H 1C48A 1CSQA 3L9AX 4YCUA 5DM73 1HH2P 4B3MQ 2PI2E 1QVGA 1FNVA 1YIJA 1G91A 2FINB 4JG2A 1A8VA 5K36H 1PZJD 4AQYQ 3E9IA 5BN4A 1SMXA 5DNFA 3HS0C 4X65Q 3CQZH 1TWGH 4DV2L 1KDBA 1HR0L 3EVQA 3NBIA 1IKLA 2KHJA 1RP5A 3OSOA 2B8GA 2PZWA 4JI5L 2K7VA 1YW5A 1QE6A 1M8AA 3OPOA 4DV2Q 2YTXA 3VA5A 1JOQA 1A0IA 4E5RA 3HOZH 1EWCA 5A2QL 1HR0Q 4DF7A 3ULPA 1Q86C 5BN5A 2CKZB 4FDBA 1STYA 2E76C 3K0XA 4O42A 1TY0A 5F2DA 4DR2L 1EIYB 4JI5Q 4KY5A 2EY1A 2Z4HA 3I4OA 4PQXA 1VDZA 3OWEB 2JXWA 2L5TA 3FP9A 2A69C 1I50B 5CORA 5E66A 4TRDA 5I4DA 1JB7A 5CV5A 1CKMA 2F0EA 4C3JH 1V1QA 2PZTA 4U86A 5E1FA 5C3EG 3WOEA 2N55A 1EWHA 3PSIA 3I73A 2LS01 3I4MH 3TBIB 4DNIA 1QZHA 4H02A 1B2TA 1VQFA 1QNKA 4DR2Q 1EIFA 1EG4A 1UNSA 2B2WA 4BXXH 1TWFB 3DEPA 5E3FA 1H9SA 1NUCA 2N78A 1Y1WB 3T1YL 3H0GH 1NBWA 5JJLA 4A3IB 3A8KE 3CPFA 3KDFA 3K5LA 1GD7A 2E74C 2VS1A 2JA8G 3L7ZC 1ENFA 4YHHL 5LL6S 4AYBG 3E0JA 4K14A 5NUCA 2L4JA 4L5SA 2XN9C 3MFGA 3QJYA 4CDFC 4C3HB 3QIAA 1HFNA 3T1YQ 4LUVA 3TDQA 2D5DA 3EBEA 3PO3B 5CQ2A 1ZKOA 4JBKA 5JVH3 2MP1A 1PTOC 1OXSC 4CKCA 1N36Q 1WJJA 1T9HA 2DGYA 3NP8A 1BKBA 4K5WA 1D6EC 1PH6A 4C2MB 1VS0A 4YHHQ 1TU2B 4A3DB 3AYHB 2JQOA 5M3FG 2BOSA 2EYHA 1HZCA 4DV3Q 3O13A 1EY6A 4IFDG 2K5VA 1K8AC 1K0SA 3D4WA 5FO8B 5JEAH 1J9OA 2ALYB 4NDXA 1XPUA 5GAEC 5IGFA 1AE3A 1J8IA 4A3GG 1LT6D 1HJPA 4A3KH 3V2TA 4U68A 2YTVA 3SGIA 2ZR6A 2L9HA 5FOBB 2F03A 3U58A 5IYDG 2KECA 5IY0A 1JJGA 2NN6G 1EYAA 2N49A 4RCOA 3PIPA 1TWHH 4HSVA 2YV5A 4KTAA 1E3PA 1BO0A 1AZPA 5D3DA 2B2UC 1DXMA 4BS9A 2CW0D 2F3VA 3LGJA 3IKJA 1E24A 2E75C 4LFAL 3M4PA 4KHPQ 2MJ8A 3S15B 1CZGA 4A3MG 1VQHA 4DUYL 5IT9E 4OIJA 2V1CC 2C9OA 3HKSA 4JOIC 1HZBA 1H9MA 1Y14B 1VQNA 1WD0A 3J7A5 1ZYRD 1A3TA 4QCLA 4LFAQ 4P72A 1STHA 2ZQVA 2NVYH 3D4RA 4A0UA 3LKXA 4RHRA 4JI2L 4A75A 1HR0W 1EFID 4LUOA 4DUYQ 2UU9L 2VUMH 3RLNA 2SNSA 1RJTA 1Y1VG 4L5RC 4QUCA 3STBD 1JWSD 3BZCA 2QEJC 2OQKA 4O2DA 1KAWA 2ATWA 2EXZA 1CHQD 2JA6H 1H9JA 3I8ZA 1STAA 3NBHB 4QUFA 2RE3A 1FJGL 1TR8A 4R4TA 1UE7A 5IWAL 1JR0D 2RKSA 2UU9Q 3SE0A 2JJQA 2YSFA 3F2DA 4V0BA 1V1PB 1E1TA 2RDHA 2F0VA 5JAVA 1I3QB 1TK7A 4PMWA 1U4MA 1VQAA 4QIBA 1Q82C 5JPNC 5U47A 3JAMi 4OL7A 4Q0FA 4AIMA 4B9XA 1FJGQ 4GKKL 1AN8A 4YCVA 5IWAQ 4EVOA 3TS2A 1VQIA 3Q8DA 1WTRA 1PHJA 5M5WB 3A5UA 5KRUA 1VCIA 3ERQA 4A3EH 2ES2A 5IOCA 1XWEA 2F0FA 2MFIA 3UDFA 3KAGA 2WAQG 3HOYH 4GKKQ 4DR7L 2Q5AA 2A5HA 4RHSA 1YJWA 3T51B 5DAUA 1XMQL 2JV4A 1IKMA 3H09A 4OGQC 4DK6C 4JI6L 4WJ3M 3GQBA 1M4VA 2EY2A 3OOCA 1I4RA 2CWAA 1LTRD 2HT1A 4DR7Q 4ZAIA 1VMCA 1NNXA 1LTAD 1XMQQ 3A54A 4BBSB 3D31A 3W3AA 3QG1A 4XT1B 1BCPB 1II3A 1B44D 2XP3A 2ZTDA 3S2DB 2EDGA 5E62A 4C1NK 3MQHA 1SYBA 3KF8A 1OTCA 2L15A 3A0JA 1A15A 2NZHA 1W3SA 3VYTA 3NSWA 1KIXA 4H44C 2HDLA 4ID6A 3G6EA 2RBMA 4GN4B 3W5OA 3I4NG 5KIXA 3KADA 3BYTB 3E0EA 3PUXA 2WAEA 1GUGA 1WTVA 3T4AC 2DNCA 2KCTA 1PRTB 1TT2A 3D3RA 1PH3A 2YSIA 5M9OA 2X69A 3H3VH 1YITA 3KF6A 2AUJD 3S1NH 3V96A 4RGNA 4DAVA 1LACA 4BA2I 2VB3X 3TDBA 4CDCC 4DXFA 4HR7B 1VQ9A 1I6HB 4OELB 4BY1B 3F2BA 1CKNA 1K8MA 3NUCA 1P8LA 1N8RC 1PVOA 1W6JA 2FJ2A 3NTIA 2M3OW 4JI0L 2O5JC 5ELNA 5C3EH 4LUZA 4LFCQ 2L55A 3GTGB 1YHAA 1U0LA 3CHBD 3GTJB 1IW7C 5JPMC 2J0TD 3FPPA 3L0OA 1KAAA 1SN8A 1VQEA 2K50A 4HIDA 1B7YB 1C4QA 3S1MB 2EZ5W 2OWOA 1STGA 1OXTA 2XWBB 4YWKA 1F9SA 2VQEL 3GTQB 4FP5D 1S5BD 1CT1D 4JI0Q 4IPCA 1XTCD 1Y1VB 3VDYA 3HZXA 2CCZA 2E2JH 2AWNA 4WJ4A 1IYVA 1CK1A 5E64A 2JA5G 1EYDA 4DV6L 2SNMA 1EEFD 2PMZB 1UWVA 2R93H 1FGBD 2DNEA 1TS5A 3L3OC 4H0LC 4K6DA 4JVZA 5IODA 1LTTD 5J39A 1DYQA 2JA8H 1X6OA 3L2PA 2UUAQ 1IZ6A 3PO2G 4KN7C 4A93G 1SE4A 2Z9HA 4P2CB 3WWVA 2JA7G 3FHWA 5FKAC 4RMFA 4DV6Q 3N6RA 1O78A 2OEOA 3NELA 1GUNA 1P16A 5L37A 2CFMA 5M3FH 1EY8A 1B53A 4K5XA 4DV4L 3JC66 3UE1A 1D5ZC 5C4JB 1K9MC 1F2YA 4IFDH 1CA6A 4A3BG 4POFA 3HRZC 1I94L 1BCPC 1F9QA 3BVZA 4MHEA 3CU7A 2YTYA 4A3GH 3AFQA 1EYCA 1IBKL 2E2HH 3CKIB 4C3IG 2KCNA 4Q5VA 1QUQB 4GNXC 4DV4Q 1I4PA 3BJUA 5IYDH 2F52A 2CQAA 3TZDA 1PRTD 1IYUA 2NN6H 4NKLA 3J81L 2H1EA 1I94Q 2NTSA 4AYBE 1OXUA 4I7ZC 1HXYD 2EOTA 1FNUA 4Z9CB 2F0KA 3M4YA 2Z6KC 4RG1A 1IBKQ 2RCNA 4TQUS 1B4OA 1PRTC 3KCEA 2UXDL 4A3MH 4P73A 1UE1A 4DK1A 2NVQB 3TREA 4JYAL 2I5LX 3Q22A 2E5LL 4GLAC 2LFNA 4GOPA 4GZYC 2QEXA 4XXEA 3ULJA 3KK7A 1QNUA 2HCIA 3DLLA 4A3LG 3KLRA 2UXDQ 3UE0A 1WVLA 1Q8KA 4WJWA 1LM0A 5COYA 1CFMA 5CYUA 4JYAQ 2WB1B 2E5LQ 1PH5A 1EEID 2XTIA 3K80C 3VYUA 1DCZA 1SNOA 4LF9L 4N8FA 2IX1A 1G291 5C0XJ 3PQHA 4KJNA 1U9RA 1TS4A 1SRUA 4DKAC 3MXUA 5ELFA 1PV4A 1PH8A 4XTCS 3FRPB 1YVCA 3GV3A 5GQOA 3S16B 2A6HC 5ELCA 3I55A 1QB5D 2DJGC 5M3MH 1CTMA 2DN8A 4ME5A 2AUKA 2RHQB 4XYOA 1BBWA 1KNEA 5EGTA 2K5HA 2ZM6L 3BDCA 3I90A 2NVTH 1NMVA 5T1IA 1Y1WG 2CQOA 1Z6HA 1STBA 3GTLH 4JI1L 2DMVA 4A3IG 2BA0A 3SHLA 2YU9B 1VQGA 5IP9G 1PA6A 2YAJB 2P5ZX 3HOVB 1ICFB 1N9WA 3AU7A 5C5MA 2XRQD 1ICWA 3A8JE 2ZM6Q 1GUWA 2LY7A 3GTOH 4C3HG 5D3IB 2EE1A 3WH0A 4HMIA 3PO3G 4JI1Q 2K14A 2PMZE 3CCSA 3ERSX 1I6VC 3R8BA 4GLVB 2AKWB 3BDOA 3AMUA 1EY9A 2RDGA 1BQQT 2DUDA 3MAQA 5C3WA 1KLUD 5JJIA 3ICEA 4MZ9A 3GTMH 1PFMA 4A3DG 4QY7A 4M1UB 4GLXA 3RMHA 1OXVA 4A3FB 1RDPD 3D8GA 1B1ZA 1QVCA 5C6AA 2L4NA 2ASBA 4PZ7A 3VYSA 4LMQD 3KLSA 4XIGS 2D0OA 2PZUA 2RHSB 4ZYSA 3M4OH 1MKHA 5DM63 2F0PA 3G71A 2O2LD 3DM3A 1WTQA 5C44B 1TWAB 4DXGA 3OYYA 3S2HB 1YHQA 1IBLL 3RNUA 2K5WA 1K9RA 5M5XH 4HJ9A 2Z4IA 2B2VC 1NMGA 1K0RA 1VQJA 4RKBA 1PTOB 2WAQE 3I70A 4MTKA 3J7YW 5KYIA 3I4NH 1G51A 4NB3A 2A8VA 5FLXL 5GAHC 2ZR5A 5E4WC 3K5OA 3EQLC 3D0FA 1GXDC 1PTOF 1B8AA 3OW2A 3I72A 3R3OA 1L2FA 4HJ8A 5C3XA 3M3YB 1HQRD 2OF1A 2E2DC 2N88A 4PZ6A 2PYKA 1PYSB 4DAYB 2Q8TA 1K8OA 5GAGC 2YYZA 2KEDA 4JBMA 5KNCA 3FMCA 2PO4A 1Q1BA 4IUTA 1D7QA 2PQAA 3FVQA 4GN5A 1S3OA 3BU2A 1TWCH 1Y69U 1N33L 5E65A 1N32L 3A74A 5CR3A 2CVRA 1D2BA 4RCNA 2R7FA 1G2TA 5IP7G 5D14A 4A4IA 1FGUA 1R9TH 3ONAB 1Q1EA 4BBRG 4RGMA 1EQVA 2QKIC 2GA4B 4R9WA 4A3CH 1RKNA 1N33Q 2HIVA 1SFOB 2OTLA 1N32Q 4POGA 2LAJA 3E5SA 2A69D 2ZT9C 1F8AB 4LJZC 2TMPA 1JC7A 3RZDH 2A19A 1QVFA 1KRTA 1L0WA 1K83B 3MXPA 2EJGC 3MC0B 3MXGA 1XYIA 2JA5H 3CMAA 5JJZA 3NXWA 1DM0B 3S1QH 4OO1I 2B2TA 2NYZD 1GUTA 4NPSA 3S1RH 1V8QA 4IZ8A 3LX0A 3PO2H 4A93H 5LL6X 3NE5B 1JJCB 1JORA 3FSCA 1I5FA 3NEMA 2JA7H 4FF3A 2B63B 4EQNA 2FFKB 2XNAC 1QWYA 2MGSA 4PMBA 1EQRA 4IJHA 1LT3D 4X3UA 1I4GA 3HGBA 1X9NA 4DAYA 1ILQA 2EYLA 1DD2A 1VQ7A 4OO1G 1KDCA 2KVMA 2ZQSA 3C46A 4A3BH 1K9QA 3NTHA 5CV4A 1PYBA 2KXQA 2WACA 2Y0SB 3CC7A 1PTOD 2D9UA 2R92B 3S24A 2AHOB 4OXPA 1TS3A 2WP8J 1OXXK 4BBSG 3IL8A 2B2UA 4C3IH 3J80L 1CSPA 2WINB 4F88A 2DK1A 2AQ1B 4LF7L 4J8QA 4YWMA 3DUZA 3IRBA 4K2KA 1ESRA 1JT8A 4BY7B 1GVPA 3BZDB 4TSSA 3KAHA 1QOHA 4JOIA 5T1GA 1L0XB 2NVXB 5EQ0A 2BE5C 3T53B 3CCMA 3KYHC 5FLXc 4LF7Q 2PW7A 4DV7L 3CCLA 4U84A 2OQ0A 1EIGA 4H7BA 4X3SA 5EKKA 1LT4D 1SBBB 3H94A 1RHPA 4HJAA 3GD7A 4EX5A 1Q7YC 5CMDA 2F0WA 1JB3A 2YSHA 4FVMA 1SJHD 2MPMA 4A3LH 1SYEA 2ICIA 2B2WC 4DV7Q 4DR3L 1I5HW 3GTKB 1HNXL 3KAFA 4X62L 4XQJA 2KHSA 4BY1G 3OMGA 1O7YA 1WCMB 4PZ8A 3VR5A 2VXWA 3A7LA 2IL8A 1I50H 3PV0A 5FK9C 2R7ZB 2F1MA 1JOKA 4RWSC 4UP9A 3I91A 1TR5A 2ENBA 1X32A 3CW2C 2FHTA 3W2DA 1Y8OB 1HNXQ 4IPGA 1NAPA 2D2CC 2WIIB 3K7AB 4X62Q 2XSCA 2M9VA 3CF5A 1VQ8A 2EYMA 2X6LA 1U5KA 5HURA 3N52A 2ZTCA 3DMUA 5IT9L 3W1BA 2JEAI 2Q8IB 3CCJA 1KD1C 2XRSD 3DHQA 1VF7A 4DA2A 5IIFA 1TWFH 1PYWD 3H91A 3ZYYX 1Y1WH 2MHVA 2H5XA 4HAEA 4HJ5A 2B8FA 5FO9B 4A3IH 2KOLA 1FLCA 4BBRB 1MD2D 4JI2Q 3KFUA 1KNAA 4B9WA 3T56B 1BBUA 1CZWA 2XP4A 1CA5A 4EQOA 1IL2A 1WYDA 3G48A 4NW2A 2JE6I 2ID0A 2XPBA 4C3HH 3GV6A 3HG9A 2K5DA 2VY3A 5IGDA 4IPDA 3PO3H 5AJ3L 2F0JA 2HD3A 4QB4A 3K59A 1ASZA 4C2MH 3I3CA 1ENAA 1PZID 4A3DH 1PFNA 4CKBA 2I5HA 3PMFA 1GUOA 3K57A 5EBDA 1YJNA 1BDOA 5IYBH 3K81C 1EG3A 3HOWG 1M1KC 1FVIA 1DONA 3KUPA 1SYCA 3FSBA 4FNFA 1S5CD 3J80c 2HIXA 2PQEA 4QF4A 1VQPA 3E9HA 1GKHA 1LTLA 2RSNA 5ELDA 2PNHA 4A3JB 5TSSA 4L8JA 4HCEA 1BVSA 1PXUA 3R2IA 2F0GA 2LSSA 5FLMG 1WTOA 2UUCL 2Q2UA 1EU4A 4QGUA 4G4KA 2QDLA 2E2IB 3OIPA 2MO1A 3D4DA 1D1IA 4X3KA 4ZUJA 3TS0A 3HOUB 2BDOA 5EBCA 2B2YC 3S15H 3MEHA 3H15A 4FF2A 5A35A 2UUCQ 3J81i 2EYFA 4GS3A 2HUGA 1A62A 2IX3A 3MWYW 3M7GA 4JI6Q 2JXMB 4JC0A 3FPUB 2DJFC 3TP6A 5KYLA 4OHJA 1NR2A 4GKJL 5AHTA 3NBHA 4Y7NB 2WKCA 1TKWB 1JMCA 2EJFC 5K5PA 4O1NA 1BCPF 1SE2A 1V1PA 2ZXRA 4GNXB 2C5CA 3RR5A 2IW3A 2WB1G 5LMUL 1N34L 2KEEA 2QW7A 1IXRA 2K03A 4XQNA 1KQSA 5IP7H 5JEAJ 1SNDA 4YWLA 4BWGB 2IHEA 4GKJQ 1SAPA 1WMVA 2VNUD 5ELBA 4X64L 3HOXB 1SYGA 5M5YB 3BDLA 2XPAA 1G6ZA 5LMUQ 5IT9c 2F0DA 5I6WA 5EKLA 4RKLA 3MXNB 1I3QH 1PRTF 4IALA 1O80A 2LXKA 3KLWA 1C7YA 2PCFB 3HKZB 5I9OA 3NENA 4N8X1 5IE8A 1WTHA 3F8TA 3PIO3 3I56A 2EPBA 4HJ7A 5EKIA 4LF4L 1IW7D 5C4XB 4X64Q 3ITPA 3HOVG 4KV6A 5M5WH 2QCPX 3K0YA 3A55A 3AB9A 1Z9FA 2SEBD 1C8CA 2KUMA 2F0UA 2K01A 2ZJPA 4UHVA 3PQIA 4ZUIA 5GROA 1NTGA 1HZ9A 4LF4Q 4H13C 1HUMA 2NZOA 2UXCL 1BXTA 3E6ZX 1J5EL 3VR6A 3KLSX 4HEDA 4ZKCB 3K58A 1HNZL 3H3VC 3TZUA 2PPBC 4OO1H 3S14B 2XP7A 4IQZA 3J81j 5GADC 1JMQA 4LF5L 4A3FG 1PLFA 2VQEQ 4KN4C 1X3FA 2UXCQ 4U85A 1HRJA 1J5EQ 4ABNA 4BBSH 3NTKA 1ENCA 3BZKA 4R4IA 2IJ0A 3HFZB 3CCVA 2Z1CA 1ILPA 2KJXA 4S3SA 1HNZQ 3JAME 2BA1A 2Z6KA 1FR3A 5C44G 3QOJA 3S2DH 3QO2A 4UY8C 4G7HC 4LF5Q 3A5ZB 2RVLA 1BCPD 2JA9A 1EUJA 4C3JG 1BBXC 3NWSA 1UEBA 3MXNA 3PUZA 2EZVA 1Q3LA 3HOWB 1B3QA 2XP9A 3Q23A 1YNNC 4REXA 2Q8RE 1DJRD 2HHHL 3EROA 4JPBW 2LMCB 4LWCA 1V43A 3ODKA 4PNYA 2CWPA 3LWEA 3OW7A 2VL6A 1FYCA 1YZ6A 2A68C 1SXTA 4UAIA 4BA1I 4M8AA 1VQLA 2EYPA 5EJWA 2NUCA 3D6CA 2R6GA 4P75A 3CXCA 1H9RA 4ME3A 4PG3A 1O7ZA 2HHHQ 3X3NA 3FKIB 3PF4A 1I6HH 1ET6A 2DJYA 4OWXB 4BY1H 1S40A 4IO9A 5FO7B 5HGQA 1T5XD 4KK7A 2AQ2B 3A8IE 1A2TA 1JICA 2OT2A 3GTGH 4DR4L 4YCWA 1IHZA 3GTJH 5CV7A 1XX8A 2EIFA 1MHWC 2EYJA 1QZGA 3S1MH 4MN3A 2ZAJA 1EQTA 1CM9A 4MIUA 3GTQH 2J4XA 1JOOA 4HCSA 3SDZA 2DWVA 4JCVE 4R4CA 1K8GA 4LF6L 1KL9A 4G7OC 5DEHA 4ZKBB 3FEWX 1RD9D 1Y1VH 4DR4Q 2K6AA 2A6HD 4I7AA 1PDQA 2WFWA 5HY6A 2F0LA 2RDFA 4A3KG 2K32A 2CH4W 2B39A 4KI0A 1SEBD 1CQVA 4XYQA 2F4VL 1A6XA 3RZOB 1NSNS 4LF6Q 2A6ED 4HIKA 1TQOA 2JSOA 3NK9A 3DEOA 4A76A 3SXHA 4TVAB 5LMNL 4LF9Q 2B63G 2ZQUA 1VQBA 1ESFA 1L1OB 2RA4A 3K5NA 3CAMA 4DFAA 1XNRL 1QUQA 2A6EC 3GTPB 1O6WA 4GN3B 2IHFA 2F4VQ 5IYCG 2F3WA 2LXJA 5C4JH 2E45A 2F0IA 3S17B 1QILA 3R2TA 1STEA 3P1HA 2BH2A 3U4VA 5LMNQ 2J7ZA 4CJ2C 3T13A 2XIWA 1CQFA 1XXGA 2Y0SG 2QRVA 1KTKA 4FXDA 1SE3A 2R92G 2EVBA 3KJPA 1U4LA 2F0TA 3P7JA 2B2VA 1NE3A 1XNRQ 2VUMG 1SSOA 4JI7L 1MI2A 1KLGD 4YIJA 1KDAA 2ZXPA 2HQLA 3CC4A 1A63A 2O4XA 3C1FA 5FLMH 3CQZB 1TWGB 3OMCA 5JVG3 2O5IC 4XDXA 1EIHA 2QDBA 4BY7G 1CI3M 2XVSA 4DN4M 2L1BA 3LWUA 1GHKA 1EU3A 3J80i 1Y8PB 5AFWA 5BR8L 3CNGA 3QWNA 1I4XA 3A56A 1K28A 4JI7Q 1S4ZA 4JI8L 2NVQH 4R1JA 2ZQTA 3HOZB 5I9PA 5CGKA 3TP8A 1AE2A 1LTID 2XWJB 5BR8Q 3J81c 4DUZL 4ZCKA 3WDNA 4C3JB 1X3EA 4JI8Q 1FD7D 3SK8A 2Z8LA 3SK4A 4IFDJ 4R8NA 3G6JB 1HCZA 2Q2HA 3PCOB 4K8IA 2K5NA 3I4MB 1WCMG 1PZKD 2IX0A 5I2XA 2G5DA 4E6IA 1GUSA 1IBLQ 2R7ZG 4DUZQ 3TQYA 3S16H 1PFSA 4DR6L 2RF4A 4Y52H 2Q2IA 3H0GB 2G9HD 5ISRA 3J7AF 1Q81C 5CBAE 3PIOA 3CRKC 3MTSA 2B3GA 3FS8A 1R4PB 3UI2A 3MFYA 1LT5D 1XNQL 4F7XA 1L0YB 5C0XI 4AQYL 1IYJB 4ZQ3A 3LE4A 4DR6Q 3L4HA 2YU9H 2A73B 3CCQA 1K3RA 1H9SB 3U9OA 3HOVH 1B3AA 4FYDA 3H3VI 3MEFA 3KDFB 5J22A 5IGCA 5E7NA 3TP5A 4KD4A 2WB1E 1XNQQ 3TEHB 1FL0A 2OXPA 1L1OC 3NQIA 2AQ3B 4XQQA 1DZ1A 4I65A 3VA7A 4HIMA 4MTNA 1EFWA 4EQ5A 3K6OA 4KHVA 2UXBL 5C0XG 1O7LA 3K8AA 1YNXA 2ZTEA 1XPRA 1ET9A 2FMMA 4UPAA 5IGEA 4IUPA 3CCRA 2ITKA 4A3KB 5A2QE 2BCOA 1MGSA 3BVMA 1NY4A 1E7ZA 2YSBA 3FDTA 5EAYA 5EPKA 2N3SA 5LMNW 4L5QA 4A3FH 4KD3A 5KEEA 1X3GA 1JWUD 3F1ZA 1YEZA 2HCCA 4IURA 1TWHB 4NMZA 1HTLD 2UXBQ 4PMCA 2F0SA 5G3LD 2MUYA 1CUKA 4A3JG 1SLJA 1TWAH 4K2LA 5C44H 1YHBA 3VYRA 4DNTB 4RGOS 3S2HH 4L63B 4HTHA 2WKDA 3KOJA 2ZJQA 1WTWA 4HIOA 4DR5L 4CBVA 2EJMA 4L6TB 2V4DA 2JP1A 4DV1L 3OOBA 2C35B 1VQ6A 4HN7A 1PTOH 3V05A 1ZCNA 1IBML 3HOUG 1TS2A 4HSPA 1JQYD 2AWOA 1HTPA 1LV9A 3RN5A 4CJ0B 2KA7A 1VQDA 2EYOA 3UDIA 3QOLA 2NVYB 3F2CA 4JI4L 4OX9L 1SE8A 2VZAA 1WTPA 2I5MX 4DR5Q 4RAUC 2VUMB 2HQEA 3M3YH 4QL5A 1WOCA 4DV1Q 4O0AA 2EQSA 3ND9A 4FF4A 2BE5D 3NHHA 1UE5A 1IBMQ 1MSGA 2R93G 3J80E 1QCBD 1N36L 4CJ1B 2VW9A 4APVA 4IFDI 1J6QA 2WADA 1XPOA 3CD6A 1LLRD 2JA6B 1RIPA 4JI4Q 4OX9Q 1AZQA 1D1KA 2R3ZA 4J15A 3SVMA 4OIKA 4G57A 3LKXB 1A3UA 3UDXA 4DV3L 3J7AV 1HUNA 1X3PA 5J3BA 2R7DA 2B2TC 3P75A 4ZK9B 2I07B 4OWWB 1EYGA 1JE4A 1IL8A 1Y8NB 1Q46A 1D5MC 1YJ9A 2NN6I 1VQOA 3CRLC 1TY2A 1EWIA 4OONA 3HOXG 3TSSA 3KAIA 1F2ZA 2GN5A 1SNQA 4IUVA 1SFOH 3R93A 4KMUC 1LABA 5J1ZA 4XT3B 4KHZA 2I46A 3ER0A 3CCUA 4EGVA 1B9MA 3HKZG 1GHJA 3IAYA 1K83H 4A3EB 1Z7TA 2DK7A 2D62A 4QIWB 3MA2B 3GO5A 2F21A 2D0PA 1S72A 5C4XG 3K7UC 4KHPL 3HOYB 1QG7A 1M90C 1PH4A 1OO9B 2EY5A 2JYOA 4FXGC 3DM1A 3ND8A 4PV1C 3EJIA 1WTXA 2NBFA 2N8NA 4KKTA 4DR3Q 1SNCA 2K28A 2KHIA 3RLOA 4JI3L 2B63H 3MHBA 5LHY1 3M7NA 3WOFA 1XTDA 3TRZA 2NWGA 3EN2A 4B3RL 2JEBI 4G7ZC 2EY6A 2IPKD 1AP0A 4V190 5H1SE 4WORA 2CW0C 4DV0L 5IYCH 3HEJA 3F2UA 1U4RA 3AQQA 1C0AA 4FO2A 5IP9H 1G2SA 4ALPA 1EY0A 1WD1A 4JI3Q 3UDGA 2R92H 4JBWA 2MQHA 5CV6A 4B3RQ 3IFDA 4K6LA 5I6YA 5C4HA 4DV0Q 1BF4A 5BN3A 2GVAA 1ZYRC 2QILA 2TSSA 1ZEQX 2B2YA 1E1OA 4K0KL 4QMGA 4BY7H 4IUNA 1YI2A 1NR4A 1SYDA 4OEMB 1SMYD 3C2PA 3KBGA 1LYLA 1V1OA 2K4KA 2NVXH 3KF8B 5FJ8G 2JN4A 3X3MA 3STBC 2ICEC 1GM5A 5AJ3Q 1H95A 5M3MG 3S1NB 2IT1A 4CDDC 3S9WA 1DGSA 1YNJD 3I4LA 1SMYC 4K0KQ 1C9OA 3TCZA 2QA4A 4J6HA 5IGGA 2CH4A 4DU9A 1LTBD 4R4OA 3U4ZA 1A3VA 1F2LA 2XP5A 2Y8NB 2YSGA 1YNJC 2Y0SE 3PUYA 4NXML 5C3EB 3BYYB 1QJOA 3KF6B 3GTKH 1AEXA 3H6MA 2A74C 3FKIG 3I7FA 3NPPA 1WCMH 3CP0A 5I2YA 2Z6BA 3MCBB 2R7ZH 1XMOL 1SNMA 1DOKA 3DWAA 1CKNB 1PMRA 3M4QA 1X55A 4FXKC 1XJVA 4NXMQ 1VQCA 3MQGA 2E2JB 1E22A 2NB0A 1O7IA 3HP3A 1HPCA 3K7AH 4RGTA 4LNQA 2R93B 3TMEA 4DNRB 3P20A 3EIVA 2FXQA 2JA8B 1TXYA 2M00A 4AYBB 5ELEA 1XMOQ 1W6KA 4UDUC 4IOCA 1PFBA 4U673 2IWHA 4CDEC 2F0QA 4K5VA 2XP6A 1LTSD 4UP7A 1K73C 2MO0A 2KQ3A 4BBRH 2R61A 1W2BA 1DOLA 2L12A 2F3IA 4LFBL 2XGTA 3KJOA 2EXDA 4QIWE 5M3FB 1SDFA 1N34Q 3DWQA 4DAMA 4IN3A 1AH9A 1NMFA 4ZRZA 3Q24A 4X66L 3QB3A 5C0XH 4R8IA 3OTOL 4F87A 5C5LA 4A3GB 1HHVA 2SOBA 3RUZA 2E2HB 4LFBQ 3IFTA 1VQ4A 4IUQA 1ML0D 4C56C 4LW1A 4ULLA 3U50C 3SK6A 1CKOA 1KXLA 4LFCL 2M8JA 2NZ1D 1SR3A 2Z0SA 5KNBA 4FF1A 1KRSA 1ZXTA 2K5QA 4B3TL 4X66Q 2E8GA 5K36G 2KCCA 3OTOQ 1CHPD 1RTOA 3MCBA 4A3JH 4LF8L 2GVBA 3VR2A 3ZJYC 4CGYB 3VR3A 3KABA 2DY7A 4KY7A 1KHIA 3RD4A 4RA8A 1Q8IA 5C4ZA 2VQFL 4A3MB 2ZXOA 4CHTB 1HFGA 4AH6A 4CKEA 4QQBX 4LK1C 2E2IH 1U4PA 3SK5A 2UUBL 2L11A 2SDFA 1EY5A 4B3TQ 1HNWL 3HOUH 4TKOB 4GNXA 4LF8Q 4A3CG 2QF7A 4JBJA 5JJKA 4C1NI 3PUVA 1YBYA 4DR1L 2UUAL 2KBNA 1BR9A 4L5TA 2VQFQ 3EFXD 3HOZG 2A1AA 2B29A 4DAPA 1VQKA 3URYA 4B3SL 1F9PA 2UUBQ 3C1EA 5ELOA 1HNWQ 4Y7NH 1SYFA 4GOPB 3MZ5A 1BNZA 1KC8C 1F2MA 3TC5A 3TN2A 4B08A 1YNND 1Q90A 4QJFA 3T16A 3JAML 1RF2D 2F0OA 1VQMA 4DR1Q 1E2ZA 1UAPA 4KJOA 2IY5B 1S5FD 4KY6A 2FMCA 3NQTA 1DOMA 1PH9A 1SNPA 4B3SQ 2M2LA 3I4MG 5M3MB 2A68D 1STNA 5HGTA 4OWTB 4MNOA 1G6PA 3NWTA 3RN2A 3T1HL 4BXXG 2MNAA 2NVTB 1VMPA 1B9NA 3M85A 3HOXH 3H0GG 5M5YH 1MBYA 3GTLB 2G9DA 1H9KA 5E5WA 3CC2A 1WR7A 3LNNA 1HZAA 3Q0AA 3OWFA 1MIUA 1PH1A 4UP8A 1BUVT 3T1HQ 2VB2X 1LTGD 5CV8A 3PUWA 3GTOB 4WRDA 1MSHA 5C4XH 5IGBA 3J81E 2WAQB 1T5EA 4N9TA 1EOVA 1WFQA 3GDEA 4ZLTF 5E4XA 1G8ZD 3A7AB 1R4QB 2OCEA 4ILWA 4DK3C 1EZ6A 1SJED 1EL0A 5CBEE 3GTMB
chains in the Genus database with same CATH topology
4RFBA 2LKVA 1RL2A 1SROA 4NXNL 2XP8A 5KNDA 1V9PA 3SR1A 1F77A 4KKUA 3SEBA 2RQXA 5JEAG 3BVGA 1JWMD 1D5XC 4DK0A 2JMFA 1EY7A 1ASYA 1Q12A 1GJXA 3S14H 5D65A 2BH8A 3M4OB 1GOZA 4RH6A 1BOSA 4A0TA 4NXNQ 3AEVA 3U9SA 3DWPA 3PF5A 5M5XB 3RLFA 1X54A 2WV6D 3HKZE 3M9BA 1PH2A 2NTTA 2K75A 1MJCA 5EPJA 1ONLA 1KABA 1I4HA 3PIP3 3I4NB 4P74A 1F9RA 4IJLA 3K5MA 1HQMC 4P71A 1Z47A 4NP5A 4R4QA 3MVVA 3D6WA 4YY3L 2AMCB 5FJ8H 4JK1C 3HOWH 4ODGA 2ZR4A 4F8MA 1S5ED 3CCEA 2Q2TA 2F0NA 4GOPC 4LAAA 3PGZA 1TWCB 1NJIC 1FNWA 1I4QA 1PINA 4K8JA 4YY3Q 1RODA 5CV9A 4IUUA 4J1MA 2F4IA 1R9TB 1AW7A 3JAMc 2F0MA 1E2WA 5EPLA 2JA6G 4DGZA 1LUZA 2RSOA 1X65A 4DV5L 2M8IA 2PI2A 3FKIH 3ULLA 3Q6SA 4DPGA 3W1GA 2PNRC 1WI5A 2PQAB 2X6GA 3CPWA 3TP7A 1EOTA 2CHBD 1EQQA 1EY4A 2K33A 4X3TA 3BG3A 1B50A 2BDNA 3RZDB 2K04A 5DLQE 1TIID 1A2UA 5G3LF 2JA5B 2DY8A 4DV5Q 3S1QB 4JV5L 3G7LA 2OTJA 3GP7A 5IYBG 3S1RB 1VF5C 3G4SA 3PO2B 4A93B 3J7ZC 4A3EG 1AFPA 4X6AH 4WFN3 1MJEA 1L1OA 1LO5D 2JA7B 3HOYG 4HMJA 1RTNA 1E2VA 2L0CA 3OIQA 3C3LA 1PH7A 1E0BA 3BS1A 4JV5Q 2I0QA 2HDMA 2K1BA 1UUPA 2K05A 2KCMA 2ZJRA 1X3QA 3RZOH 5FLXE 3DXJC 3B6YA 3CMEA 1JE5A 3OHXC 1JCKB 3KBXA 3VR4A 2QGQA 4IPHA 4B3ML 2MDIA 1UE6A 2JK8A 4KLKA 1JJ2A 1S5DD 1RCVD 4A3BB 1B70B 5KGUA 2H4OA 2PW5A 2K52A 1HA5A 1GO3E 5CC4A 4N9PA 1UEAB 3AFPA 4EQPA 3I2ZA 1D8LA 1X56A 2JX8A 5JOBA 3GTPH 1HA6A 2KENA 1NCVA 4C3IB 4IOAA 1EZ8A 3EA6A 4X65L 1TVXA 2F0HA 3NTPA 1VQ5A 4KKSA 3S17H 1C48A 1CSQA 3L9AX 4YCUA 5DM73 1HH2P 4B3MQ 2PI2E 1QVGA 1FNVA 1YIJA 1G91A 2FINB 4JG2A 1A8VA 5K36H 1PZJD 4AQYQ 3E9IA 5BN4A 1SMXA 5DNFA 3HS0C 4X65Q 3CQZH 1TWGH 4DV2L 1KDBA 1HR0L 3EVQA 3NBIA 1IKLA 2KHJA 1RP5A 3OSOA 2B8GA 2PZWA 4JI5L 2K7VA 1YW5A 1QE6A 1M8AA 3OPOA 4DV2Q 3VA5A 2YTXA 1JOQA 1A0IA 4E5RA 3HOZH 1EWCA 5A2QL 1HR0Q 4DF7A 3ULPA 1Q86C 5BN5A 2CKZB 4FDBA 1STYA 2E76C 3K0XA 4O42A 1TY0A 5F2DA 4DR2L 1EIYB 4JI5Q 4KY5A 2EY1A 2Z4HA 3I4OA 4PQXA 1VDZA 3OWEB 2JXWA 2L5TA 3FP9A 2A69C 1I50B 5CORA 5E66A 4TRDA 5I4DA 1JB7A 5CV5A 1CKMA 2F0EA 4C3JH 2PZTA 1V1QA 4U86A 5E1FA 5C3EG 3WOEA 2N55A 1EWHA 3PSIA 3I73A 2LS01 3I4MH 3TBIB 4DNIA 1QZHA 4H02A 1B2TA 1VQFA 1QNKA 4DR2Q 1EIFA 1EG4A 1UNSA 2B2WA 4BXXH 1TWFB 3DEPA 5E3FA 1H9SA 1NUCA 2N78A 1Y1WB 3T1YL 3H0GH 1NBWA 5JJLA 4A3IB 3A8KE 3CPFA 3K5LA 3KDFA 1GD7A 2E74C 2VS1A 2JA8G 3L7ZC 1ENFA 4YHHL 5LL6S 4AYBG 3E0JA 4K14A 5NUCA 2L4JA 4L5SA 2XN9C 3MFGA 3QJYA 4C3HB 3QIAA 1HFNA 3T1YQ 3TDQA 4LUVA 2D5DA 3EBEA 3PO3B 5CQ2A 1ZKOA 4JBKA 5JVH3 2MP1A 1PTOC 1OXSC 4CKCA 1N36Q 1WJJA 1T9HA 2DGYA 3NP8A 4K5WA 1BKBA 1D6EC 1PH6A 4C2MB 1VS0A 4YHHQ 1TU2B 4A3DB 3AYHB 2JQOA 5M3FG 2BOSA 2EYHA 1HZCA 4DV3Q 3O13A 1EY6A 4IFDG 2K5VA 1K8AC 3D4WA 5FO8B 5JEAH 1J9OA 4NDXA 2ALYB 1XPUA 5GAEC 5IGFA 1AE3A 1J8IA 4A3GG 1LT6D 1HJPA 4A3KH 3V2TA 4U68A 2YTVA 5FOBB 2ZR6A 2L9HA 3SGIA 2F03A 3U58A 5IYDG 2KECA 5IY0A 1JJGA 2NN6G 1EYAA 4RCOA 2N49A 3PIPA 4HSVA 1TWHH 2YV5A 4KTAA 1E3PA 1BO0A 1AZPA 5D3DA 2B2UC 1DXMA 4BS9A 2CW0D 2F3VA 3LGJA 3IKJA 1E24A 2E75C 4LFAL 3M4PA 4KHPQ 2MJ8A 3S15B 1CZGA 4A3MG 1VQHA 4DUYL 5IT9E 4OIJA 2V1CC 2C9OA 3HKSA 4JOIC 1HZBA 1H9MA 1Y14B 1VQNA 1WD0A 3J7A5 1ZYRD 1A3TA 4QCLA 4LFAQ 4P72A 1STHA 2ZQVA 2NVYH 3D4RA 4A0UA 3LKXA 4RHRA 4JI2L 4A75A 1HR0W 1EFID 4LUOA 4DUYQ 2UU9L 2VUMH 3RLNA 2SNSA 1RJTA 1Y1VG 4L5RC 4QUCA 3STBD 1JWSD 3BZCA 2QEJC 2OQKA 4O2DA 1KAWA 2ATWA 2EXZA 1CHQD 2JA6H 1H9JA 3I8ZA 1STAA 4QUFA 3NBHB 2RE3A 1FJGL 1TR8A 4R4TA 1UE7A 5IWAL 1JR0D 2RKSA 2UU9Q 3SE0A 2JJQA 2YSFA 3F2DA 4V0BA 1V1PB 1E1TA 2RDHA 2F0VA 5JAVA 1I3QB 1TK7A 4PMWA 1U4MA 1VQAA 4QIBA 1Q82C 5JPNC 5U47A 3JAMi 4OL7A 4Q0FA 4AIMA 4B9XA 1FJGQ 4GKKL 1AN8A 4YCVA 5IWAQ 4EVOA 3TS2A 1VQIA 3Q8DA 1WTRA 1PHJA 5M5WB 3A5UA 5KRUA 1VCIA 3ERQA 4A3EH 2ES2A 5IOCA 1XWEA 2F0FA 2MFIA 3UDFA 3KAGA 2WAQG 3HOYH 4GKKQ 4DR7L 2Q5AA 2A5HA 4RHSA 1YJWA 3T51B 5DAUA 1XMQL 2JV4A 1IKMA 3H09A 4OGQC 4DK6C 4JI6L 4WJ3M 3GQBA 1M4VA 2EY2A 3OOCA 1I4RA 2CWAA 1LTRD 2HT1A 4DR7Q 4ZAIA 1VMCA 1LTAD 1XMQQ 3A54A 4BBSB 3D31A 3W3AA 3QG1A 4XT1B 1BCPB 1II3A 1B44D 2XP3A 2ZTDA 3S2DB 2EDGA 5E62A 4C1NK 3MQHA 1SYBA 3KF8A 1OTCA 2L15A 3A0JA 1A15A 2NZHA 1W3SA 3VYTA 3NSWA 1KIXA 4H44C 2HDLA 4ID6A 3G6EA 2RBMA 4GN4B 3W5OA 3I4NG 5KIXA 3KADA 3BYTB 3PUXA 3E0EA 2WAEA 1GUGA 1WTVA 3T4AC 2DNCA 2KCTA 1PRTB 1TT2A 3D3RA 1PH3A 2YSIA 5M9OA 2X69A 3H3VH 1YITA 3KF6A 2AUJD 3S1NH 3V96A 4RGNA 4DAVA 1LACA 4BA2I 2VB3X 3TDBA 4DXFA 4HR7B 1VQ9A 1I6HB 4BY1B 3F2BA 1K8MA 3NUCA 1CKNA 1P8LA 1N8RC 1PVOA 1W6JA 2FJ2A 3NTIA 2M3OW 4JI0L 2O5JC 5ELNA 5C3EH 4LUZA 4LFCQ 2L55A 3GTGB 1YHAA 1U0LA 3CHBD 3GTJB 1IW7C 5JPMC 2J0TD 3FPPA 1KAAA 1SN8A 3L0OA 1VQEA 2K50A 4HIDA 1C4QA 1B7YB 3S1MB 2EZ5W 2OWOA 1STGA 1OXTA 2XWBB 4YWKA 1F9SA 2VQEL 3GTQB 4FP5D 1S5BD 1CT1D 4JI0Q 4IPCA 1XTCD 1Y1VB 3VDYA 3HZXA 2CCZA 2E2JH 2AWNA 4WJ4A 1IYVA 1CK1A 5E64A 2JA5G 1EYDA 4DV6L 2SNMA 1EEFD 2PMZB 1UWVA 2R93H 1FGBD 2DNEA 1TS5A 3L3OC 4H0LC 4K6DA 5IODA 1LTTD 5J39A 1DYQA 2JA8H 1X6OA 3L2PA 2UUAQ 1IZ6A 3PO2G 4KN7C 4A93G 1SE4A 4P2CB 3WWVA 2JA7G 3FHWA 5FKAC 4RMFA 4DV6Q 3N6RA 1O78A 2OEOA 3NELA 1GUNA 1P16A 2CFMA 5M3FH 1EY8A 1B53A 4K5XA 4DV4L 3JC66 3UE1A 1D5ZC 5C4JB 1K9MC 1F2YA 4IFDH 1CA6A 4A3BG 4POFA 3HRZC 1I94L 1BCPC 1F9QA 3BVZA 4MHEA 3CU7A 2YTYA 4A3GH 3AFQA 1EYCA 1IBKL 2E2HH 3CKIB 4C3IG 2KCNA 4Q5VA 1QUQB 4GNXC 4DV4Q 1I4PA 3BJUA 5IYDH 2F52A 2CQAA 3TZDA 1PRTD 1IYUA 2NN6H 4NKLA 3J81L 2H1EA 1I94Q 2NTSA 4AYBE 1OXUA 4I7ZC 1HXYD 2EOTA 1FNUA 4Z9CB 2F0KA 3M4YA 2Z6KC 4RG1A 1IBKQ 2RCNA 4TQUS 1B4OA 1PRTC 3KCEA 2UXDL 4A3MH 4P73A 1UE1A 4DK1A 2NVQB 3TREA 4JYAL 3Q22A 2I5LX 2E5LL 4GLAC 2LFNA 4GOPA 4GZYC 2QEXA 4XXEA 3ULJA 3KK7A 1QNUA 2HCIA 3DLLA 4A3LG 3KLRA 2UXDQ 3UE0A 1WVLA 1Q8KA 4WJWA 1LM0A 5COYA 1CFMA 5CYUA 4JYAQ 2WB1B 2E5LQ 1PH5A 1EEID 2XTIA 3K80C 3VYUA 1DCZA 1SNOA 4LF9L 2IX1A 1G291 5C0XJ 3PQHA 4KJNA 1U9RA 1TS4A 1SRUA 4DKAC 3MXUA 5ELFA 1PV4A 1PH8A 4XTCS 3FRPB 3S16B 3GV3A 1YVCA 5GQOA 2A6HC 5ELCA 3I55A 1QB5D 5M3MH 1CTMA 2DN8A 4ME5A 2AUKA 2RHQB 4XYOA 1BBWA 1KNEA 5EGTA 2K5HA 2ZM6L 3BDCA 3I90A 2NVTH 1NMVA 5T1IA 1Y1WG 2CQOA 1Z6HA 1STBA 3GTLH 4JI1L 2DMVA 4A3IG 2BA0A 3SHLA 2YU9B 1VQGA 5IP9G 1PA6A 2YAJB 3HOVB 1N9WA 3AU7A 5C5MA 2XRQD 1ICWA 3A8JE 2ZM6Q 1GUWA 2LY7A 3GTOH 4C3HG 5D3IB 2EE1A 3WH0A 4HMIA 3PO3G 4JI1Q 2K14A 2PMZE 3CCSA 3ERSX 1I6VC 3R8BA 4GLVB 3BDOA 2AKWB 3AMUA 1EY9A 2RDGA 1BQQT 3MAQA 2DUDA 5C3WA 1KLUD 5JJIA 3ICEA 4MZ9A 3GTMH 1PFMA 4A3DG 4QY7A 4M1UB 4GLXA 3RMHA 1OXVA 4A3FB 1RDPD 3D8GA 1B1ZA 1QVCA 5C6AA 2L4NA 2ASBA 4PZ7A 3VYSA 4LMQD 3KLSA 4XIGS 2D0OA 2PZUA 2RHSB 4ZYSA 3M4OH 5DM63 1MKHA 2F0PA 3G71A 2O2LD 3DM3A 1WTQA 5C44B 1TWAB 4DXGA 3OYYA 3S2HB 1YHQA 1IBLL 3RNUA 2K5WA 1K9RA 5M5XH 4HJ9A 2Z4IA 2B2VC 1NMGA 1K0RA 4RKBA 1VQJA 1PTOB 2WAQE 3I70A 3J7YW 5KYIA 3I4NH 1G51A 4NB3A 2A8VA 5FLXL 5GAHC 2ZR5A 5E4WC 3K5OA 3EQLC 3D0FA 1GXDC 1PTOF 1B8AA 3OW2A 3I72A 3R3OA 1L2FA 4HJ8A 5C3XA 3M3YB 1HQRD 2OF1A 2E2DC 2N88A 4PZ6A 2PYKA 1PYSB 4DAYB 2Q8TA 1K8OA 5GAGC 2YYZA 2KEDA 4JBMA 5KNCA 3FMCA 2PO4A 1Q1BA 4IUTA 1D7QA 2PQAA 3FVQA 4GN5A 1S3OA 3BU2A 1TWCH 1Y69U 1N33L 5E65A 1N32L 3A74A 5CR3A 2CVRA 1D2BA 4RCNA 1G2TA 2R7FA 5IP7G 5D14A 4A4IA 1FGUA 1R9TH 3ONAB 1Q1EA 4BBRG 4RGMA 1EQVA 2QKIC 2GA4B 4R9WA 4A3CH 1RKNA 1N33Q 2HIVA 1SFOB 2OTLA 1N32Q 4POGA 2LAJA 3E5SA 2A69D 2ZT9C 1F8AB 4LJZC 2TMPA 1JC7A 3RZDH 2A19A 1QVFA 1KRTA 1L0WA 1K83B 3MXPA 2EJGC 3MC0B 3MXGA 1XYIA 2JA5H 3CMAA 5JJZA 3NXWA 1DM0B 3S1QH 4OO1I 2B2TA 2NYZD 1GUTA 4NPSA 3S1RH 1V8QA 4IZ8A 3LX0A 3PO2H 4A93H 5LL6X 3NE5B 1JJCB 1JORA 3FSCA 1I5FA 3NEMA 2JA7H 4FF3A 2B63B 4EQNA 2FFKB 2XNAC 1QWYA 2MGSA 4PMBA 1EQRA 4IJHA 1LT3D 4X3UA 1I4GA 3HGBA 1X9NA 4DAYA 1ILQA 2EYLA 1DD2A 1VQ7A 4OO1G 1KDCA 2KVMA 2ZQSA 3C46A 4A3BH 1K9QA 3NTHA 5CV4A 1PYBA 2KXQA 2WACA 2Y0SB 3CC7A 1PTOD 2D9UA 2R92B 3S24A 2AHOB 4OXPA 1TS3A 2WP8J 1OXXK 4BBSG 3IL8A 2B2UA 3J80L 4C3IH 1CSPA 2WINB 4F88A 2DK1A 2AQ1B 4LF7L 4J8QA 4YWMA 3DUZA 3IRBA 4K2KA 1ESRA 1JT8A 4BY7B 1GVPA 3BZDB 4TSSA 3KAHA 1QOHA 4JOIA 5T1GA 1L0XB 2NVXB 5EQ0A 2BE5C 3T53B 3CCMA 3KYHC 5FLXc 4LF7Q 2PW7A 4DV7L 3CCLA 4U84A 2OQ0A 1EIGA 4H7BA 4X3SA 5EKKA 1LT4D 1SBBB 3H94A 1RHPA 4HJAA 3GD7A 4EX5A 1Q7YC 5CMDA 2F0WA 1JB3A 2YSHA 4FVMA 1SJHD 2MPMA 4A3LH 1SYEA 2ICIA 2B2WC 4DV7Q 4DR3L 1I5HW 3GTKB 1HNXL 3KAFA 4X62L 4XQJA 2KHSA 4BY1G 3OMGA 1O7YA 1WCMB 4PZ8A 3VR5A 2VXWA 3A7LA 2IL8A 3PV0A 1I50H 5FK9C 2R7ZB 2F1MA 1JOKA 4RWSC 4UP9A 3I91A 1TR5A 2ENBA 1X32A 3W2DA 2FHTA 3CW2C 1Y8OB 1HNXQ 4IPGA 1NAPA 2D2CC 2WIIB 3K7AB 4X62Q 2XSCA 2M9VA 3CF5A 1VQ8A 2EYMA 2X6LA 5HURA 1U5KA 3N52A 2JEAI 3DMUA 5IT9L 2ZTCA 3W1BA 2Q8IB 3CCJA 1KD1C 2XRSD 3DHQA 1VF7A 4DA2A 5IIFA 1TWFH 1PYWD 3H91A 3ZYYX 1Y1WH 2MHVA 2H5XA 4HAEA 4HJ5A 2B8FA 5FO9B 4A3IH 2KOLA 1FLCA 4BBRB 1MD2D 4JI2Q 3KFUA 1KNAA 4B9WA 3T56B 1CZWA 1BBUA 2XP4A 1CA5A 4EQOA 1IL2A 1WYDA 3G48A 4NW2A 2JE6I 2ID0A 2XPBA 4C3HH 3GV6A 3HG9A 2K5DA 2VY3A 5IGDA 4IPDA 3PO3H 5AJ3L 2F0JA 4QB4A 3K59A 1ASZA 4C2MH 3I3CA 1ENAA 1PZID 4A3DH 1PFNA 4CKBA 2I5HA 3PMFA 1GUOA 3K57A 5EBDA 1YJNA 1BDOA 5IYBH 3K81C 1EG3A 3HOWG 1M1KC 1DONA 1FVIA 3KUPA 1SYCA 3FSBA 4FNFA 1S5CD 3J80c 2HIXA 2PQEA 4QF4A 1VQPA 3E9HA 1GKHA 5ELDA 2RSNA 1LTLA 2PNHA 4A3JB 5TSSA 4L8JA 4HCEA 1BVSA 1PXUA 3R2IA 2F0GA 2LSSA 5FLMG 1WTOA 2UUCL 2Q2UA 1EU4A 4QGUA 4G4KA 2E2IB 3OIPA 2MO1A 3D4DA 1D1IA 4X3KA 4ZUJA 3HOUB 3TS0A 2BDOA 5EBCA 2B2YC 3S15H 3MEHA 3H15A 4FF2A 5A35A 2UUCQ 3J81i 2EYFA 4GS3A 2HUGA 1A62A 2IX3A 3MWYW 3M7GA 4JI6Q 2JXMB 4JC0A 3FPUB 3TP6A 5KYLA 4OHJA 1NR2A 4GKJL 5AHTA 3NBHA 4Y7NB 2WKCA 1TKWB 1JMCA 2EJFC 5K5PA 4O1NA 1BCPF 1SE2A 1V1PA 2ZXRA 4GNXB 2C5CA 3RR5A 2IW3A 2WB1G 5LMUL 1N34L 2KEEA 1IXRA 2K03A 4XQNA 1KQSA 5IP7H 5JEAJ 1SNDA 4BWGB 4YWLA 2IHEA 4GKJQ 1SAPA 1WMVA 2VNUD 5ELBA 4X64L 3HOXB 1SYGA 5M5YB 3BDLA 2XPAA 1G6ZA 5LMUQ 5IT9c 2F0DA 5I6WA 5EKLA 4RKLA 3MXNB 1PRTF 1I3QH 4IALA 1O80A 2LXKA 3KLWA 1C7YA 2PCFB 3HKZB 5I9OA 3NENA 5IE8A 3PIO3 3F8TA 3I56A 2EPBA 4HJ7A 5EKIA 4LF4L 1IW7D 5C4XB 4X64Q 3ITPA 3HOVG 4KV6A 5M5WH 2QCPX 3K0YA 3A55A 3AB9A 1Z9FA 2SEBD 1C8CA 2KUMA 2F0UA 2K01A 2ZJPA 4ZUIA 5GROA 1NTGA 1HZ9A 4LF4Q 4H13C 1HUMA 2NZOA 2UXCL 1BXTA 3E6ZX 1J5EL 3VR6A 3KLSX 4HEDA 4ZKCB 3K58A 1HNZL 3H3VC 3TZUA 2PPBC 4OO1H 3S14B 2XP7A 4IQZA 3J81j 5GADC 1JMQA 4LF5L 4A3FG 1PLFA 2VQEQ 4KN4C 1X3FA 2UXCQ 4U85A 1HRJA 1J5EQ 4ABNA 4BBSH 3NTKA 1ENCA 1ILPA 3BZKA 2IJ0A 3HFZB 4R4IA 2Z1CA 3CCVA 2KJXA 4S3SA 1HNZQ 3JAME 2BA1A 2Z6KA 1FR3A 5C44G 3QOJA 3S2DH 3QO2A 4UY8C 4G7HC 4LF5Q 3A5ZB 2RVLA 1BCPD 2JA9A 1EUJA 4C3JG 1BBXC 3NWSA 1UEBA 3MXNA 3PUZA 2EZVA 1Q3LA 3HOWB 2XP9A 3Q23A 1YNNC 4REXA 2Q8RE 1DJRD 2HHHL 3EROA 2LMCB 4LWCA 1V43A 3ODKA 4PNYA 2CWPA 3LWEA 3OW7A 2VL6A 1FYCA 1YZ6A 2A68C 1SXTA 4UAIA 4BA1I 4M8AA 1VQLA 2EYPA 5EJWA 2NUCA 3D6CA 2R6GA 4P75A 3CXCA 1H9RA 4ME3A 4PG3A 1O7ZA 2HHHQ 3X3NA 3FKIB 3PF4A 1I6HH 1ET6A 2DJYA 4OWXB 4BY1H 1S40A 4IO9A 5FO7B 5HGQA 1T5XD 4KK7A 2AQ2B 3A8IE 1A2TA 1JICA 2OT2A 3GTGH 4DR4L 4YCWA 1IHZA 3GTJH 5CV7A 1XX8A 2EIFA 2EYJA 1QZGA 3S1MH 4MN3A 2ZAJA 1EQTA 1CM9A 4MIUA 3GTQH 2J4XA 1JOOA 4HCSA 3SDZA 2DWVA 4JCVE 4R4CA 1K8GA 4LF6L 1KL9A 4G7OC 5DEHA 4ZKBB 3FEWX 1RD9D 1Y1VH 4DR4Q 2K6AA 2A6HD 1PDQA 2WFWA 5HY6A 2F0LA 2RDFA 4A3KG 2K32A 2B39A 4KI0A 1SEBD 1CQVA 4XYQA 2F4VL 1A6XA 3RZOB 1NSNS 4LF6Q 2A6ED 4HIKA 1TQOA 2JSOA 3NK9A 3DEOA 4A76A 3SXHA 4TVAB 5LMNL 4LF9Q 2B63G 2ZQUA 1VQBA 1ESFA 2RA4A 1L1OB 3K5NA 4DFAA 3CAMA 1XNRL 1QUQA 2A6EC 3GTPB 1O6WA 4GN3B 2IHFA 2F4VQ 5IYCG 2F3WA 2LXJA 5C4JH 2E45A 2F0IA 3S17B 1QILA 3R2TA 1STEA 3P1HA 2BH2A 3U4VA 5LMNQ 2J7ZA 4CJ2C 3T13A 2XIWA 1CQFA 1XXGA 2Y0SG 2QRVA 1KTKA 4FXDA 1SE3A 2R92G 2EVBA 3KJPA 1U4LA 2F0TA 3P7JA 2B2VA 1NE3A 1XNRQ 2VUMG 1SSOA 4JI7L 1MI2A 1KLGD 4YIJA 1KDAA 2ZXPA 2HQLA 3CC4A 1A63A 2O4XA 3C1FA 5FLMH 3CQZB 1TWGB 3OMCA 5JVG3 2O5IC 4XDXA 1EIHA 2QDBA 4BY7G 1CI3M 2XVSA 4DN4M 2L1BA 3LWUA 1GHKA 1EU3A 3J80i 1Y8PB 5AFWA 5BR8L 3CNGA 3QWNA 1I4XA 3A56A 4JI7Q 1S4ZA 4JI8L 2NVQH 4R1JA 2ZQTA 3HOZB 5I9PA 5CGKA 3TP8A 1AE2A 1LTID 2XWJB 5BR8Q 3J81c 4DUZL 3WDNA 4C3JB 1X3EA 4JI8Q 1FD7D 3SK8A 2Z8LA 3SK4A 4IFDJ 4R8NA 3G6JB 1HCZA 2Q2HA 3PCOB 4K8IA 2K5NA 3I4MB 1WCMG 1PZKD 2IX0A 5I2XA 4E6IA 1GUSA 1IBLQ 2R7ZG 4DUZQ 3TQYA 3S16H 1PFSA 4DR6L 2RF4A 4Y52H 2Q2IA 3H0GB 2G9HD 5ISRA 3J7AF 1Q81C 5CBAE 3PIOA 3CRKC 3MTSA 2B3GA 3FS8A 1R4PB 3UI2A 3MFYA 1LT5D 1XNQL 4F7XA 1L0YB 5C0XI 4AQYL 1IYJB 4ZQ3A 3LE4A 4DR6Q 3L4HA 2YU9H 2A73B 3CCQA 1K3RA 1H9SB 3U9OA 3HOVH 1B3AA 4FYDA 3H3VI 3MEFA 5J22A 3KDFB 5IGCA 5E7NA 3TP5A 4KD4A 2WB1E 1XNQQ 3TEHB 1FL0A 2OXPA 1L1OC 3NQIA 2AQ3B 4XQQA 1DZ1A 4I65A 3VA7A 4HIMA 4MTNA 1EFWA 4EQ5A 3K6OA 4KHVA 2UXBL 5C0XG 1O7LA 3K8AA 1YNXA 2ZTEA 1XPRA 1ET9A 2FMMA 5IGEA 4UPAA 4IUPA 3CCRA 2ITKA 4A3KB 5A2QE 2BCOA 1MGSA 3BVMA 1NY4A 1E7ZA 2YSBA 3FDTA 5EPKA 5EAYA 2N3SA 5LMNW 4L5QA 4A3FH 4KD3A 5KEEA 1X3GA 1JWUD 3F1ZA 1YEZA 2HCCA 4IURA 1TWHB 4NMZA 1HTLD 2UXBQ 4PMCA 2F0SA 5G3LD 2MUYA 1CUKA 4A3JG 1SLJA 4K2LA 1TWAH 5C44H 3VYRA 1YHBA 4DNTB 4RGOS 3S2HH 4L63B 4HTHA 2WKDA 3KOJA 2ZJQA 1WTWA 4HIOA 4DR5L 4CBVA 2EJMA 4L6TB 2V4DA 2JP1A 4DV1L 3OOBA 2C35B 1VQ6A 4HN7A 1PTOH 3V05A 1ZCNA 1IBML 3HOUG 1TS2A 4HSPA 1JQYD 2AWOA 1HTPA 1LV9A 3RN5A 4CJ0B 2KA7A 1VQDA 2EYOA 3UDIA 3QOLA 2NVYB 3F2CA 4JI4L 4OX9L 1SE8A 2VZAA 1WTPA 2I5MX 4DR5Q 4RAUC 2VUMB 2HQEA 3M3YH 4QL5A 1WOCA 4DV1Q 4O0AA 2EQSA 3ND9A 4FF4A 2BE5D 3NHHA 1UE5A 1IBMQ 1MSGA 2R93G 3J80E 1QCBD 1N36L 4CJ1B 2VW9A 4APVA 4IFDI 1J6QA 2WADA 1XPOA 3CD6A 1LLRD 2JA6B 1RIPA 4JI4Q 4OX9Q 1AZQA 1D1KA 2R3ZA 4J15A 3SVMA 4OIKA 4G57A 3LKXB 1A3UA 3UDXA 4DV3L 3J7AV 1HUNA 1X3PA 5J3BA 2R7DA 2B2TC 3P75A 4ZK9B 2I07B 4OWWB 1EYGA 1JE4A 1IL8A 1Y8NB 1Q46A 1D5MC 1YJ9A 2NN6I 1VQOA 3CRLC 1TY2A 1EWIA 4OONA 3HOXG 3TSSA 3KAIA 1F2ZA 2GN5A 1SNQA 4IUVA 1SFOH 3R93A 4KMUC 1LABA 5J1ZA 4XT3B 4KHZA 2I46A 3ER0A 3CCUA 4EGVA 1B9MA 3HKZG 1GHJA 3IAYA 1K83H 4A3EB 1Z7TA 2DK7A 2D62A 4QIWB 3MA2B 3GO5A 2F21A 2D0PA 1S72A 5C4XG 3K7UC 4KHPL 3HOYB 1QG7A 1M90C 1PH4A 1OO9B 2EY5A 2JYOA 4FXGC 3DM1A 3ND8A 4PV1C 3EJIA 1WTXA 2NBFA 2N8NA 4KKTA 4DR3Q 1SNCA 2K28A 2KHIA 3RLOA 4JI3L 2B63H 3MHBA 5LHY1 3M7NA 3WOFA 1XTDA 3TRZA 2NWGA 3EN2A 4B3RL 2JEBI 4G7ZC 2EY6A 2IPKD 1AP0A 4V190 5H1SE 4WORA 2CW0C 4DV0L 5IYCH 3HEJA 3F2UA 1U4RA 3AQQA 1C0AA 4FO2A 5IP9H 1G2SA 4ALPA 1EY0A 1WD1A 4JI3Q 3UDGA 2R92H 4JBWA 2MQHA 5CV6A 4B3RQ 3IFDA 4K6LA 5I6YA 5C4HA 4DV0Q 1BF4A 5BN3A 2QILA 1ZYRC 2GVAA 2TSSA 1ZEQX 2B2YA 1E1OA 4K0KL 4QMGA 4BY7H 4IUNA 1YI2A 1NR4A 1SYDA 1SMYD 3C2PA 3KBGA 1LYLA 1V1OA 2K4KA 2NVXH 3KF8B 5FJ8G 3X3MA 3STBC 2ICEC 1GM5A 5AJ3Q 1H95A 5M3MG 3S1NB 2IT1A 3S9WA 1DGSA 1YNJD 3I4LA 1SMYC 4K0KQ 1C9OA 3TCZA 2QA4A 4J6HA 5IGGA 4DU9A 1LTBD 4R4OA 3U4ZA 1A3VA 1F2LA 2XP5A 2Y8NB 2YSGA 1YNJC 3PUYA 2Y0SE 4NXML 5C3EB 3BYYB 1QJOA 3KF6B 3GTKH 1AEXA 3H6MA 2A74C 3FKIG 3I7FA 3NPPA 1WCMH 3CP0A 5I2YA 3MCBB 2R7ZH 1XMOL 1SNMA 1DOKA 3DWAA 1PMRA 1CKNB 3M4QA 1X55A 4FXKC 1XJVA 4NXMQ 1VQCA 3MQGA 2E2JB 1E22A 2NB0A 1O7IA 3HP3A 1HPCA 4RGTA 3K7AH 4LNQA 2R93B 3TMEA 4DNRB 3P20A 3EIVA 2JA8B 2FXQA 1TXYA 2M00A