2BA1A

Archaeal exosome core
Total Genus 36
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
36
sequence length
179
structure length
179
Chain Sequence
MRFVMPGDRIGSAEEYVKGEGVYEEGGELFAAVAGKLIIKDRVAKVESISPIPEIVKGDVVLGRVVDLRNSIALIEVSSKKGENRGPSNRGIGILHVSNVDEGYVKEISEAVGYLDILKARVIGDNLRLSTKEEEMGVLRALCSNCKTEMVREGDILKCPECGRVEKRKISTDYGKGEW
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Archaeal exosome RNA binding protein CSL4
publication title Structural framework for the mechanism of archaeal exosomes in RNA processing.
pubmed doi rcsb
source organism Archaeoglobus fulgidus
molecule tags Rna binding protein
total genus 36
structure length 179
sequence length 179
chains with identical sequence B, C
ec nomenclature
pdb deposition date 2005-10-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF10447 EXOSC1 Exosome component EXOSC1/CSL4
A PF14382 ECR1_N Exosome complex exonuclease RRP4 N-terminal region
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.20.70.10 Mainly Beta Single Sheet Ubiquitin Ligase Nedd4; Chain: W; Ubiquitin Ligase Nedd4; Chain: W; 2ba1A03
2.40.50.100 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 2ba1A01
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 2ba1A02
3S1RH 4DNRB 4DV4L 2L5TA 1HNXL 1PH2A 4A3LH 4YWLA 1VQ5A 2LSSA 3W1BA 4OX9Q 1NBWA 4A93G 3A5ZB 3HOUH 2EJGC 4JBWA 2WB1G 2YSGA 4A3MH 2XP6A 1GUOA 3TZUA 4OGQC 2OQKA 3HOVH 1V9PA 4LUVA 4A3FG 4AYBG 4KHPL 5K36G 2JE6I 1WCMH 1IW7D 1TKWB 4QJFA 3D0FA 3RNUA 4GKJQ 2QEXA 4HJ8A 2EVBA 4PV1C 3K80C 1B8AA 1SMXA 3CW2C 3ND9A 3S2DH 1C9OA 3S16H 3U9SA 3D31A 4A3EH 4DV1L 3TCZA 3QIAA 3F8TA 5HY6A 4YWMA 4YCUA 4IJLA 2JA8H 4X64Q 4JI3L 1B9NA 4DR1L 1VQEA 2IHFA 4DR4L 3ND8A 4EX5A 5GQOA 1BBUA 1E2VA 3T53B 2UUBL 2E8GA 2VQFQ 1XJVA 2JA7G 3NEMA 3PIPA 4DR7L 5GROA 2A68D 2E75C 1YNXA 1FR3A 3HOWG 4RG1A 2PNRC 5IP7H 1QZGA 2NN6H 1A8VA 4GKKQ 3CCMA 3BU2A 4DV3Q 3G4SA 4DUZQ 4APVA 3M4YA 3CCRA 3CAMA 2VL6A 4OWWB 2I5HA 2E2IH 2NZOA 3PGZA 2AWNA 2D0PA 2K33A 4POGA 2K5HA 3CF5A 4IFDI 4DNTB 2ES2A 4KHZA 1Z47A 3M85A 2DUDA 1YW5A 1Q1BA 2R92H 1KIXA 4JI0L 2KCTA 2ZJRA 3CCQA 3I73A 4P71A 1YJNA 4DPGA 2JQOA 2RE3A 4KN4C 1VQIA 3I2ZA 3ULJA 2E5LQ 1HCZA 2ZJPA 4G7OC 3CCEA 2BH8A 1IZ6A 1NMFA 3OW7A 1GUTA 4BBRH 1HZBA 1CSQA 4FDBA 4HIDA 4R4QA 4LF8Q 2R7ZG 1CKOA 3BG3A 1OXVA 2EQSA 5FJ8G 1CKNB 1H9JA 1VQ9A 3FMCA 4NXNL 1P16A 1PH4A 3KFUA 4NB3A 3G6EA 4DNIA 1SR3A 5IYDH 3GTQH 1PHJA 4BXXG 4A3BH 3CXCA 1IYUA 1L1OB 2Q8IB 2Q2TA 4YCWA 5ELOA 2D0OA 4HJAA 5M5YH 3KJOA 1I6HH 2B8FA 5JEAJ 4B3MQ 2DK1A 4LF9Q 1PH1A 3JAMc 4LFAL 1S40A 1JE5A 4OXPA 5GAHC 3I4OA 4H0LC 2VUMH 1AH9A 1K0RA 5M5WH 4LFBL 4TQUS 3TS0A 3IRBA 2YSHA 4JV5Q 3FKIG 1YJ9A 5ELNA 4R4OA 1X56A 2E76C 2B63H 4A3KG 4LF6Q 2BE5D 1HZ9A 3I56A 2E2JH 3I4LA 1UWVA 2AUJD 4A3LG 4MNOA 3KLWA 4DV6Q 4DV5Q 2LAJA 5BN4A 2F4VQ 2XPAA 1E1TA 3T51B 1A62A 1L1OC 3IFTA 1Y14B 4DV2Q 3B6YA 1E2ZA 3NELA 4A93H 1L2FA 4OO1I 2JV4A 1QUQA 1FJGL 1AE3A 1EYGA 2PI2E 4JI8L 1M90C 1UEBA 1KL9A 2A6ED 3GQBA 1E7ZA 1E1OA 1YI2A 2WFWA 5C0XG 2EZ5W 2DGYA 1VQBA 1U5KA 2UXCQ 4A3FH 3MEFA 3MFYA 2D5DA 1I94Q 3H94A 4DV0Q 3CC4A 5K36H 4XTCS 2Q2IA 1L0WA 1VQKA 1XNQQ 1QVGA 4UP9A 2ZR6A 4GLXA 1X3FA 2PQAA 3VA7A 2PPBC 1PH6A 1HQMC 5IYCG 4LUZA 2IT1A 2CFMA 2ZT9C 2HHHL 1GUSA 1ASYA 4IQZA 3PCOB 2BDOA 4QY7A 4LF7L 2YTYA 3CRLC 4JI6Q 4JBMA 1XNRL 1J6QA 1BKBA 2IX1A 5IE8A 2KHIA 2UU9Q 2R7FA 1VDZA 2JA7H 1O7LA 3GTJH 4U86A 1XMOQ 2DK7A 3LWUA 5GAEC 3HOWH 1K8AC 2ZM6L 3H3VI 2YSFA 5BN3A 4LWCA 3J81i 3J7A5 1VQHA 1HH2P 4LF5Q 1GUNA 2R7DA 4DR5L 3K7UC 3KYHC 2XP7A 1T9HA 2ZQTA 4QGUA 3U50C 5GADC 2VQEL 2AWOA 4X65L 3M4QA 1YBYA 4LNQA 1VQLA 2V1CC 1I5FA 4K0KL 2D2CC 4AQYL 3AQQA 1K9RA 1Y8PB 2R92G 4PZ7A 1NE3A 4A3CG 5KNCA 5AJ3Q 1N36Q 4DR3L 4YY3Q 1I50H 1K73C 1KQSA 2JA6G 4B3RQ 4QIWE 2K50A 1SRUA 3GD7A 2K75A 3VR5A 2Z6KC 1H9MA 1QJOA 1VQAA 4IPHA 5C44G 4B3SQ 1HR0Q 1SMYC 4JI1Q 2FXQA 3CC2A 1VQGA 3CNGA 3CCVA 2N3SA 4BBRG 4A75A 3S1QH 3H15A 3DXJC 1MJCA 2B8GA 2QF7A 3OTOQ 2R7ZH 5FJ8H 3UDFA 1EUJA 3GO5A 3K7AH 1E22A 1M1KC 4IO9A 4BXXH 4DR2Q 1N9WA 2A68C 3H0GH 5IY0A 1S72A 2UXBL 3DLLA 4OWTB 4KHPQ 2H5XA 3TS2A 2LXKA 1BVSA 1HPCA 2JA5G 1EOVA 1YVCA 4H02A 1N8RC 1GM5A 4P75A 4JYAL 1N32Q 2ZR5A 4GNXA 2E45A 4A3KH 4NPSA 2Q5AA 2YSIA 4GS3A 1HNZQ 1NMGA 2XP4A 3K0XA 1EG3A 2MDIA 2ZTEA 4DR4Q 4JI2Q 2KENA 3CCSA 4EQ5A 4UPAA 1PFSA 5J3BA 3CCUA 5IT9c 2C35B 2KBNA 5LMUQ 3TC5A 2K4KA 1IBKL 3J81j 1Y8OB 3AFQA 1VQJA 1HTPA 3CPWA 3HOXH 1XPOA 1CI3M 1VQNA 1XMQQ 3GTOH 2EJMA 3L4HA 5E7NA 1G6PA 2GN5A 5C0XH 4BY7H 3VDYA 2ALYB 5IYBG 2HIXA 2F1MA 3FPPA 4NXMQ 2A1AA 2MO1A 4KKTA 2UXDQ 5M5XH 3PUZA 3RZDH 2OTJA 5JEAG 3MXNB 4GN4B 4YHHL 2AUKA 3WDNA 5IYCH 1UE5A 4L5QA 1WYDA 2A69C 1BDOA 1SROA 4JI7L 3BDOA 2A19A 1YHBA 1X54A 1EWHA 1A63A 4IPGA 4B3TQ 2ZQSA 3JAMi 2ZTCA 1W3SA 1EFWA 1VQMA 1PINA 1T5EA 4AIMA 2XPBA 1K8OA 2F52A 3SDZA 1X3EA 4LF4L 1B9MA 4OX9L 3CQZH 4YWKA 4C2MH 3KAIA 3RLOA 4QL5A 3KCEA 2NVYH 1KRTA 1YHQA 4A3IG 1H9RA 1Q7YC 3PUVA 3OOBA 3HGBA 1NY4A 1KHIA 5IP9G 1OXSC 1V43A 1GUGA 3HOZG 3K8AA 2UUAL 4DUYQ 3PSIA 4MTNA 3KAFA 3AEVA 1JT8A 1FYCA 1HZAA 3TEHB 1Q8KA 4WJ3M 2XP3A 2MFIA 4C3HH 2CKZB 1KAWA 1MIUA 1LACA 3E9IA 1IBMQ 4IOAA 2EIFA 5KNDA 4A3CH 1TK7A 3IKJA 3A8JE 2JA6H 3M4PA 1X55A 4BA1I 5C44H 3STBC 1I3QH 1SE8A 4JOIA 2I5LX 2JEBI 1IBLQ 1OTCA 1CUKA 1LTLA 4X64L 5IWAQ 1HJPA 1PYSB 3BJUA 2B3GA 3GDEA 2ZJQA 1G51A 1H9KA 3OPOA 4JI4L 1HZCA 3J7ZC 3F2CA 1ASZA 2DNCA 1VQDA 3F2DA 4JI5Q 3PF5A 2JXWA 2VY3A 3ER0A 4H44C 1YNNC 4IOCA 2WAQE 4X66Q 4HJ9A 1N33Q 1FJGQ 3CD6A 3T1YQ 3H0GG 3F2BA 1JJGA 1Q46A 4JI8Q 4GKKL 4BY1G 4DV3L 3OYYA 1YNJC 4P72A 1K9MC 4DUZL 1VF7A 4X62Q 1O7IA 2F3IA 1JB7A 2A8VA 3W1GA 3S15H 3NE5B 1JJCB 3CCJA 4A3JG 1N34Q 4IFDG 1E3PA 2HT1A 3I4MG 2F21A 2VNUD 2JA5H 4DK0A 1VS0A 3T1HQ 3CP0A 3J80c 2NVQH 3KLRA 1DD2A 1ZCNA 1UE6A 4LF7Q 4JBKA 1NMVA 1B7YB 1K8MA 1B70B 3WH0A 3PO3G 2Q2UA 1Q12A 2PQAB 3GTMH 2VS1A 5FLXc 1RIPA 4A76A 4LF8L 3HOXG 2JMFA 3A5UA 2ZAJA 5AHTA 3S2HH 1MJEA 2YYZA 3KF6B 4HJ7A 3OOCA 2A6HC 4BY7G 3M7NA 3CPFA 1QVCA 4P74A 3A7LA 1H95A 2L15A 3D4RA 5IYBH 4DR6L 4ALPA 3CRKC 4X65Q 1KRSA 1LABA 1YITA 4E5RA 1CSPA 1V1QA 4K0KQ 1KC8C 3OW2A 3ULPA 1W2BA 1Y1WH 1JMCA 1IYVA 4C3JH 3E0EA 5JEAH 4KKUA 5A35A 1JMQA 2CQOA 3L2PA 1E24A 2RHQB 3KJPA 4HIKA 3BZCA 2Q2HA 5FLMH 5EAYA 2ZR4A 3WWVA 2NZHA 4LF6L 2RF4A 4G7HC 3TREA 4DKAC 5LMNQ 2UUCL 3P20A 4DV6L 4QQBX 4DV5L 2F4VL 3CMEA 4PZ6A 3E9HA 1G291 3RN5A 3UE1A 2D62A 1K3RA 4LUOA 3VR6A 4OO1G 4U85A 4HIOA 4A3IH 1I6VC 4DV7L 2CWPA 4LFCQ 1LYLA 1J5EL 3L0OA 5IP9H 3L7ZC 1WFQA 3HOYG 4PZ8A 1TWGH 3HOZH 1EG4A 2QGQA 2YSBA 3I4NH 2JXMB 3EN2A 2UXCL 1Q86C 2E2HH 1S3OA 1I94L 4DV0L 2K14A 3ODKA 1HNWL 2N8NA 4KLKA 2WP8J 4JC0A 1XTDA 1IW7C 3U4ZA 4DAYB 4L5RC 1GKHA 3ERSX 2OWOA 4RMFA 4DV4Q 1TWCH 4JI6L 2K5VA 1HNXQ 3F1ZA 3AFPA 1EIYB 1GHKA 3T56B 1FVIA 4A3GH 3RZOH 3VR2A 2UU9L 2MNAA 2XP9A 3S1NH 1PA6A 1TWHH 4WJ4A 4GNXB 2LMCB 3UDXA 1RL2A 1LM0A 2GVAA 4A3DH 5C0XJ 2RHSB 4LF5L 4BY1H 1DXMA 5JJIA 4KI0A 4PG3A 1K8GA 1PH8A 2AKWB 1WR7A 5C4XG 3KOJA 4GOPA 1DGSA 2JX8A 1WMVA 1Q1EA 4A3JH 1Z7TA 1HR0W 3W5OA 3KAHA 4IFDH 1IXRA 2DJYA 4R4IA 1LUZA 3I4MH 4Y52H 4GOPC 3I55A 1NTGA 2KHJA 2HQLA 4DV1Q 5AJ3L 1GJXA 4YY3L 3KDFA 4B3RL 1ONLA 4JI3Q 4RCNA 2O5JC 4DR1Q 4GNXC 4B3SL 2MO0A 2DNEA 3PO3H 1VQ6A 1MKHA 1CFMA 3NTPA 2UUBQ 3TDBA 4DR7Q 3VR4A 5JJKA 4I7ZC 3FP9A 1F8AB 1R9TH 3OTOL 4LF4Q 2ID0A 3KAGA 4G7ZC 4OWXB 3A0JA 2YU9H 1IL2A 1OXXK 1EQRA 1VF5C 2UUAQ 3I7FA 4MZ9A 2BA1A 4DR2L 3N6RA 4JCVE 4REXA 1Y1WG 2I0QA 1H9SA 4IJHA 2KXQA 1O78A 3TRZA 2PI2A 3U4VA 1Q81C 2LXJA 1X3GA 4JI0Q 4A4IA 3FHWA 4HR7B 1D8LA 3BZKA 1K83H 1P8LA 3HKZE 5FLMG 4JG2A 4YCVA 2XP8A 4Y7NH 1PMRA 1O6WA 1VQCA 3LGJA 5BR8L 2ZTDA 1N32L 1X65A 3PIOA 1D7QA 1CKMA 3CMAA 1HNZL 3PF4A 1C0AA 5GAGC 2YTVA 3A7AB 4JI2L 2BE5C 2N78A 2EXDA 4JI4Q 3J80i 1KD1C 2YV5A 4NXNQ 2M8IA 5LMUL 2WB1E 4OO1H 1SFOH 1ZKOA 3A8KE 2JK8A 4TKOB 2WAQG 3ICEA 1E2WA 3I4NG 3HOYH 4X6AH 1XMQL 3EBEA 5KNBA 4AH6A 4AYBE 2ASBA 3A8IE 4GN3B 3S24A 4UY8C 1PH7A 4LFAQ 2A6EC 4GN5A 1Q82C 2VZAA 4NXML 3RLNA 2KCCA 4ME3A 3PV0A 4GKJL 2UXDL 4LFBQ 2EDGA 4LK1C 1WOCA 1VQFA 2BA0A 4O0AA 3M4OH 4KKSA 4POFA 4DK6C 1QZHA 5M3FH 1Y8NB 4UP8A 2YTXA 2OCEA 3PO2G 2EJFC 4KN7C 4R1JA 2XP5A 4L8JA 4L5TA 1YHAA 4JOIC 2IX0A 1XPRA 3KADA 1YZ6A 4A3GG 4B3TL 2VQFL 3G48A 1PH3A 3QG1A 4L5SA 2VW9A 1TU2B 3H3VH 3KABA 4A3DG 1BBWA 5H1SE 2XTIA 1VQ4A 1SN8A 3CCLA 2OQ0A 5BN5A 5CQ2A 3S14H 1JJ2A 1V8QA 5C0XI 5M3MG 3DM3A 1GO3E 1VQOA 4DR6Q 5JJLA 5C4XH 4DUYL 1TXYA 5C3EH 1QUQB 4IPDA 4BBSG 2IY5B 3RN2A 3HKSA 2A69D 1VQ7A 4P73A 4HJ5A 3UDGA 1IBML 4LW1A 1FL0A 2R93G 2HHHQ 2XGTA 4PMWA 2PCFB 3S1MH 1Y1VG 1CKNA 2N49A 3KF8B 1I5HW 1XNRQ 2Z0SA 2E5LL 4DK1A 1IBLL 4JBJA 3SGIA 2ZQUA 1K9QA 1IYJB 1VQPA 3UDIA 1L1OA 5IWAL 4IPCA 4GZYC 2OTLA 1PH5A 2UUCQ 3M9BA 3MXUA 2ZM6Q 2CWAA 2B29A 4OONA 2NN6I 2E74C 1TWAH 4J15A 4DAMA 1A6XA 3RLFA 4JI5L 4DR5Q 1A0IA 2Y0SG 3HOUG 1EQQA 2L4JA 4DV7Q 4X66L 1N33L 1J5EQ 2ITKA 2VQEQ 4A3MG 3T1YL 3GTKH 1GHJA 1VQ8A 3JC66 3HOVG 2DN8A 2AHOB 4AQYQ 4B3ML 1Z6HA 2RCNA 4X62L 4LF9L 2NVTH 4U84A 1WCMG 1YEZA 4DR3Q 1N34L 1PV4A 4XIGS 1HNWQ 4O2DA 1PYBA 3STBD 4KMUC 2JA9A 4HIMA 2KA7A 3GTLH 1QVFA 4LJZC 3T1HL 4JV5L 1KXLA 2JJQA 1Y69U 4A3EG 4QIBA 2K52A 5C4JH 2JA8G 3PUWA 2HIVA 3HFZB 1ZYRC 5DLQE 3KF6A 3TQYA 3NENA 1SLJA 4DV2L 1WJJA 2Y0SE 2PMZE 3ULLA 4UP7A 1EIFA 1DCZA 5IP7G 4R4CA 3CC7A 4TVAB 2NN6G 3LE4A 3EQLC 3W3AA 3A74A 1UE7A 2UXBQ 1YJWA 2IHEA 1Z9FA 4IFDJ 1NJIC 5HGQA 3QJYA 2CCZA 4BA2I 4H13C 1XNQL 4R4TA 2ZQVA 4GLVB 2PNHA 2Z6KA 4JYAQ 2AMCB 1X9NA 1UE1A 5LMNW 5M3FG 2MQHA 3U58A 1OXUA 2JEAI 2K5NA 1YIJA 3UE0A 4GOPB 2ATWA 3PUYA 3GTGH 3AB9A 3PO2H 2M3OW 2K7VA 2I5MX 1WI5A 1VCIA 2GVBA 3Q8DA 3M3YH 2R6GA 1GD7A 1IBKQ 5LMNL 1FGUA 1XMOL 3KDFB 2O5IC 2A6HD 1Q90A 3K81C 2M8JA 1PVOA 4C3IH 5IYDG 3LNNA 4A3BG 2CW0C 4LFCL 2DWVA 4DK3C 3PUXA 1AE2A 3RR5A 1OXTA 1PH9A 5M3MH 5C3EG 1XPUA 1CTMA 3AYHB 3GTPH 1EWIA 2BH2A 3EIVA 3ZJYC 2K32A 2V4DA 4BBSH 2QA4A 1TWFH 2DMVA 3SE0A 4YHHQ 1GVPA 3VR3A 1N36L 2NVXH 2R93H 3NBHB 2VUMG 4JK1C 3G71A 1C7YA 4JI7Q 4GLAC 1Y1VH 1HR0L 3HKZG 2B63G 3J81c 1U0LA 3FKIH 3I72A 4JI1L 2KCMA 5BR8Q 1X6OA 1H9SB 3S17H
chains in the Genus database with same CATH superfamily
3S1RH 4DNRB 4DV4L 2QW7A 2L5TA 4CDDC 1HNXL 5E3FA 1S5FD 1PH2A 4A3LH 2AQ3B 4YWLA 1VQ5A 1JCKB 3MA2B 4TRDA 2LSSA 3W1BA 2OEOA 1JR0D 4OX9Q 2NBFA 4DA2A 3BVZA 2F0UA 1NBWA 4A93G 3FS8A 1I4XA 4HMIA 1EFID 2A73B 2DY7A 3A5ZB 3HOUH 2EJGC 4JBWA 2WB1G 4J6HA 1XX8A 3NQTA 4A3KB 5I2XA 5F2DA 2YSGA 1JOQA 4A3MH 2XP6A 1GUOA 3TZUA 1EQVA 1FGBD 4OGQC 5ELBA 2OQKA 3EJIA 3HOVH 2K1BA 1EZ6A 1SE4A 4DFAA 1RP5A 1TS4A 1V9PA 2EYMA 4LUVA 1MBYA 4A3FG 4AYBG 4KHPL 4QUFA 5K36G 4C56C 2JE6I 4KTAA 1WCMH 1IW7D 1TKWB 4I65A 1SMYD 3D0FA 4QJFA 1KDCA 3V05A 3C46A 3RNUA 3HRZC 2QEXA 4HJ8A 4GKJQ 3U9OA 2EVBA 3K80C 4PV1C 1B8AA 1SMXA 3CW2C 5ISRA 3NP8A 3ND9A 3S2DH 1C9OA 3HOXB 3S16H 3FEWX 5KEEA 1QNUA 3U9SA 2H4OA 2F0PA 2IW3A 3D31A 3QO2A 4A3EH 1LT5D 4ZYSA 4DV1L 3TCZA 3F8TA 3K6OA 3QIAA 3GTOB 3HZXA 2KHSA 2NUCA 5HY6A 4YWMA 4YCUA 3TDQA 4IJLA 2JA8H 4BY7B 4X64Q 4JI3L 1B9NA 2QDBA 3Q23A 5HURA 4DR1L 3TMEA 1VQEA 3MXPA 2IHFA 4DR4L 4V190 3ND8A 4EX5A 5GQOA 1BBUA 1E2VA 3T53B 1NAPA 5M5XB 2E8GA 2VQFQ 4ULLA 2UUBL 1XJVA 2JA7G 1DOKA 4WRDA 3NEMA 4I7AA 2EYLA 3PIPA 2EPBA 4DR7L 5GROA 2A68D 4KD3A 2E75C 3RZDB 4K2KA 4CDFC 1YNXA 5J1ZA 1FR3A 3L3OC 3HOWG 1WD0A 4HAEA 4RG1A 1ZXTA 2PNRC 4UHVA 1CZGA 5IP7H 1QZGA 2NN6H 2RQXA 1E0BA 1AZQA 1A8VA 4GKKQ 3CCMA 3BU2A 4DV3Q 2HCCA 1PYWD 1JOOA 2RA4A 3G4SA 4DUZQ 1B44D 4LMQD 4APVA 1EL0A 1EY5A 3M4YA 2G9DA 3CCRA 3CAMA 2VL6A 5EPLA 4OWWB 2I5HA 2E2IH 1NR4A 2VXWA 2NZOA 2K6AA 5CV4A 3PGZA 1PRTC 2AWNA 2D0PA 2JYOA 2HUGA 2K33A 4POGA 2E2DC 2K5HA 3CF5A 4IFDI 4NW2A 4DNTB 2JN4A 2ES2A 3CQZB 4H7BA 1FLCA 4KHZA 2CH4W 4C2MB 1Z47A 3M85A 2DUDA 2NVYB 1YW5A 1Q1BA 2R92H 1KIXA 1ESRA 5I4DA 4JI0L 2KCTA 2ZJRA 1RJTA 2Y8NB 2WADA 3CCQA 3I73A 5I2YA 4IUNA 4P71A 1YJNA 4DPGA 2JQOA 2RE3A 4KN4C 1VQIA 3I2ZA 3ULJA 5C3XA 1SE3A 1CT1D 5T1GA 1HCZA 2E5LQ 2ZJPA 4G7OC 1RTOA 1ET9A 3CCEA 1KNEA 1BCPB 3A56A 3EA6A 3BVMA 2BH8A 4IUPA 5CGKA 1SYDA 1IZ6A 1NMFA 3K0YA 3OW7A 3P75A 3Q6SA 4C3HB 1GUTA 4BBRH 1HZBA 1CSQA 4FDBA 4HIDA 4R4QA 5IGBA 4LF8Q 1SYBA 2R7ZG 1HUNA 1CKOA 3BG3A 1OXVA 3K5NA 2EQSA 5FJ8G 1CKNB 1H9JA 1QG7A 1VQ9A 3FMCA 4NXNL 4KV6A 2JA6B 3E0JA 1P16A 5CC4A 1PH4A 3KFUA 1I4QA 4NB3A 3G6EA 4DNIA 1SR3A 5IYDH 3GTQH 3M4OB 5IODA 1STYA 1PHJA 4BXXG 1QWYA 4A3BH 2SNMA 3H91A 3CXCA 2EY2A 5C44B 1I3QB 4XT1B 1IYUA 1L1OB 2Q8IB 2Q2TA 1PFBA 4YCWA 2IX3A 5ELOA 2D0OA 2TMPA 2XN9C 1G6ZA 2Q8TA 4HJAA 2WIIB 5M5YH 3KJOA 5EGTA 1I6HH 1D6EC 2B8FA 5JEAJ 4B3MQ 2DK1A 4LF9Q 5JPMC 1PH1A 1O80A 3JAMc 3TP5A 4LFAL 5FOBB 1S40A 2F0FA 1EYCA 1JE5A 2NYZD 1LT4D 4OXPA 5GAHC 1HRJA 3P7JA 3I4OA 4H0LC 2VUMH 1EYAA 1HXYD 1AH9A 1K0RA 5M5WH 4LFBL 4DU9A 4TQUS 2CVRA 3TS0A 1GOZA 3IRBA 2YSHA 4JV5Q 3FKIG 1YJ9A 5ELNA 4R4OA 1X56A 4FXDA 2E76C 2B2VC 2B63H 5E4WC 4A3KG 4PQXA 3NHHA 4LF6Q 1NUCA 2BE5D 1HZ9A 3I56A 1EWCA 1CHQD 4RKBA 2E2JH 2K5WA 1UWVA 3I4LA 3QOJA 2AUJD 1L0YB 4A3LG 1IKLA 1R4PB 3BS1A 4MNOA 5DM73 3KLWA 4DV6Q 4DV5Q 3S15B 2LAJA 5C4XB 5BN4A 2F4VQ 2XPAA 1E1TA 4FF3A 1A62A 3T51B 1L1OC 3GV6A 3NUCA 3IFTA 1Y14B 4DV2Q 4R8IA 3HP3A 2JA5B 3B6YA 1E2ZA 3NELA 5U47A 4A93H 2NVQB 1CA6A 1HQRD 1L2FA 4OO1I 2JV4A 1QUQA 2F3WA 1FJGL 5LL6X 2X6GA 1SDFA 1AE3A 1EYGA 3J80E 2PI2E 2LKVA 1HFGA 4JI8L 1M90C 1UEBA 4X3TA 2K01A 1KL9A 3GQBA 1EU3A 1E7ZA 1E1OA 2A6ED 1YI2A 2WFWA 1W6JA 5C0XG 2EZ5W 1XXGA 1TY2A 3EFXD 3ONAB 2DGYA 3D4WA 1VQBA 1U5KA 1PTOF 5IT9L 3H3VC 2UXCQ 4A3FH 3MEFA 3MFYA 2D5DA 4G4KA 1I94Q 3GTMB 3H94A 1RF2D 4DV0Q 3CC4A 5K36H 4XTCS 1D5MC 2Q2IA 3PIP3 4HEDA 1OO9B 1L0WA 1VQKA 1XNQQ 1SJHD 1QVGA 1PTOB 4UP9A 5FLXE 2ZR6A 4GLXA 3NQIA 1X3FA 2PQAA 3VA7A 2PPBC 4QMGA 2Z1CA 1JICA 3MFGA 1PH6A 1HQMC 5IYCG 3S2HB 2KEDA 2D9UA 4LUZA 2IT1A 2CFMA 2ZT9C 3W2DA 2HHHL 1GUSA 1ASYA 4IQZA 3PCOB 4FXGC 2BDOA 1HA5A 2XSCA 4QY7A 4LF7L 1EY7A 2YTYA 1RD9D 3CRLC 4JI6Q 4JBMA 5CYUA 1XNRL 1YNND 1J6QA 2MGSA 1BKBA 2IX1A 3PMFA 5IE8A 2KHIA 4OL7A 2UU9Q 2R7FA 5E4XA 1VDZA 2JA7H 1O7LA 3I3CA 1S5BD 3GTJH 1XWEA 4ZLTF 4U86A 1UUPA 1Y1WB 5C5LA 2NVTB 1XMOQ 2DK7A 5EKKA 4C3JB 2F0JA 3LWUA 3CU7A 5IGFA 5GAEC 3HOWH 1K8AC 2WACA 2ZM6L 3H3VI 2YSFA 5BN3A 4LWCA 3J81i 3J7A5 1UEAB 4L63B 1VQHA 5IIFA 1HH2P 1LTTD 1GUNA 4LF5Q 3TBIB 2R7DA 4DR5L 3K7UC 3KYHC 2XP7A 1T9HA 2ZQTA 2FHTA 4QGUA 4RGOS 3U50C 5GADC 2L9HA 2VQEL 2AWOA 4X65L 3M4QA 1YBYA 4LNQA 1SNCA 4WJWA 1VQLA 2V1CC 2MP1A 1TS3A 1I5FA 1F2ZA 3DEPA 4K0KL 2F0GA 1KDBA 5A2QL 2D2CC 4AQYL 1O7ZA 1A3TA 1CHPD 3AQQA 1I4HA 1K9RA 3H09A 5I6YA 3MEHA 1Y8PB 2PW5A 2R92G 4PZ7A 2RDFA 4RGMA 1NE3A 4A3CG 5KNCA 5AJ3Q 1N36Q 4DR3L 1VMCA 4YY3Q 1I50H 1K73C 4A3IB 1KQSA 2JA6G 1V1PB 4B3RQ 3NSWA 4QIWE 2K50A 4RA8A 4XYOA 1ILPA 1D5XC 1SRUA 2K75A 3GD7A 3VR5A 2Z6KC 1H9MA 3SEBA 1QJOA 1VQAA 4IPHA 5C44G 4B3SQ 1HR0Q 1TWGB 3HOZB 1SMYC 4JI1Q 2FFKB 2FJ2A 3J7YW 2FXQA 1B3QA 4F8MA 3CC2A 3I4NB 5EBCA 1VQGA 3CNGA 1LLRD 3CCVA 2N3SA 4BBRG 1MGSA 4CHTB 1SNPA 4A75A 4IUQA 3S1QH 3H15A 5ELFA 1MJCA 3DXJC 2B8GA 2QF7A 3OTOQ 2R7ZH 4X3SA 2SDFA 2P5ZX 2EY5A 5FJ8H 3UDFA 1EUJA 3BDLA 3GO5A 3K7AH 3AU7A 1E22A 5DEHA 1M1KC 4B08A 1DOLA 3NTKA 4IO9A 4K5WA 4BXXH 5IGDA 2GA4B 1GXDC 4K14A 2PW7A 3KLSX 1NNXA 4DR2Q 1N9WA 1U4PA 2A68C 3H0GH 1TWCB 1SNOA 2FINB 5IY0A 3TN2A 1AZPA 1S72A 2UXBL 3DLLA 4OWTB 5JVH3 4DAYA 4KHPQ 2FMCA 2H5XA 4A3GB 3RZOB 4R8NA 2RCFA 3RD4A 1RKNA 4N9TA 1B4OA 3TS2A 3S1NB 2LXKA 3AMUA 4DXFA 1TWHB 1BVSA 1HPCA 2JA5G 1LT6D 1EOVA 2QCPX 5KYLA 1YVCA 4H02A 4NP5A 2EY6A 1N8RC 1ZYRD 2EE1A 4A3DB 3OHXC 1GM5A 1LTBD 4P75A 4JYAL 1SEBD 1U4MA 1N32Q 3FSBA 1JB3A 3J7AF 4BY1B 2ZR5A 4GNXA 2E45A 4A3KH 4NPSA 3JAML 2Q5AA 2YSIA 4GS3A 1HNZQ 1NMGA 2XP4A 2WKDA 3K0XA 4XT3B 1EG3A 4OELB 2MDIA 4K5XA 2ZTEA 4FNFA 1SBBB 3I8ZA 4DR4Q 4JI2Q 3E6ZX 1F9SA 2KENA 3CCSA 4A3JB 4EQ5A 4UPAA 1PFSA 2F0NA 2HQEA 5J3BA 3CCUA 3I4MB 1QE6A 3FPUB 2C35B 4ILWA 5IT9c 2KBNA 5ELDA 3WOEA 5LMUQ 3TC5A 2K4KA 1IBKL 3J81j 2NTTA 1Y8OB 3AFQA 1VQJA 1HTPA 3CPWA 3HOXH 2K5DA 3QOLA 5J22A 4HSPA 1XPOA 1HUMA 2RSNA 1CI3M 1STAA 1VQNA 1D1IA 4K6DA 1XMQQ 4NDXA 3GTOH 2EJMA 3L4HA 1G91A 2B39A 3E5SA 5E7NA 1G6PA 2GN5A 1EYDA 5C0XH 1TR8A 3VDYA 4BY7H 2ALYB 4IALA 5EJWA 4IN3A 5IYBG 5FO7B 3PO3B 2HIXA 2LS01 5D3DA 3L9AX 4HCSA 2F1MA 4JVZA 3J81E 1WD1A 2L11A 3NXWA 3FPPA 4NXMQ 2A1AA 2MO1A 3R2IA 4KKTA 2UXDQ 5M5XH 4ZK9B 1S4ZA 1X3QA 3PUZA 3C2PA 1PRTF 1RODA 1SAPA 2SNSA 3VYUA 1R9TB 1SSOA 4ZRZA 4C3JG 2QKIC 3RZDH 5CBEE 2OTJA 5JEAG 3MXNB 3R3OA 4GN4B 4YHHL 2AUKA 3WDNA 5IYCH 1K3BC 1UE5A 2F0LA 4L5QA 2YU9B 4A0TA 1PRTB 1F2LA 1WYDA 2HDLA 2A69C 1BDOA 1SROA 4JI7L 4PNYA 1U9RA 2A19A 3BDOA 1YHBA 5KGUA 1J9OA 1X54A 1EWHA 1A63A 1SYFA 4IPGA 2EYFA 5ELEA 3TP8A 4B3TQ 2ZQSA 3JAMi 2ZTCA 1W3SA 1DJRD 4NKLA 5ELCA 1VQMA 3DUZA 1PINA 1EFWA 3OWFA 1T5EA 4AIMA 2XPBA 2KQ3A 1K8OA 1JQYD 4BWGB 2F52A 3KUPA 3SDZA 3R2TA 1X3EA 4LF4L 2DJFC 2N88A 1B9MA 4N8X1 4OX9L 3TZDA 3CQZH 4YWKA 4C2MH 3D6WA 3KAIA 3RLOA 4UDUC 4QL5A 3KCEA 2NVYH 3D8GA 1KRTA 1K83B 4CGYB 1YHQA 1LTGD 4A3IG 2M00A 1H9RA 1Q7YC 3MVVA 3PUVA 3OOBA 4Y7NB 3HGBA 4QIWB 1NY4A 1PZJD 2KUMA 4A3EB 1KHIA 5IP9G 2B2UA 1OXSC 1V43A 1GUGA 3HOZG 3K8AA 4CKBA 2UUAL 2WAEA 3BZDB 4DUYQ 1TY0A 4F87A 3PSIA 4MTNA 3KAFA 3AEVA 1JT8A 1FYCA 2B2UC 4MHEA 1K0SA 3UI2A 3TP7A 1HZAA 3TEHB 2QDLA 1Q8KA 4WJ3M 2XP3A 2MFIA 4OEMB 2F0EA 4QF4A 1PDQA 1SNMA 4X3UA 2CKZB 3T4AC 4C3HH 1KAWA 1MIUA 2DY8A 5IGGA 1LACA 3E9IA 1KDAA 1IBMQ 4IOAA 2EIFA 3K58A 5KNDA 4A3CH 4KY6A 1TK7A 1JWUD 5G3LF 2NWGA 3IKJA 1SFOB 3A8JE 2JA6H 1SJED 3M4PA 2OXPA 5LHY1 3D3RA 1X55A 5L37A 4MIUA 4BA1I 3HOYB 5C44H 3STBC 4B9XA 1I3QH 1SE8A 1KABA 4JOIA 2I5LX 2JEBI 1IBLQ 4IUTA 1OTCA 1CUKA 1ENFA 1LTLA 1TS5A 2Z8LA 5T1IA 4ID6A 4X64L 1WTOA 5IWAQ 1HJPA 3C3LA 3T13A 2EYOA 1PYSB 3BJUA 2ZXPA 3LX0A 2PZWA 2B3GA 3GDEA 2ZJQA 1G51A 1H9KA 2MPMA 1DZ1A 3OPOA 4ODGA 1LTRD 4JI4L 1HZCA 1J8IA 1FNVA 3J7ZC 3F2CA 2DNCA 1ASZA 1VQDA 3F2DA 1ICFB 1STEA 3LKXA 2JXWA 2VY3A 3ER0A 3PF5A 4JI5Q 4H44C 1YNNC 4IOCA 2WAQE 4MTKA 1XYIA 4X66Q 4HJ9A 4K5VA 1WTWA 1N33Q 2B2TA 1FJGQ 1UNSA 2XRSD 3CD6A 3T1YQ 3H0GG 3F2BA 1JJGA 5M3FB 1Q46A 1ML0D 2WKCA 3PQHA 1O7YA 4JI8Q 4GKKL 1NSNS 4BY1G 4DV3L 3OYYA 1YNJC 4P72A 1K9MC 2AQ1B 3BDCA 5K5PA 1II3A 3GV3A 4A0UA 4DUZL 1QB5D 4EGVA 1VF7A 3E3XA 2LY7A 4X62Q 1O7IA 2F3IA 1RDPD 1JB7A 1WTRA 2CH4A 2A8VA 3W1GA 3S15H 3NE5B 1JJCB 3CCJA 4A3JG 1N34Q 3RMHA 2F0OA 4FF4A 4IFDG 1E3PA 3OMGA 2HT1A 1KLUD 2F0WA 3I4MG 2F21A 1V1OA 2VNUD 2G5DA 1I4RA 2JA5H 1VS0A 4DK0A 3T1HQ 5CV9A 4Z9CB 3CP0A 3J80c 5DM63 2NVQH 1HFNA 5I9OA 3KLRA 1JORA 1DD2A 1S5DD 5E1FA 5EQ0A 1ZCNA 3S14B 2QRVA 2KOLA 1UE6A 1JE4A 4LF7Q 2Z9HA 4KJNA 4JBKA 1NMVA 1B7YB 1S5CD 1K8MA 1B70B 3WH0A 3GP7A 3PO3G 2Q2UA 1PLFA 1ESFA 1IHZA 5C3EB 1Q12A 3Q0AA 2PQAB 3GTMH 2VS1A 2RDGA 5FLXc 1RIPA 1Q3LA 1B3AA 3HEJA 4A76A 1PTOH 3G6JB 4LF8L 3HOXG 3MQHA 1Q8IA 2JMFA 3A5UA 1SNDA 4EQOA 2ZAJA 5AHTA 1K28A 3S2HH 1MJEA 2YYZA 3KF6B 4HJ7A 3S1MB 4RGNA 2JSOA 3OOCA 1F77A 2MHVA 2A6HC 4BY7G 3M7NA 1DOMA 3CPFA 1QVCA 4P74A 3A7LA 3BYTB 3HKZB 1H95A 1RHPA 4CJ1B 5E66A 2L15A 3D4RA 5IYBH 4DR6L 1A15A 2Q8RE 4ALPA 1D2BA 3CRKC 4X65Q 1TT2A 1KRSA 2ICIA 2NB0A 1LABA 1YITA 4E5RA 1CSPA 1V1QA 3KF8A 4Q0FA 3OIPA 4K0KQ 1KC8C 3OW2A 3LWEA 3ULPA 1BR9A 1W2BA 1NR2A 1PFNA 5D3IB 2F0DA 4XYQA 1Y1WH 1JMCA 1IYVA 2DJGC 2RVLA 4EQNA 2L4NA 1TWAB 3I90A 4C3JH 3E0EA 5JEAH 1HA6A 4XXEA 3MXGA 5KIXA 1JOKA 3K5LA 4KKUA 5A35A 4RWSC 1JMQA 2CQOA 5I9PA 3L2PA 1E24A 4RHRA 2RHQB 1MSGA 5IGEA 3KJPA 4HIKA 4F7XA 1A3UA 4ZAIA 3BZCA 2Q2HA 5AFWA 5EAYA 5FLMH 1AEXA 3GTKB 2WB1B 2ZR4A 1BQQT 2AQ2B 4RHSA 2PQEA 3WWVA 2NZHA 2F0QA 2KCNA 4LF6L 2RF4A 4FVMA 4R9WA 2I07B 4G7HC 1LTID 3TREA 4DKAC 5LMNQ 2UUCL 3P20A 4DV6L 4QQBX 4DV5L 4ABNA 5EBDA 2F4VL 3CMEA 4PZ6A 3E9HA 2PZUA 1G291 3RN5A 3UE1A 3ZYYX 3MQGA 1CK1A 2LFNA 1QNKA 2D62A 1K3RA 3NWSA 4LUOA 3VR6A 3GTLB 5JOBA 2IWHA 4B9WA 4U85A 4HIOA 4A3IH 4OO1G 1I6VC 1TIID 4DV7L 2CWPA 4LFCQ 1C8CA 1LYLA 5CV6A 1EY4A 1J5EL 5C4JB 3L0OA 5IP9H 3L7ZC 1WFQA 3HOYG 4PZ8A 4CJ2C 1TWGH 2HCIA 2F0KA 3HOZH 1EG4A 2QGQA 3BYYB 2YSBA 3I4NH 2JXMB 3T16A 4C3HG 5JVG3 1BCPD 1KAAA 3EN2A 4EQPA 4E6IA 2UXCL 1Q86C 2B2YA 2E2HH 1S3OA 4K8JA 1I94L 4DV0L 3N52A 2K14A 3IFDA 3ODKA 4JW0A 4WORA 1HNWL 3OWEB 4EVOA 2N8NA 4KLKA 1D1KA 2WP8J 1CQFA 4JC0A 1XTDA 4FF1A 2WAQB 1IW7C 3U4ZA 2B2WA 5DNFA 2F0TA 4DAYB 4L5RC 5LL6S 5EKIA 3ITPA 1GKHA 4KK7A 3ERSX 1D5ZC 2OWOA 4RMFA 4DV4Q 3Q24A 1TWCH 4KHVA 2YAJB 4U673 2ENBA 4JI6L 2K5VA 1HNXQ 3F1ZA 3AFPA 1STBA 1EIYB 3SK4A 3KBGA 1GHKA 2IPKD 2C9OA 3DWQA 3T56B 1VMPA 1FVIA 4A3GH 1SNQA 3RZOH 3VR2A 2UU9L 1MD2D 2MNAA 2XP9A 3S1NH 5EKLA 1PA6A 1TWHH 3K59A 3H6MA 4WJ4A 4GNXB 2LMCB 4P2CB 2MJ8A 5FO8B 3UDXA 1RL2A 1G2SA 1LM0A 2GVAA 5D14A 4A3DH 4O42A 5C0XJ 2RHSB 3I91A 4LF5L 3GTGB 3DWPA 4BY1H 3PO2B 1DXMA 3O13A 1DM0B 5JJIA 1EY0A 4KI0A 4PG3A 1K8GA 5CMDA 1PH8A 2XIWA 4HTHA 1ZEQX 2AKWB 1WR7A 5C4XG 3KOJA 1V1PA 1U4LA 4GOPA 1EIGA 1DGSA 2JX8A 1WMVA 3M3YB 1Q1EA 3R93A 3R8BA 2C5CA 4A3JH 1Z7TA 4IZ8A 1HR0W 3W5OA 3KAHA 4IFDH 1IXRA 2DJYA 4R4IA 1LUZA 1BXTA 3I4MH 4Y52H 4GOPC 1B53A 1TR5A 3I55A 1NTGA 1SYGA 1JC7A 3MCBA 2KHJA 2HQLA 1BF4A 4DV1Q 2F4IA 5AJ3L 1ILQA 1GJXA 4C3IB 1C48A 4YY3L 3KDFA 4B3RL 4K2LA 1ONLA 4JI3Q 2G9HD 4RCNA 3KK7A 2O5JC 4DF7A 3K57A 3HG9A 4DR1Q 4GNXC 5M3MB 1G2TA 4B3SL 1PFMA 2MO0A 2DNEA 1PZID 3GTPB 3PO3H 1VQ6A 1MKHA 3OMCA 1CFMA 1T5XD 3NTPA 4KJOA 2UUBQ 2O2LD 3J80L 4BBSB 4ZKCB 1TWFB 3PQIA 3TDBA 4DR7Q 4QUCA 3VR4A 2KJXA 5JJKA 1M8AA 4I7ZC 5KRUA 5JJZA 4L6TB 4C1NI 3FP9A 1F8AB 3SK8A 2NVXB 3URYA 2F0VA 1U4RA 3OTOL 1PTOD 1R9TH 1STHA 4LF4Q 2R93B 1KLGD 2ID0A 3KAGA 2IJ0A 2SEBD 4OWXB 3M7GA 4G7ZC 3A0JA 1L0XB 2ZXOA 4PMCA 5IOCA 2EYJA 2F03A 4XQQA 1FNWA 2YU9H 2QEJC 1BBXC 1Y1VB 1IL2A 1S5ED 2H1EA 1OXXK 3FKIB 3NBHA 4CKCA 5FLXL 1EQRA 1SE2A 1VF5C 3SVMA 3S17B 2UUAQ 3I7FA 4MZ9A 2BA1A 4DR2L 3S1RB 1TVXA 1WTXA 5FK9C 3N6RA 4CBVA 3Q22A 2RBMA 1G8ZD 4JCVE 4CJ0B 4REXA 2Z4IA 1Y1WG 5C4HA 2I0QA 1H9SA 4IJHA 4TSSA 2KXQA 1O78A 3TRZA 2PI2A 2ICEC 3KLSA 3U4VA 1Q81C 2LXJA 1X3GA 5I6WA 4JI0Q 4A4IA 3FHWA 4QB4A 4HR7B 1D8LA 4KY7A 4XDXA 3MWYW 2HD3A 3BZKA 2Y0SB 3HOUB 1EOTA 1K83H 1P8LA 3HKZE 2PMZB 5IT9E 5FLMG 4JG2A 4YCVA 3MTSA 2XP8A 1F9PA 3DHQA 4K8IA 4Y7NH 4A3MB 1PMRA 4NMZA 1O6WA 1VQCA 3LGJA 5BR8L 2ZTDA 1N32L 2N55A 2K04A 1X65A 3HOVB 3J7AV 1A2UA 3PIOA 1D7QA 1CKMA 3CMAA 3TP6A 1HNZL 3PF4A 4HN7A 4QCLA 2XWBB 2PYKA 1F9QA 1C0AA 1AFPA 2OT2A 5JAVA 5GAGC 2OF1A 5FO9B 2XVSA 2YTVA 3A7AB 1WCMB 2CW0D 4JI2L 1IL8A 2BE5C 4N8FA 2N78A 2EXDA 3BVGA 3J80i 1KD1C 4JI4Q 2YV5A 4NXNQ 5C4ZA 2M8IA 5LMUL 4K6LA 3S2DB 2WB1E 3S16B 2X6LA 4OO1H 4F88A 1SFOH 1ZKOA 1AP0A 2JK8A 3A8KE 1HTLD 4TKOB 1TS2A 2WAQG 3ICEA 3CHBD 1E2WA 1LTSD 4HSVA 3I4NG 2JA8B 3HOYH 4RH6A 1WTPA 4X6AH 2BDNA 3SHLA 1XMQL 3EBEA 2HDMA 4O1NA 2F0SA 5KNBA 4AH6A 4AYBE 1IKMA 3MXNA 3QR8A 3I70A 1LO5D 1PZKD 2ASBA 5HGTA 1TQOA 3A8IE 4GN3B 3S24A 4UY8C 5C6AA 3LKXB 5CV5A 1PH7A 4LFAQ 3A54A 2A6EC 4GN5A 1Q82C 2VZAA 4N9PA 4NXML 3RLNA 2KCCA 4ME3A 3PV0A 2SOBA 4OIKA 4DAVA 4GKJL 2UXDL 3IL8A 4ZCKA 5E5WA 1FD7D 4LFBQ 2EDGA 4LK1C 2KECA 1WOCA 1VQFA 2BA0A 4O0AA 3M4OH 4YIJA 4KKSA 3QWNA 1LV9A 2EYPA 3P1HA 5NUCA 4POFA 4DK6C 1QZHA 5A2QE 3X3MA 5M3FH 1Y8NB 4UP8A 2YTXA 2OCEA 1QILA 5C3WA 1LTAD 1BNZA 3VYRA 3PO2G 1BCPF 1BUVT 2EJFC 4KN7C 4R1JA 2XP5A 2WINB 4L5TA 1XTCD 4L8JA 1YHAA 4JOIC 2IX0A 2E2IB 4XQJA 1XPRA 3KADA 2K03A 2Z6BA 1YZ6A 2XNAC 3EROA 4A3GG 1KNAA 4B3TL 1CM9A 1GUWA 2VQFL 2XRQD 1CQVA 3G48A 1PH3A 3QG1A 3A55A 4L5SA 3VYTA 4FYDA 2VW9A 1TU2B 3KBXA 2R92B 3D6CA 3H3VH 3KABA 3SK5A 4A3DG 1BBWA 4FXKC 5H1SE 2XTIA 1VQ4A 1SN8A 4C3IG 3WOFA 2B2TC 3NPPA 3CCLA 2OQ0A 2A5HA 1LT3D 5BN5A 5CQ2A 3S14H 2EY1A 1JJ2A 1EEID 1F9RA 5E64A 1V8QA 1WTVA 5C0XI 5M3MG 3DM3A 1GO3E 1VQOA 2CHBD 2O4XA 4DR6Q 5JJLA 5C4XH 4DUYL 2EXZA 1TXYA 3NBIA 5C3EH 3FVQA 1QUQB 4IPDA 4BBRB 4BBSG 2IY5B 4RGTA 3RN2A 3HKSA 4X3KA 1STGA 1C4QA 2A69D 1VQ7A 3NWTA 4P73A 4HJ5A 1STNA 3UDGA 3DWAA 1IBML 4LW1A 1FL0A 2R93G 2A74C 2HHHQ 2XGTA 1UAPA 2PCFB 4PMWA 5DAUA 4ZQ3A 3GTQB 1BCPC 2FMMA 3NK9A 5EPKA 4A3BB 2B2VA 1PXUA 3S1MH 1Y1VG 5CV8A 1CKNA 2N49A 3KF8B 1I5HW 1XNRQ 1RTNA 2Z0SA 4JPBW 2E5LL 3MHBA 2TSSA 5M5YB 1I6HB 4DK1A 1IBLL 4JBJA 1A3VA 2ZQUA 1K9QA 1IYJB 3SGIA 3V96A 1VQPA 2VB3X 2L1BA 3UDIA 1L1OA 5IWAL 4IPCA 3DM1A 4GZYC 2OTLA 1PH5A 2UUCQ 4DAPA 1KTKA 3M9BA 3MXUA 5KYIA 2ZM6Q 3JAME 2CWAA 2B29A 4OONA 2NN6I 1EEFD 2E74C 1TWAH 3CKIB 2VUMB 4J15A 4DAMA 4C1NK 3C1EA 5M5WB 3J81L 1A6XA 2JP1A 1MHWC 4JI5L 3RLFA 2RKSA 4DR5Q 1A0IA 2Y0SG 3HOUG 1EQQA 2L4JA 4DV7Q 1SXTA 4X66L 1PRTD 1NCVA 4IURA 1N33L 2B63B 1J5EQ 2ITKA 5FKAC 2VQEQ 4A3MG 3T1YL 5COYA 3GTKH 1CZWA 3MC0B 4KY5A 1GHJA 2M9VA 1F2MA 1VQ8A 3PIO3 2E2JB 3JC66 4G57A 4PMBA 3HOVG 3RUZA 1MSHA 4CDEC 1ENCA 1WTHA 3IAYA 4DXGA 2AHOB 2DN8A 2IL8A 4AQYQ 2F3VA 4RAUC 1Z6HA 2RCNA 3K5MA 1ENAA 4J8QA 4B3ML 4X62L 1X3PA 4LF9L 1JWMD 3NTHA 2NVTH 4U84A 3SR1A 1WCMG 2F0IA 1YEZA 5CORA 3SK6A 4DR3Q 2EZVA 1N34L 1PV4A 4XIGS 4RCOA 4A93B 1EQTA 3F2UA 2QILA 1PYBA 2XWJB 4O2DA 4KMUC 3STBD 2JA9A 1HNWQ 1BOSA 4HIMA 1I4PA 2KA7A 4FF2A 3GTLH 1QVFA 5CR3A 4LJZC 2KEEA 3T1HL 3OIQA 4JV5L 5CBAE 1KXLA 2JJQA 4A3EG 1Y69U 4QIBA 2K52A 2NTSA 5CV7A 2PZTA 5C4JH 2I46A 2JA8G 2HIVA 3PUWA 4M1UB 4ZKBB 3HFZB 1ZYRC 1F2YA 4LAAA 3FDTA 4A3FB 4AYBB 5J39A 5DLQE 4CKEA 4IUVA 3KF6A 4U68A 3TQYA 3NENA 1SLJA 3DEOA 4WFN3 4DV2L 1WJJA 2Y0SE 4V0BA 2VB2X 2PMZE 1B1ZA 5EPJA 3ULLA 1ET6A 2BCOA 4UP7A 1CA5A 4FP5D 1B2TA 1YNJD 1EIFA 4BS9A 1DCZA 5IP7G 1DONA 4R4CA 1M4VA 3CC7A 4TVAB 2NN6G 3LE4A 3ERQA 3EQLC 2K5QA 3VA5A 3W3AA 5E65A 1DYQA 3A74A 1EY6A 2WV6D 2R61A 1UE7A 3MZ5A 5G3LD 2UXBQ 2PO4A 1YJWA 1PTOC 2J7ZA 3D4DA 4J1MA 2IHEA 1Z9FA 1EIHA 4IFDJ 1WTQA 1NJIC 2KVMA 3FSCA 5HGQA 2JA7B 3GTJB 4IUUA 3QJYA 4M8AA 2CCZA 2F0MA 4HCEA 2X69A 4BA2I 4H13C 4ME5A 1XNQL 2B2YC 5M9OA 3HOWB 4R4TA 4RKLA 1B50A 2ZQVA 3HS0C 4GLVB 2PNHA 2ZXRA 5JPNC 1MI2A 2Z6KA 4JYAQ 2AMCB 1X9NA 1UE1A 5LMNW 5M3FG 1BO0A 2MQHA 3U58A 1AW7A 1OXUA 1SYEA 4XQNA 2K5NA 2JEAI 3DMUA 2EOTA 1YIJA 3UE0A 1FNUA 4GOPB 1W6KA 2ATWA 2RSOA 3PUYA 1R4QB 3GTGH 3AB9A 2B2WC 3PO2H 2M3OW 2K7VA 2I5MX 2EYHA 3VYSA 1WI5A 2CQAA 1AN8A 3EVQA 2F0HA 3NTIA 3K5OA 4HMJA 3SXHA 1EY9A 1VCIA 3MCBB 4DN4M 2GVBA 3Q8DA 3M3YH 2Z4HA 3FRPB 2R6GA 4ZUIA 1GD7A 1IBKQ 5LMNL 1FGUA 1XMOL 4S3SA 2E2HB 3KDFB 3OSOA 3G7LA 2O5IC 1HHVA 5E62A 2A6HD 1Q90A 1QOHA 4CDCC 1I50B 3K81C 2L12A 1QCBD 2M8JA 1PVOA 3TSSA 4C3IH 5IYDG 3LNNA 3S9WA 1RCVD 4A3BG 2CW0C 1I4GA 2J0TD 2NZ1D 3MAQA 4LFCL 2DWVA 4DK3C 1EZ8A 2M2LA 3PUXA 5TSSA 2K05A 3X3NA 1AE2A 3RR5A 1OXTA 1PH9A 2J4XA 5M3MH 5C3EG 1XPUA 1CTMA 1X32A 3AYHB 5D65A 2MUYA 1EWIA 3V2TA 3GTPH 2BH2A 3EIVA 4FO2A 3C1FA 3S1QB 3ZJYC 2K32A 2V4DA 4MN3A 2QA4A 4BBSH 1TWFH 1WVLA 2BOSA 2DMVA 2R7ZB 3SE0A 4OIJA 1SYCA 2RDHA 1ICWA 4YHHQ 5IGCA 1EY8A 1GVPA 3VR3A 1N36L 2NVXH 2R3ZA 2L55A 2R93H 3NBHB 5C5MA 2VUMG 3K7AB 4KD4A 4RFBA 4JK1C 4OHJA 3G71A 1C7YA 4JI7Q 4GLAC 4ZUJA 4DGZA 1A2TA 3QB3A 1Y1VH 2K28A 2L0CA 1HR0L 4UAIA 1JWSD 3HKZG 4Q5VA 2B63G 3J81c 1U0LA 3H0GB 3FKIH 3I72A 4JI1L 2KCMA 5BR8Q 1X6OA 1H9SB 1EU4A 3S17H
chains in the Genus database with same CATH topology
3S1RH 4DNRB 4DV4L 2L5TA 1HNXL 5E3FA 1S5FD 1PH2A 4A3LH 2AQ3B 4YWLA 1VQ5A 1JCKB 3MA2B 4TRDA 2LSSA 3W1BA 2OEOA 1JR0D 4OX9Q 2NBFA 4DA2A 3BVZA 2F0UA 1NBWA 4A93G 3FS8A 1I4XA 4HMIA 1EFID 2A73B 2DY7A 3A5ZB 3HOUH 2EJGC 4JBWA 2WB1G 4J6HA 1XX8A 3NQTA 4A3KB 5I2XA 5F2DA 2YSGA 1JOQA 4A3MH 2XP6A 1GUOA 3TZUA 1EQVA 1FGBD 4OGQC 5ELBA 2OQKA 3EJIA 3HOVH 2K1BA 1EZ6A 1SE4A 4DFAA 1RP5A 1TS4A 1V9PA 2EYMA 4LUVA 1MBYA 4A3FG 4AYBG 4KHPL 4QUFA 5K36G 4C56C 2JE6I 4KTAA 1WCMH 1IW7D 1TKWB 4I65A 1SMYD 3D0FA 4QJFA 1KDCA 3V05A 3C46A 3RNUA 3HRZC 2QEXA 4HJ8A 4GKJQ 3U9OA 2EVBA 4PV1C 3K80C 1B8AA 5ISRA 1SMXA 3CW2C 3NP8A 3ND9A 3S2DH 1C9OA 3HOXB 3S16H 3FEWX 5KEEA 1QNUA 3U9SA 2H4OA 2F0PA 2IW3A 3D31A 3QO2A 4A3EH 1LT5D 4ZYSA 4DV1L 3TCZA 3K6OA 3QIAA 3F8TA 3GTOB 3HZXA 2KHSA 2NUCA 5HY6A 4YWMA 3TDQA 4YCUA 4IJLA 2JA8H 4BY7B 4X64Q 4JI3L 1B9NA 2QDBA 3Q23A 5HURA 4DR1L 3TMEA 1VQEA 3MXPA 2IHFA 4DR4L 4V190 3ND8A 4EX5A 5GQOA 1BBUA 1E2VA 3T53B 1NAPA 5M5XB 2E8GA 2VQFQ 4ULLA 2UUBL 1XJVA 2JA7G 1DOKA 4WRDA 3NEMA 2EYLA 3PIPA 2EPBA 4DR7L 5GROA 2A68D 4KD3A 2E75C 3RZDB 4K2KA 5J1ZA 1YNXA 1FR3A 3L3OC 3HOWG 1WD0A 4HAEA 4RG1A 1ZXTA 2PNRC 1CZGA 5IP7H 1QZGA 2NN6H 2RQXA 1E0BA 1AZQA 1A8VA 4GKKQ 3CCMA 3BU2A 4DV3Q 2HCCA 1PYWD 1JOOA 2RA4A 1EL0A 3G4SA 1B44D 4LMQD 4APVA 4DUZQ 1EY5A 3M4YA 2G9DA 3CCRA 3CAMA 2VL6A 5EPLA 4OWWB 2I5HA 2E2IH 1NR4A 2VXWA 2NZOA 2K6AA 5CV4A 3PGZA 1PRTC 2AWNA 2JYOA 2D0PA 2HUGA 2K33A 4POGA 2E2DC 4IFDI 2K5HA 3CF5A 4NW2A 4DNTB 2ES2A 3CQZB 4H7BA 1FLCA 4KHZA 4C2MB 1Z47A 3M85A 2NVYB 2DUDA 1YW5A 1Q1BA 2R92H 1KIXA 1ESRA 5I4DA 4JI0L 2KCTA 2ZJRA 1RJTA 2Y8NB 2WADA 3CCQA 3I73A 5I2YA 4IUNA 4P71A 1YJNA 4DPGA 2JQOA 2RE3A 4KN4C 1VQIA 3I2ZA 3ULJA 5C3XA 1SE3A 1CT1D 5T1GA 1HCZA 2E5LQ 2ZJPA 4G7OC 1RTOA 1ET9A 3CCEA 1KNEA 1BCPB 3A56A 3EA6A 3BVMA 4IUPA 2BH8A 5CGKA 1SYDA 1IZ6A 1NMFA 3K0YA 3OW7A 3P75A 3Q6SA 4C3HB 1GUTA 4BBRH 1HZBA 1CSQA 4FDBA 4HIDA 4R4QA 5IGBA 4LF8Q 1SYBA 1HUNA 2R7ZG 1CKOA 3BG3A 1OXVA 3K5NA 2EQSA 5FJ8G 1CKNB 1H9JA 1QG7A 1VQ9A 3FMCA 4NXNL 4KV6A 2JA6B 3E0JA 5CC4A 1P16A 1PH4A 3KFUA 1I4QA 4NB3A 3G6EA 4DNIA 1SR3A 5IYDH 3GTQH 3M4OB 5IODA 1STYA 1PHJA 4BXXG 1QWYA 4A3BH 2SNMA 3H91A 3CXCA 2EY2A 5C44B 1I3QB 4XT1B 1IYUA 1L1OB 2Q8IB 2Q2TA 1PFBA 4YCWA 2IX3A 5ELOA 2XN9C 2TMPA 2D0OA 1G6ZA 2Q8TA 4HJAA 2WIIB 5M5YH 3KJOA 5EGTA 1I6HH 1D6EC 2B8FA 5JEAJ 4B3MQ 2DK1A 4LF9Q 5JPMC 1PH1A 1O80A 3JAMc 3TP5A 4LFAL 5FOBB 1S40A 2F0FA 1EYCA 1JE5A 2NYZD 1LT4D 4OXPA 5GAHC 1HRJA 3P7JA 3I4OA 4H0LC 2VUMH 1EYAA 1HXYD 1AH9A 1K0RA 5M5WH 4LFBL 4DU9A 4TQUS 2CVRA 3TS0A 1GOZA 3IRBA 2YSHA 4JV5Q 3FKIG 1YJ9A 5ELNA 4R4OA 1X56A 4FXDA 2E76C 2B2VC 2B63H 5E4WC 4A3KG 4PQXA 3NHHA 4LF6Q 1NUCA 2BE5D 1HZ9A 3I56A 1EWCA 1CHQD 4RKBA 2E2JH 2K5WA 3I4LA 1UWVA 3QOJA 2AUJD 1L0YB 4A3LG 1IKLA 1R4PB 3BS1A 4MNOA 5DM73 3KLWA 4DV6Q 4DV5Q 3S15B 2LAJA 5C4XB 5BN4A 2F4VQ 2XPAA 1E1TA 4FF3A 3T51B 1A62A 3GV6A 1L1OC 3NUCA 3IFTA 1Y14B 4DV2Q 4R8IA 3HP3A 2JA5B 3B6YA 1E2ZA 3NELA 5U47A 4A93H 2NVQB 1CA6A 1HQRD 4OO1I 1L2FA 2JV4A 1QUQA 2F3WA 1FJGL 5LL6X 2X6GA 1SDFA 1AE3A 1EYGA 3J80E 2PI2E 2LKVA 1HFGA 4JI8L 1M90C 1UEBA 4X3TA 2K01A 1KL9A 2A6ED 1EU3A 3GQBA 1E1OA 1E7ZA 1YI2A 2WFWA 1W6JA 5C0XG 2EZ5W 1XXGA 1TY2A 3EFXD 3ONAB 2DGYA 3D4WA 1VQBA 1U5KA 1PTOF 5IT9L 3H3VC 2UXCQ 4A3FH 3MEFA 3MFYA 2D5DA 4G4KA 1I94Q 3GTMB 3H94A 1RF2D 5K36H 4DV0Q 3CC4A 4XTCS 1D5MC 2Q2IA 3PIP3 4HEDA 1OO9B 1L0WA 1VQKA 1XNQQ 1SJHD 1QVGA 1PTOB 4UP9A 5FLXE 2ZR6A 4GLXA 3NQIA 1X3FA 2PQAA 3VA7A 2PPBC 4QMGA 2Z1CA 1JICA 3MFGA 1PH6A 1HQMC 5IYCG 3S2HB 2KEDA 2D9UA 4LUZA 2IT1A 2CFMA 2ZT9C 3W2DA 2HHHL 1GUSA 1ASYA 4IQZA 3PCOB 4FXGC 2BDOA 1HA5A 2XSCA 4QY7A 4LF7L 1EY7A 2YTYA 1RD9D 3CRLC 4JI6Q 4JBMA 5CYUA 1XNRL 1YNND 1J6QA 2MGSA 1BKBA 2IX1A 3PMFA 5IE8A 2KHIA 4OL7A 2UU9Q 2R7FA 5E4XA 1VDZA 2JA7H 1O7LA 3I3CA 1S5BD 3GTJH 1XWEA 4ZLTF 4U86A 1UUPA 1Y1WB 5C5LA 2NVTB 1XMOQ 2DK7A 5EKKA 4C3JB 2F0JA 3LWUA 3CU7A 5IGFA 5GAEC 3HOWH 1K8AC 2WACA 2ZM6L 3H3VI 2YSFA 5BN3A 4LWCA 3J81i 3J7A5 1UEAB 4L63B 1VQHA 5IIFA 1HH2P 1LTTD 1GUNA 4LF5Q 3TBIB 2R7DA 4DR5L 3K7UC 3KYHC 2XP7A 1T9HA 2ZQTA 2FHTA 4QGUA 4RGOS 3U50C 5GADC 2L9HA 2VQEL 2AWOA 4X65L 3M4QA 1YBYA 4LNQA 1SNCA 4WJWA 1VQLA 2V1CC 2MP1A 1TS3A 1I5FA 1F2ZA 3DEPA 4K0KL 2F0GA 1KDBA 5A2QL 2D2CC 4AQYL 1O7ZA 1A3TA 1CHPD 3AQQA 1I4HA 1K9RA 3H09A 5I6YA 3MEHA 1Y8PB 2PW5A 2R92G 4PZ7A 2RDFA 4RGMA 1NE3A 4A3CG 5KNCA 5AJ3Q 1N36Q 4DR3L 1VMCA 4YY3Q 1I50H 1K73C 4A3IB 1KQSA 2JA6G 1V1PB 4B3RQ 3NSWA 4QIWE 4RA8A 1ILPA 4XYOA 2K50A 1D5XC 1SRUA 3GD7A 2K75A 3VR5A 2Z6KC 1H9MA 3SEBA 1QJOA 1VQAA 4IPHA 5C44G 4B3SQ 1HR0Q 1TWGB 3HOZB 1SMYC 4JI1Q 2FFKB 2FJ2A 3J7YW 3I4NB 4F8MA 2FXQA 3CC2A 5EBCA 1VQGA 3CNGA 1LLRD 3CCVA 2N3SA 4BBRG 1MGSA 4CHTB 1SNPA 4A75A 4IUQA 3S1QH 3H15A 5ELFA 3DXJC 1MJCA 2B8GA 2QF7A 3OTOQ 2R7ZH 4X3SA 2SDFA 2EY5A 5FJ8H 3UDFA 1EUJA 3BDLA 3GO5A 3K7AH 3AU7A 1E22A 5DEHA 1M1KC 4B08A 1DOLA 3NTKA 4IO9A 4K5WA 4BXXH 5IGDA 2GA4B 1GXDC 4K14A 2PW7A 3KLSX 4DR2Q 1N9WA 1U4PA 2A68C 3H0GH 1TWCB 1SNOA 2FINB 5IY0A 3TN2A 1AZPA 1S72A 2UXBL 3DLLA 5JVH3 4OWTB 4DAYA 4KHPQ 2FMCA 2H5XA 4A3GB 3RZOB 4R8NA 3RD4A 1RKNA 4N9TA 1B4OA 3TS2A 3S1NB 2LXKA 3AMUA 4DXFA 1TWHB 1BVSA 1HPCA 2JA5G 1LT6D 1EOVA 2QCPX 5KYLA 4NP5A 1YVCA 4H02A 2EY6A 1N8RC 1ZYRD 2EE1A 4A3DB 3OHXC 1GM5A 1LTBD 4P75A 4JYAL 1SEBD 1U4MA 1N32Q 3FSBA 1JB3A 3J7AF 4BY1B 2ZR5A 4GNXA 2E45A 4A3KH 4NPSA 3JAML 2Q5AA 2YSIA 4GS3A 1HNZQ 1NMGA 2XP4A 2WKDA 3K0XA 4XT3B 1EG3A 2MDIA 4K5XA 2ZTEA 4FNFA 1SBBB 3I8ZA 4DR4Q 4JI2Q 3E6ZX 1F9SA 2KENA 3CCSA 4A3JB 4EQ5A 4UPAA 1PFSA 2F0NA 2HQEA 5J3BA 3CCUA 3I4MB 1QE6A 3FPUB 2C35B 4ILWA 5IT9c 2KBNA 5ELDA 3WOEA 5LMUQ 3TC5A 2K4KA 1IBKL 3J81j 2NTTA 1Y8OB 3AFQA 1VQJA 1HTPA 3CPWA 3HOXH 2K5DA 3QOLA 5J22A 4HSPA 1XPOA 1HUMA 2RSNA 1CI3M 1STAA 1VQNA 1D1IA 4K6DA 1XMQQ 4NDXA 3GTOH 2EJMA 3L4HA 1G91A 2B39A 3E5SA 5E7NA 1G6PA 2GN5A 1EYDA 5C0XH 1TR8A 3VDYA 4BY7H 2ALYB 4IALA 5EJWA 4IN3A 5IYBG 5FO7B 3PO3B 5D3DA 2LS01 2HIXA 3L9AX 4HCSA 2F1MA 3J81E 1WD1A 2L11A 3NXWA 3FPPA 4NXMQ 2A1AA 2MO1A 3R2IA 4KKTA 2UXDQ 5M5XH 4ZK9B 1S4ZA 1X3QA 3PUZA 3C2PA 1PRTF 1RODA 1SAPA 2SNSA 3VYUA 1R9TB 1SSOA 4ZRZA 4C3JG 2QKIC 3RZDH 5CBEE 2OTJA 5JEAG 3R3OA 3MXNB 4GN4B 4YHHL 2AUKA 3WDNA 5IYCH 1UE5A 2F0LA 4L5QA 2YU9B 4A0TA 1PRTB 1F2LA 1WYDA 2HDLA 2A69C 1BDOA 1SROA 4JI7L 4PNYA 1U9RA 3BDOA 2A19A 1YHBA 5KGUA 1J9OA 1X54A 1EWHA 1A63A 1SYFA 4IPGA 2EYFA 5ELEA 3TP8A 4B3TQ 2ZQSA 3JAMi 2ZTCA 1W3SA 1DJRD 4NKLA 5ELCA 1VQMA 3DUZA 1PINA 1EFWA 3OWFA 1T5EA 4AIMA 2XPBA 2KQ3A 1K8OA 1JQYD 4BWGB 2F52A 3KUPA 3SDZA 3R2TA 1X3EA 4LF4L 2N88A 1B9MA 4OX9L 3TZDA 3CQZH 4YWKA 4C2MH 3D6WA 3KAIA 3RLOA 4UDUC 4QL5A 3KCEA 2NVYH 3D8GA 4CGYB 1K83B 1KRTA 1YHQA 1LTGD 4A3IG 2M00A 1H9RA 1Q7YC 3MVVA 3PUVA 3OOBA 4Y7NB 3HGBA 4QIWB 1NY4A 1PZJD 2KUMA 4A3EB 1KHIA 5IP9G 2B2UA 1OXSC 1V43A 1GUGA 3HOZG 3K8AA 4CKBA 2UUAL 2WAEA 3BZDB 4DUYQ 1TY0A 4F87A 3PSIA 4MTNA 3KAFA 3AEVA 1JT8A 1FYCA 2B2UC 4MHEA 3UI2A 3TP7A 1HZAA 3TEHB 1Q8KA 4WJ3M 2XP3A 2MFIA 2F0EA 4QF4A 1PDQA 1SNMA 4X3UA 3T4AC 2CKZB 5IGGA 1KAWA 2DY8A 1MIUA 4C3HH 1LACA 3E9IA 1KDAA 1IBMQ 4IOAA 3K58A 2EIFA 5KNDA 4A3CH 4KY6A 1TK7A 1JWUD 5G3LF 2NWGA 3IKJA 1SFOB 3A8JE 2JA6H 1SJED 3M4PA 2OXPA 5LHY1 3D3RA 1X55A 4MIUA 4BA1I 3HOYB 5C44H 3STBC 4B9XA 1I3QH 1SE8A 1KABA 4JOIA 2I5LX 2JEBI 1IBLQ 4IUTA 1OTCA 1CUKA 1ENFA 1TS5A 2Z8LA 1LTLA 5T1IA 4ID6A 4X64L 1WTOA 3C3LA 1HJPA 5IWAQ 3T13A 2EYOA 1PYSB 3BJUA 2ZXPA 3LX0A 2PZWA 2B3GA 3GDEA 2ZJQA 2MPMA 1H9KA 1DZ1A 1G51A 3OPOA 4ODGA 1LTRD 4JI4L 1J8IA 1HZCA 1FNVA 3J7ZC 3F2CA 2DNCA 1ASZA 1VQDA 3F2DA 1STEA 3LKXA 2JXWA 2VY3A 3ER0A 3PF5A 4JI5Q 4H44C 1YNNC 4IOCA 2WAQE 1XYIA 4X66Q 4HJ9A 4K5VA 1WTWA 1N33Q 2B2TA 1FJGQ 1UNSA 2XRSD 3CD6A 3T1YQ 3H0GG 3F2BA 1JJGA 5M3FB 1Q46A 1ML0D 2WKCA 3PQHA 1O7YA 4JI8Q 4GKKL 1NSNS 4BY1G 4DV3L 3OYYA 1YNJC 4P72A 1K9MC 2AQ1B 3BDCA 5K5PA 1II3A 3GV3A 4A0UA 4DUZL 1QB5D 4EGVA 1VF7A 2LY7A 4X62Q 1O7IA 2F3IA 1RDPD 1JB7A 1WTRA 2A8VA 3W1GA 3S15H 3NE5B 1JJCB 3CCJA 4A3JG 1N34Q 3RMHA 2F0OA 4FF4A 4IFDG 1E3PA 3OMGA 2HT1A 1KLUD 2F0WA 3I4MG 2F21A 1V1OA 2VNUD 1I4RA 2JA5H 4DK0A 1VS0A 3T1HQ 5CV9A 4Z9CB 3CP0A 3J80c 5DM63 2NVQH 1HFNA 5I9OA 3KLRA 1JORA 1DD2A 1S5DD 5E1FA 5EQ0A 1ZCNA 3S14B 2QRVA 2KOLA 1UE6A 1JE4A 4LF7Q 4KJNA 4JBKA 1NMVA 1B7YB 1S5CD 1K8MA 1B70B 3WH0A 3GP7A 3PO3G 2Q2UA 1PLFA 1ESFA 1IHZA 5C3EB 1Q12A 3Q0AA 2PQAB 3GTMH 2VS1A 2RDGA 5FLXc 1RIPA 1Q3LA 1B3AA 3HEJA 4A76A 1PTOH 3G6JB 4LF8L 3HOXG 3MQHA 1Q8IA 2JMFA 3A5UA 1SNDA 4EQOA 2ZAJA 5AHTA 3S2HH 1MJEA 2YYZA 3KF6B 4HJ7A 3S1MB 4RGNA 2JSOA 3OOCA 1F77A 2MHVA 2A6HC 4BY7G 3M7NA 1DOMA 3CPFA 1QVCA 4P74A 3A7LA 3BYTB 3HKZB 1H95A 1RHPA 4CJ1B 5E66A 2L15A 3D4RA 5IYBH 4DR6L 1A15A 2Q8RE 4ALPA 1D2BA 3CRKC 4X65Q 1TT2A 1KRSA 2ICIA 2NB0A 1LABA 1YITA 4E5RA 4Q0FA 1CSPA 3KF8A 1V1QA 3OIPA 4K0KQ 1KC8C 3OW2A 3LWEA 3ULPA 1BR9A 1W2BA 1NR2A 1PFNA 5D3IB 2F0DA 4XYQA 1Y1WH 1JMCA 1IYVA 2RVLA 4EQNA 2L4NA 1TWAB 3I90A 4C3JH 3E0EA 5JEAH 1HA6A 4XXEA 3MXGA 5KIXA 1JOKA 3K5LA 4KKUA 5A35A 4RWSC 1JMQA 2CQOA 5I9PA 3L2PA 4RHRA 1E24A 2RHQB 1MSGA 5IGEA 3KJPA 4HIKA 4F7XA 1A3UA 4ZAIA 3BZCA 2Q2HA 5AFWA 5EAYA 3GTKB 1AEXA 5FLMH 2WB1B 2ZR4A 1BQQT 2AQ2B 4RHSA 2PQEA 3WWVA 2NZHA 2F0QA 2KCNA 4LF6L 2RF4A 4FVMA 4R9WA 2I07B 4G7HC 1LTID 3TREA 4DKAC 5LMNQ 2UUCL 3P20A 4DV6L 4QQBX 4DV5L 4ABNA 5EBDA 2F4VL 3CMEA 4PZ6A 3E9HA 2PZUA 1G291 3RN5A 3UE1A 3ZYYX 3MQGA 1CK1A 2LFNA 1QNKA 2D62A 1K3RA 3NWSA 4LUOA 3VR6A 3GTLB 5JOBA 2IWHA 4B9WA 4U85A 4OO1G 4HIOA 4A3IH 1I6VC 1TIID 4DV7L 2CWPA 4LFCQ 1C8CA 5CV6A 1LYLA 1EY4A 1J5EL 5C4JB 3L0OA 5IP9H 3L7ZC 1WFQA 3HOYG 4PZ8A 4CJ2C 1TWGH 2HCIA 2F0KA 3HOZH 1EG4A 2QGQA 3BYYB 2YSBA 3I4NH 2JXMB 3T16A 4C3HG 5JVG3 1BCPD 1KAAA 3EN2A 4EQPA 4E6IA 2UXCL 1Q86C 2B2YA 2E2HH 1S3OA 4K8JA 1I94L 4DV0L 3N52A 2K14A 3IFDA 3ODKA 4WORA 1HNWL 3OWEB 4EVOA 2N8NA 4KLKA 1D1KA 2WP8J 1CQFA 4JC0A 1XTDA 4FF1A 2WAQB 1IW7C 3U4ZA 2B2WA 5DNFA 2F0TA 4DAYB 4L5RC 5LL6S 5EKIA 3ITPA 1GKHA 4KK7A 3ERSX 1D5ZC 2OWOA 4RMFA 4DV4Q 3Q24A 1TWCH 4KHVA 2YAJB 4U673 2ENBA 4JI6L 2K5VA 1HNXQ 3F1ZA 3AFPA 1STBA 1EIYB 3SK4A 3KBGA 1GHKA 2IPKD 3T56B 2C9OA 3DWQA 1VMPA 1FVIA 4A3GH 1SNQA 3RZOH 3VR2A 2UU9L 1MD2D 2MNAA 2XP9A 3S1NH 5EKLA 1PA6A 1TWHH 3K59A 3H6MA 4WJ4A 4GNXB 2LMCB 4P2CB 2MJ8A 5FO8B 3UDXA 1RL2A 1G2SA 5D14A 1LM0A 2GVAA 4A3DH 4O42A 5C0XJ 2RHSB 3I91A 4LF5L 3GTGB 3DWPA 3PO2B 4BY1H 1DXMA 3O13A 1DM0B 5JJIA 1EY0A 4KI0A 4PG3A 1K8GA 5CMDA 1PH8A 2XIWA 4HTHA 1ZEQX 2AKWB 1WR7A 5C4XG 3KOJA 1V1PA 1U4LA 4GOPA 1EIGA 1DGSA 2JX8A 1WMVA 3M3YB 1Q1EA 3R93A 3R8BA 2C5CA 4A3JH 1Z7TA 4IZ8A 1HR0W 3W5OA 3KAHA 4IFDH 1IXRA 2DJYA 4R4IA 1LUZA 1BXTA 3I4MH 4Y52H 4GOPC 1B53A 1TR5A 3I55A 1NTGA 1SYGA 1JC7A 3MCBA 2KHJA 2HQLA 1BF4A 4DV1Q 2F4IA 5AJ3L 1ILQA 1GJXA 4C3IB 1C48A 4YY3L 3KDFA 4B3RL 4K2LA 1ONLA 4JI3Q 2G9HD 4RCNA 3KK7A 2O5JC 4DF7A 3K57A 3HG9A 4DR1Q 4GNXC 5M3MB 1G2TA 4B3SL 1PFMA 2MO0A 2DNEA 1PZID 3GTPB 3PO3H 1VQ6A 3OMCA 1MKHA 1CFMA 1T5XD 3NTPA 4KJOA 2UUBQ 2O2LD 3J80L 4BBSB 4ZKCB 1TWFB 3TDBA 4DR7Q 4QUCA 3VR4A 2KJXA 5JJKA 1M8AA 4I7ZC 5KRUA 5JJZA 4L6TB 4C1NI 3SK8A 1F8AB 3FP9A 2NVXB 3URYA 2F0VA 1U4RA 3OTOL 1PTOD 1R9TH 1STHA 2R93B 4LF4Q 1KLGD 2ID0A 3KAGA 2IJ0A 2SEBD 4G7ZC 3M7GA 4OWXB 3A0JA 1L0XB 2ZXOA 4PMCA 5IOCA 2EYJA 2F03A 4XQQA 1FNWA 2YU9H 2QEJC 1BBXC 1Y1VB 1IL2A 1S5ED 2H1EA 1OXXK 3FKIB 3NBHA 4CKCA 5FLXL 1EQRA 1SE2A 1VF5C 3SVMA 3S17B 2UUAQ 3I7FA 4MZ9A 2BA1A 4DR2L 3S1RB 1TVXA 1WTXA 5FK9C 3N6RA 4CBVA 3Q22A 2RBMA 1G8ZD 4JCVE 4CJ0B 4REXA 2Z4IA 1Y1WG 5C4HA 2I0QA 1H9SA 4IJHA 4TSSA 2KXQA 1O78A 3TRZA 2PI2A 2ICEC 3KLSA 3U4VA 1Q81C 2LXJA 1X3GA 5I6WA 4JI0Q 4A4IA 3FHWA 4QB4A 4HR7B 1D8LA 4KY7A 4XDXA 3MWYW 3BZKA 2Y0SB 3HOUB 1EOTA 5IT9E 1K83H 1P8LA 2PMZB 3HKZE 5FLMG 4JG2A 4YCVA 3MTSA 2XP8A 1F9PA 4K8IA 3DHQA 4Y7NH 4A3MB 1PMRA 4NMZA 1O6WA 1VQCA 3LGJA 5BR8L 2ZTDA 1N32L 2N55A 2K04A 1X65A 3HOVB 3J7AV 1A2UA 3PIOA 1D7QA 1CKMA 3CMAA 3TP6A 1HNZL 3PF4A 4HN7A 4QCLA 2XWBB 2PYKA 1F9QA 1AFPA 1C0AA 2OT2A 5JAVA 5GAGC 2OF1A 5FO9B 2XVSA 2YTVA 3A7AB 1WCMB 2CW0D 4JI2L 1IL8A 2BE5C 2N78A 2EXDA 3BVGA 3J80i 1KD1C 4JI4Q 2YV5A 4NXNQ 5C4ZA 2M8IA 5LMUL 4K6LA 3S2DB 3S16B 2WB1E 2X6LA 4OO1H 4F88A 1SFOH 1ZKOA 1AP0A 3A8KE 2JK8A 1HTLD 4TKOB 1TS2A 2WAQG 3ICEA 3CHBD 1E2WA 1LTSD 4HSVA 3I4NG 2JA8B 3HOYH 4RH6A 1WTPA 4X6AH 2BDNA 3SHLA 1XMQL 3EBEA 2HDMA 4O1NA 2F0SA 5KNBA 4AH6A 4AYBE 1IKMA 3MXNA 3I70A 1LO5D 1PZKD 2ASBA 5HGTA 1TQOA 3A8IE 4GN3B 3S24A 4UY8C 5C6AA 3LKXB 5CV5A 1PH7A 4LFAQ 3A54A 2A6EC 4GN5A 1Q82C 2VZAA 4N9PA 4NXML 3RLNA 2KCCA 4ME3A 3PV0A 2SOBA 4OIKA 4DAVA 4GKJL 2UXDL 3IL8A 5E5WA 1FD7D 4LFBQ 2EDGA 4LK1C 2KECA 1WOCA 1VQFA 2BA0A 4O0AA 3M4OH 4YIJA 4KKSA 3QWNA 1LV9A 2EYPA 3P1HA 5NUCA 4POFA 4DK6C 1QZHA 5A2QE 3X3MA 5M3FH 1Y8NB 4UP8A 2YTXA 2OCEA 1QILA 5C3WA 1LTAD 1BNZA 3VYRA 3PO2G 1BCPF 1BUVT 2EJFC 4KN7C 4R1JA 2XP5A 2WINB 4L8JA 1XTCD 4L5TA 1YHAA 4JOIC 2IX0A 2E2IB 4XQJA 1XPRA 3KADA 2K03A 1YZ6A 2XNAC 3EROA 4A3GG 1KNAA 4B3TL 1CM9A 1GUWA 2VQFL 2XRQD 1CQVA 3G48A 1PH3A 3QG1A 3A55A 4L5SA 3VYTA 4FYDA 2VW9A 1TU2B 3KBXA 2R92B 3D6CA 3H3VH 3KABA 3SK5A 4A3DG 4FXKC 1BBWA 5H1SE 2XTIA 1VQ4A 1SN8A 4C3IG 3WOFA 2B2TC 3NPPA 3CCLA 2OQ0A 2A5HA 1LT3D 5BN5A 5CQ2A 3S14H 2EY1A 1JJ2A 1EEID 1F9RA 5E64A 1V8QA 1WTVA 5C0XI 5M3MG 3DM3A 1GO3E 1VQOA 2CHBD 2O4XA 4DR6Q 5JJLA 5C4XH 4DUYL 2EXZA 1TXYA 3NBIA 5C3EH 3FVQA 1QUQB 4IPDA 4BBRB 4BBSG 2IY5B 4RGTA 3RN2A 3HKSA 4X3KA 1STGA 1C4QA 2A69D 1VQ7A 3NWTA 4P73A 4HJ5A 1STNA 3UDGA 3DWAA 1IBML 4LW1A 1FL0A 2R93G 2A74C 2HHHQ 2XGTA 1UAPA 2PCFB 4PMWA 5DAUA 4ZQ3A 3GTQB 1BCPC 2FMMA 3NK9A 5EPKA 4A3BB 2B2VA 1PXUA 3S1MH 1Y1VG 5CV8A 1CKNA 2N49A 3KF8B 1I5HW 1XNRQ 1RTNA 2Z0SA 2E5LL 3MHBA 2TSSA 5M5YB 1I6HB 4DK1A 1IBLL 4JBJA 1A3VA 2ZQUA 1K9QA 1IYJB 3SGIA 3V96A 1VQPA 2VB3X 2L1BA 3UDIA 1L1OA 5IWAL 4IPCA 3DM1A 4GZYC 2OTLA 1PH5A 2UUCQ 4DAPA 1KTKA 3M9BA 3MXUA 5KYIA 2ZM6Q 3JAME 2CWAA 2B29A 4OONA 2NN6I 1EEFD 2E74C 3CKIB 1TWAH 2VUMB 4J15A 4DAMA 4C1NK 3C1EA 5M5WB 3J81L 1A6XA 2JP1A 3RLFA 4JI5L 2RKSA 4DR5Q 1A0IA 2Y0SG 3HOUG 1EQQA 2L4JA 4DV7Q 1SXTA 4X66L 1PRTD 1NCVA 4IURA 1N33L 2B63B 1J5EQ 2ITKA 5FKAC 2VQEQ 4A3MG 3T1YL 5COYA 3GTKH 1CZWA 3MC0B 4KY5A 1GHJA 2M9VA 1F2MA 1VQ8A 3PIO3 2E2JB 4G57A 3JC66 4PMBA 3HOVG 3RUZA 1MSHA 1ENCA 3IAYA 4DXGA 2DN8A 2IL8A 2AHOB 4AQYQ 4RAUC 2F3VA 1Z6HA 3K5MA 2RCNA 1ENAA 4J8QA 4B3ML 4X62L 1X3PA 4LF9L 1JWMD 3NTHA 2NVTH 4U84A 3SR1A 1WCMG 2F0IA 5CORA 1YEZA 3SK6A 4DR3Q 2EZVA 1N34L 1PV4A 4XIGS 4RCOA 4A93B 1EQTA 3F2UA 2QILA 2XWJB 1PYBA 4O2DA 4KMUC 3STBD 2JA9A 1HNWQ 1BOSA 4HIMA 1I4PA 2KA7A 4FF2A 3GTLH 1QVFA 5CR3A 4LJZC 2KEEA 3T1HL 3OIQA 4JV5L 5CBAE 1KXLA 2JJQA 1Y69U 4A3EG 4QIBA 2K52A 2NTSA 5CV7A 2PZTA 5C4JH 2I46A 2JA8G 3PUWA 2HIVA 4M1UB 4ZKBB 3HFZB 1ZYRC 1F2YA 4LAAA 3FDTA 4A3FB 4AYBB 5J39A 5DLQE 4CKEA 4IUVA 4U68A 3KF6A 3TQYA 3NENA 3DEOA 1SLJA 4WFN3 4DV2L 1WJJA 4V0BA 2Y0SE 2VB2X 2PMZE 1B1ZA 5EPJA 3ULLA 1ET6A 2BCOA 4UP7A 1CA5A 4FP5D 1B2TA 1YNJD 4BS9A 1EIFA 1DCZA 5IP7G 1DONA 4R4CA 1M4VA 3CC7A 4TVAB