2BA1A

Archaeal exosome core
Total Genus 36
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
36
sequence length
179
structure length
179
Chain Sequence
MRFVMPGDRIGSAEEYVKGEGVYEEGGELFAAVAGKLIIKDRVAKVESISPIPEIVKGDVVLGRVVDLRNSIALIEVSSKKGENRGPSNRGIGILHVSNVDEGYVKEISEAVGYLDILKARVIGDNLRLSTKEEEMGVLRALCSNCKTEMVREGDILKCPECGRVEKRKISTDYGKGEW
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Rna binding protein
molecule keywords Archaeal exosome RNA binding protein CSL4
publication title Structural framework for the mechanism of archaeal exosomes in RNA processing.
pubmed doi rcsb
source organism Archaeoglobus fulgidus
total genus 36
structure length 179
sequence length 179
chains with identical sequence B, C
ec nomenclature
pdb deposition date 2005-10-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF10447 EXOSC1 Exosome component EXOSC1/CSL4
A PF14382 ECR1_N Exosome complex exonuclease RRP4 N-terminal region
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.20.70.10 Mainly Beta Single Sheet Ubiquitin Ligase Nedd4; Chain: W; Ubiquitin Ligase Nedd4; Chain: W; 2ba1A03
2.40.50.100 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 2ba1A01
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 2ba1A02
2JEBI 1NMVA 3I55A 4JOIC 3L7ZC 5IP7H 2E5LL 3NEMA 5C3EG 1I94L 4GNXC 2I5HA 1YNNC 4QJFA 2YSFA 2JA8H 2A6EC 4OX9L 1VQFA 2CW0C 2DNEA 1PH7A 4BXXH 4B3RQ 1K3RA 2R92H 4GN5A 1IZ6A 4LFAL 2YSIA 1YI2A 1J6QA 1IBML 4A3IG 2F21A 1ASYA 2ALYB 1N33L 3NE5B 1VS0A 4TQUS 1U0LA 2GN5A 2XP6A 2JXWA 4LWCA 4X62Q 4LUVA 4HJ7A 1I6HH 2F3IA 1SRUA 2AUJD 4QGUA 2XP5A 2Z6KC 2B8GA 1NTGA 5FLXc 1K0RA 3UDFA 4LF6Q 3F8TA 5GROA 1YVCA 2VQEL 5JJLA 3N6RA 3HOXG 1AH9A 2A68D 1HNWQ 2UXDL 1KRSA 4B3TQ 1D7QA 1UE6A 4LF4Q 1N34Q 4BBRG 4B3SQ 2F1MA 4EX5A 1E1TA 3J80i 4OONA 4X66Q 1V43A 1YBYA 3K7UC 4R1JA 3EN2A 2NZOA 1SLJA 3RN5A 2GVBA 4P74A 4BY7G 4PZ8A 4R4TA 4AYBE 5KNBA 4YWMA 2F4VQ 3IRBA 1Q1EA 4JI5Q 1HNZL 5BN5A 2D5DA 2JA5H 1B7YB 2HHHL 2K52A 2RF4A 3CCVA 1L2FA 1NJIC 1YJWA 3CCJA 3TQYA 4NXNQ 3PO2H 3ERSX 3OOBA 4C3HH 4LUOA 3U4ZA 1VQOA 1A6XA 3S1QH 1E24A 2DGYA 4YCVA 1CSPA 3UE1A 3ND8A 3M9BA 3E9HA 4JI4Q 5IYDG 3ZJYC 2ZQVA 4A3JG 5C0XG 3MEFA 2XP8A 1RL2A 1E22A 1VF5C 1IYVA 1HCZA 3TC5A 3LWUA 3GTMH 1E3PA 4DUYQ 1PYBA 2ZM6Q 4DV4Q 3JAMi 2LMCB 3BZCA 1Y1VG 1BDOA 3NELA 4PG3A 5GADC 1H9SB 2K75A 1VQHA 3AYHB 4IOCA 4IFDJ 1TWCH 2ID0A 1VQIA 2YSBA 5M5WH 1DXMA 4GKJQ 1VCIA 2VQFQ 4JYAL 1QVCA 2XGTA 2PQAA 2RE3A 4HJAA 1Z47A 2DMVA 3BU2A 1E1OA 3F2DA 3CCUA 4GKKQ 1K8AC 4JI8L 1I5FA 4KHPL 1IXRA 2E75C 3RLNA 3S2HH 3E0EA 4IPGA 1S72A 3T51B 3E9IA 4UP7A 1G51A 2MFIA 2JA7G 2AWNA 5LMNL 5H1SE 1PHJA 4DV7Q 1GVPA 3ND9A 1OXTA 3TZUA 3HFZB 4JI1Q 4P75A 3GTQH 1QUQA 2B63H 4KMUC 4YY3Q 2ZQUA 1UE1A 4DV1Q 1YHQA 4DR5Q 1H95A 5C0XI 3DLLA 4A3GH 4NB3A 3J81c 5BN3A 2N3SA 4A3KG 4LF9L 2D2CC 2XP3A 3M4YA 4L8JA 3AB9A 1TK7A 3KFUA 1FJGL 4NXMQ 3I4MH 3OYYA 4LFBQ 2O5JC 2BH8A 1NBWA 3D0FA 4YWLA 4BY1G 1Q7YC 4DUZL 4KKUA 3T56B 4JG2A 3HOUG 4DK0A 3HKSA 2O5IC 3L4HA 1XNRQ 2DK7A 1N32L 1VQNA 4A3CG 3FHWA 2M3OW 4A75A 4X65Q 2OTJA 4DNIA 2ZAJA 4DR3L 4P73A 2QF7A 4A3DG 1X54A 3VA7A 4X64L 4IO9A 3W1GA 1WYDA 3P20A 4BBRH 3CMEA 4KHZA 1RIPA 3T1HL 1QVFA 1Z9FA 1HZ9A 3TCZA 1VQ9A 2XPBA 2KA7A 3HOYG 4BA2I 1A8VA 1EQRA 3CP0A 4OWWB 3G6EA 1ZKOA 5IT9c 4LF7L 3KJOA 5IP9G 1H9RA 4KKTA 4YHHL 3S2DH 3PO3G 3HKZG 4O0AA 2HIXA 3TEHB 4ALPA 4WJ3M 1PH3A 5JJIA 3PUYA 1Z7TA 1GKHA 5M3FG 4LK1C 1X55A 1PA6A 5IYDH 3U58A 2A6ED 2ES2A 3TS2A 5C0XH 1HTPA 3K81C 4POGA 2EJFC 2I5LX 5JJKA 3A5UA 2K5HA 1YEZA 4OX9Q 4UY8C 3K7AH 1PH5A 2DWVA 4A3LH 4HJ8A 4LFAQ 5IYCG 4U86A 4DNRB 2BA1A 3AQQA 1SMXA 1MKHA 2UUCL 1N33Q 4JOIA 1Y8NB 1HZAA 4GNXA 4GOPC 3KF8B 2UXBL 1UEBA 1XMQQ 1PYSB 2LXKA 3GTOH 2XTIA 3J80c 2IHFA 2R7DA 5AJ3L 4H44C 4DAYB 2VQEQ 1PH6A 2ZJRA 2C35B 1EQQA 1M1KC 2UXDQ 1JMQA 1Q90A 5E7NA 4L5SA 1JJCB 2JA7H 2EJGC 1NMFA 3ICEA 2JMFA 3FP9A 1CKOA 3KF6A 2R6GA 1J5EL 2KHIA 3KAHA 1Y1WG 1Y8PB 3H0GH 2Z6KA 4OWXB 1PH8A 3CQZH 1FR3A 2JJQA 1CTMA 4AYBG 1F8AB 1ZYRC 3M85A 3I2ZA 3TRZA 3AFQA 1JJGA 3F2BA 4G7HC 1VQCA 1HNZQ 2JEAI 1L1OB 4MTNA 5C4JH 1IBLL 4MNOA 2KCMA 4A3KH 2B8FA 2HHHQ 2YTXA 1DD2A 3CRLC 1KHIA 2CWPA 4DV6L 1QZGA 4G7ZC 3KDFB 2EQSA 1LYLA 1CKNA 4LJZC 3J81j 1X3EA 2E2JH 2Q5AA 5C44H 4BY1H 3FMCA 1EG3A 3BJUA 3S1RH 3RZDH 4C2MH 2IX0A 4OXPA 4H0LC 4EQ5A 1PVOA 1N9WA 1V9PA 3B6YA 1BVSA 4A3BH 1Q81C 3U9SA 2KENA 4DR6L 1PINA 4H13C 4QQBX 2Q2HA 1Z6HA 2UUBL 1B70B 2A8VA 1X65A 3OOCA 1TU2B 1KRTA 2R7FA 3T1YL 2BDOA 4R4QA 2K5NA 4C3JH 3I4OA 1K8MA 2WAQG 4UP8A 3A74A 1LTLA 1VQ5A 1Q86C 4BBSG 1E2VA 1Q8KA 2EVBA 1OXXK 2ZT9C 2RHQB 1TWFH 5BR8L 4JI7L 3CC7A 2MO0A 4JYAQ 3MFYA 2HIVA 4DK3C 5IP9H 3PO3H 4R4IA 1MJEA 2CFMA 1H9MA 1FYCA 2KHJA 4YCUA 5GAHC 4JI8Q 4DV2L 2VUMH 4KHPQ 4GN4B 4DR7L 3PIPA 2NVXH 3CNGA 2OTLA 5M3FH 5CQ2A 3IKJA 1E2ZA 2HQLA 2MNAA 1YIJA 5LMNQ 4LFCQ 3U4VA 3SE0A 3QIAA 4RCNA 3RR5A 1C7YA 2V1CC 2ATWA 1CFMA 2JE6I 3I4NG 3OW2A 2GVAA 3ULLA 1YITA 1VQGA 2WB1G 1I5HW 1K83H 1VQ4A 1GJXA 1Q82C 1C9OA 3KLRA 3CMAA 4A3EG 2E74C 2UUAL 5JEAG 1A62A 4QY7A 2MQHA 3PV0A 4XIGS 4LF9Q 1IL2A 2R7ZG 2K5VA 2Z0SA 4O2DA 2YV5A 2ZTEA 2PI2E 3H94A 1FJGQ 1EUJA 3GTJH 2ZR4A 1XPRA 4YWKA 5KNCA 4DR1L 3S17H 3CCEA 1IYUA 1N32Q 4DR4Q 1XMOL 5A35A 1O7IA 1XNQL 4X62L 5DLQE 2NZHA 1IBKL 4DR3Q 4DR2L 2Y0SE 1EIYB 4KKSA 4IQZA 4LF6L 2MDIA 5IE8A 3GDEA 3G48A 2AMCB 3PIOA 1HNWL 3I4LA 1Y1WH 3T1HQ 1MIUA 1N36Q 1E7ZA 4IFDG 3KJPA 1JT8A 1TXYA 3NTPA 4B3SL 1H9KA 3A8KE 3K80C 3CCLA 3RZOH 4LF8Q 1T5EA 1TWAH 4RG1A 4LF7Q 3CXCA 2IHEA 1PH4A 3CF5A 5LMNW 4YHHQ 3BDOA 3LNNA 1XJVA 2F4VL 5C3EH 2KXQA 4R4CA 3WDNA 1W3SA 1PH2A 2K7VA 4QIBA 1P8LA 5LMUL 1YHBA 4JI0Q 3F2CA 5IY0A 1UWVA 3OW7A 3OTOL 4JI6Q 5HGQA 1VQ8A 1Y14B 3IFTA 3FKIG 4A3IH 2RHSB 4LF5L 2UXCL 3EQLC 1VQMA 2DJYA 2YU9H 4K0KL 1H9JA 3A7AB 1P16A 4A4IA 4A93G 4GLAC 2AHOB 2E2IH 3RLOA 2OQ0A 1YJNA 2PMZE 1WJJA 2QGQA 4TVAB 2F52A 3PUWA 1YNXA 4JK1C 4BBSH 4DUYL 1ZCNA 2UUCQ 2ZTDA 3HOXH 2LSSA 2ZJPA 4AQYL 1N8RC 4DV3L 4IJHA 3UE0A 4DV0L 2UXBQ 4IFDI 2M8JA 1HZBA 4JI3L 5K36G 3CCQA 2PQAB 3WH0A 4G7OC 1HNXQ 2DNCA 1E2WA 1SMYC 2NN6G 3GO5A 2IT1A 2B3GA 2VS1A 5IWAL 4GKJL 5FLMG 4JC0A 4B3MQ 1PV4A 4BY7H 2A19A 1FGUA 3KADA 1L0WA 2K4KA 1HJPA 2VNUD 3RNUA 4GOPA 2D62A 3H3VI 2PI2A 1J5EQ 1HR0L 3PUZA 3L0OA 2ASBA 3I4NH 1Y8OB 4OO1I 1B9MA 1QUQB 1WCMG 2JA6G 1KXLA 2K50A 1B9NA 4DV7L 1VF7A 4H02A 4YCWA 2VZAA 2ZQTA 3PUVA 4GN3B 2VY3A 4DK6C 4U85A 3A8IE 5M5YH 5JEAH 3UDXA 2BE5C 4DAMA 1VQJA 1EWHA 1FL0A 4DPGA 1HZCA 4A3JH 3RN2A 1OTCA 4DR5L 3RLFA 3T53B 4DV6Q 2CWAA 4UPAA 2E5LQ 3WWVA 4MZ9A 1G6PA 1I94Q 2HT1A 1EIFA 4KN4C 1IYJB 5GAGC 1YW5A 1YHAA 3H15A 1NMGA 3S24A 1X3GA 3ULPA 3PO2G 1EFWA 1QJOA 2K33A 3QJYA 1KL9A 1Y1VH 3LGJA 1K8GA 1IBMQ 1XTDA 1I50H 4DR6Q 2EJMA 3M4OH 2R93G 4L5TA 2XP4A 3KAFA 2UUBQ 2NN6I 4APVA 4UP9A 3T1YQ 1DCZA 3S16H 4X65L 2UU9L 2YSHA 2L5TA 3CC2A 1BBWA 1VQ6A 2E76C 3HOZG 3A8JE 3L2PA 2JX8A 4JBMA 1V8QA 1W2BA 1YNJC 1D8LA 3GTPH 1S3OA 1VQAA 5BR8Q 4JI7Q 1VQPA 2L4JA 1KAWA 3CRKC 2EDGA 2RCNA 1I3QH 1L1OC 4GOPB 2CKZB 2MO1A 1KIXA 1O7LA 3BG3A 2VL6A 1AE3A 4DV2Q 4REXA 2A69D 1YJ9A 3VR2A 1QZHA 3H3VH 1HQMC 1OXSC 1PH9A 1GUTA 1VDZA 3D4RA 2CCZA 2NVTH 1SE8A 1GO3E 3HOWG 3HKZE 3CPFA 1X56A 4A3FG 5EAYA 1K8OA 1Q12A 4A93H 2OCEA 2E2HH 2UUAQ 2B63G 3HOUH 4GS3A 2LAJA 4Y7NH 3CAMA 4JI2L 5C4XG 3JAMc 3CCRA 4IOAA 2EZ5W 1O78A 3U50C 4A3CH 1WR7A 4A3GG 2ZR5A 3DXJC 3M4PA 2ZR6A 4A3DH 3AFPA 3TS0A 1IW7D 1SFOH 2FXQA 4GNXB 1M90C 2KCCA 5K36H 4DR1Q 3W5OA 2KCTA 3I4MG 2H5XA 2AUKA 2NN6H 1TWGH 1XMOQ 3PUXA 1EWIA 1XMQL 1XNQQ 1LUZA 5FLMH 3PGZA 3M4QA 2Y0SG 3HOYH 1IBKQ 4R4OA 1X9NA 4DR2Q 4JV5L 1WFQA 1H9SA 3Q8DA 4HIOA 4X6AH 4PV1C 2YYZA 3ULJA 1VQKA 4AIMA 4DV5L 2EIFA 4P72A 1DGSA 5BN4A 3KF6B 3TREA 4KLKA 1GM5A 3VDYA 2Q2TA 1VQLA 3FPPA 2DN8A 1WCMH 2JA6H 3KOJA 3CC4A 3VR4A 4LW1A 5KNDA 1GUGA 3S1MH 4E5RA 3M7NA 5FJ8G 2A69C 2ZTCA 4FDBA 2PCFB 1LABA 4QIWE 5GAEC 3SDZA 1HPCA 1FVIA 3HOVG 1K73C 3S14H 3A0JA 1S40A 4DKAC 2WFWA 2YSGA 1U5KA 1QVGA 3PSIA 1CKNB 5LMUQ 5JEAJ 3G71A 1JJ2A 1CI3M 3KYHC 5C0XJ 1GUOA 2A6HD 3I73A 3OTOQ 2Q2UA 3GQBA 4Y52H 5IYCH 1MJCA 4RMFA 1BKBA 1KQSA 3AEVA 4I7ZC 2XPAA 1Q1BA 4LF5Q 2UXCQ 4B3RL 1UE5A 2D0PA 2R93H 1JE5A 3I7FA 4K0KQ 2JQOA 4DUZQ 4DK1A 1CSQA 5M5XH 2IX1A 5ELOA 3PF5A 1ASZA 3STBD 1IW7C 3HOZH 3GTGH 4WJ4A 3D31A 1X3FA 1I6VC 5HY6A 3CD6A 1WI5A 4A3LG 3M3YH 4ME3A 5IYBG 4AQYQ 4DV3Q 4JBKA 4HR7B 3VR5A 4X64Q 4DV0Q 2N78A 4JI3Q 2E45A 3W3AA 2WAQE 3CW2C 4P71A 3BZKA 4GZYC 2N8NA 4B3TL 1UE7A 5IWAQ 4LNQA 4LF4L 1N34L 2ZQSA 2I0QA 1XPOA 2A68C 2L15A 1K9QA 3GD7A 1KD1C 2WP8J 1K9RA 4X66L 1C0AA 3PCOB 3QG1A 3DM3A 4A3MG 4OGQC 3HOWH 1HR0Q 4JI5L 2BE5D 3KCEA 1Y69U 4A3FH 4LFCL 3GTKH 1Q46A 2M8IA 2A1AA 4QL5A 3PF4A 1SN8A 3F1ZA 1CUKA 5M3MG 2Q8IB 4NXNL 3H0GG 4OO1G 1VQDA 3KLWA 5C4XH 1NY4A 1OXUA 2WB1E 3UDGA 3EBEA 5J3BA 1JMCA 1AE2A 4JI4L 2A6HC 1PMRA 2EXDA 2DK1A 3KAGA 1A0IA 3MXNB 4AH6A 2K14A 3SGIA 5AHTA 4KI0A 5IP7G 1ONLA 3CCMA 3GTLH 1K9MC 3K0XA 2V4DA 4IPCA 3MXUA 2JA8G 5GQOA 1JB7A 1B8AA 5C44G 3ODKA 2E8GA 5ELNA 4BXXG 4PZ6A 2R92G 1PFSA 2ZM6L 2CQOA 4DV4L 4KN7C 4A3BG 4DR4L 3STBC 4L5QA 3TDBA 3NENA 1EG4A 2K32A 3K8AA 2UU9Q 4LUZA 1VQBA 2JXMB 3KABA 3CPWA 4HIMA 3S15H 2N49A 5AJ3Q 2VQFL 4HIDA 4JBWA 2OQKA 1GD7A 4JCVE 1SROA 1GUNA 3OPOA 2YTVA 4OWTB 4GKKL 2JK8A 1N36L 1TWHH 5FJ8H 3KAIA 4U84A 1OXVA 4LF8L 3HOVH 1PH1A 3W1BA 1HR0W 3I72A 2PNHA 1NE3A 2Q2IA 4A3EH 4JI1L 3VR6A 2QEXA 1GHJA 4YY3L 2DUDA 2ITKA 1IBLQ 2VUMG 4DV1L 1VQEA 2R7ZH 2NVQH 4IJLA 2YTYA 4HJ5A 4JI0L 3EIVA 1L1OA 1KC8C 1XPUA 1BBUA 2JA5G 3A7LA 4JI6L 4POFA 4BA1I 2JA9A 1SR3A 3KDFA 3I56A 3A5ZB 4XTCS 4NXML 4JI2Q 1WMVA 4IPHA 2BH2A 4LFBL 4TKOB 1EOVA 1TKWB 3J81i 3HGBA 1VQ7A 5IYBH 1XNRL 2PNRC 2PPBC 1CKMA 3NBHB 3S1NH 4PZ7A 2BA0A 1T9HA 2IY5B 3JC66 1YZ6A 3LE4A 2OWOA 1R9TH 4IFDH 3J7A5 4HIKA 2JV4A 1HNXL 2I5MX 4NPSA 4JV5Q 1LM0A 1EYGA 4GLVB 4PMWA 4B3ML 4A3MH 4DV5Q 2ZJQA 1A63A 2NVYH 1G291 2D0OA 2LXJA 1WOCA 3VR3A 2AKWB 3ER0A 2VW9A 4DR7Q 1X6OA 4J15A 1GUSA 2XP9A 3G4SA 3CCSA 5M3MH 1O6WA 2B29A 1LACA 2KBNA 4OO1H 2XP7A 3J7ZC 4DNTB 1GHKA 1V1QA 3FKIH 1HH2P 2QA4A 4IPDA 4L5RC 4A76A 4HJ9A 4JBJA 3UDIA 4C3IH 4GLXA 2AWOA
chains in the Genus database with same CATH superfamily
2JEBI 2E2IB 3R8BA 5D3IB 2Y0SB 1NMVA 3I55A 2QW7A 4XT3B 4HSPA 1RF2D 4JOIC 3L7ZC 5IP7H 1PFNA 2Z8LA 2E5LL 3NEMA 5C3EG 1I94L 4GNXC 2I5HA 1YNNC 4ZYSA 5T1IA 2QDBA 4QJFA 2YSFA 3HOXB 2JA8H 2A6EC 2XWJB 4OX9L 1VQFA 2CW0C 2FJ2A 2DNEA 4HMIA 1PH7A 4BXXH 1S5CD 1RTNA 5D14A 4B3RQ 1EEFD 1K3RA 4KJOA 2R92H 4GN5A 1IZ6A 4LFAL 2EYLA 4BBRB 2YSIA 1YI2A 1J6QA 1BCPD 3NP8A 5IGFA 1IBML 2EE1A 4A3IG 2F21A 3H91A 3D6CA 2ALYB 1ASYA 1D1KA 1N33L 1SYGA 1R4PB 1VS0A 3NE5B 5JVG3 4M1UB 2SDFA 1JICA 4TQUS 2HQEA 1U0LA 2GN5A 2XP6A 4BY7B 1JWUD 3K5OA 2RA4A 2JXWA 2F0UA 2PW7A 4LWCA 4RGTA 4X62Q 2B2VC 4RCOA 4LUVA 4HJ7A 1I6HH 2F3IA 1SRUA 3IAYA 2HDMA 2AUJD 4NDXA 4QGUA 2XP5A 1I4QA 2B8GA 2Z6KC 4F88A 2F0KA 1NTGA 2IX3A 5CV6A 1LT3D 5FLXc 4CGYB 1K0RA 3UDFA 3S2DB 4LF6Q 1J8IA 3F8TA 5GROA 3FEWX 1YVCA 2VQEL 5JJLA 3N6RA 3HOXG 1AH9A 1EYCA 2A68D 1HNWQ 2UXDL 1SYCA 4ODGA 1KRSA 4B3TQ 4KD3A 4JPBW 1D7QA 1EY5A 3HRZC 1UE6A 4LF4Q 1N34Q 3VYRA 3SVMA 4BBRG 1CA6A 4B3SQ 3ZYYX 2EY1A 1PRTC 2F1MA 4RA8A 4EX5A 1E1TA 3J80i 4OONA 4A3JB 5CBEE 1W6KA 4X66Q 1A3TA 1V43A 1YBYA 3K7UC 3HS0C 4R1JA 3EN2A 4UAIA 2NZOA 1PYWD 2PMZB 1SLJA 3RN5A 2GVBA 3OWEB 4P74A 1SNOA 4BY7G 4PZ8A 2A5HA 4R4TA 4AYBE 5KNBA 4QUCA 4YWMA 2F4VQ 3IRBA 5IGDA 1Q1EA 4JI5Q 2KEDA 1TR8A 1HNZL 5BN5A 5K5PA 2D5DA 4EGVA 2JA5H 5DNFA 5KGUA 2GA4B 4KY7A 1KTKA 2XVSA 1B7YB 1WTOA 2HHHL 2K52A 2RF4A 3CCVA 1JB3A 1EWCA 1L2FA 2TSSA 3DUZA 1NJIC 1YJWA 3CCJA 1Y1VB 3TQYA 4NXNQ 3PO2H 3ERSX 3OOBA 4C3HH 1SYBA 1ESFA 1LTAD 4LUOA 3A54A 2KECA 3U4ZA 4CKEA 1VQOA 1A6XA 3EVQA 3S1QH 1E24A 3DEOA 2DGYA 4YCVA 1CSPA 3UE1A 4RKBA 2NTSA 1PFBA 1TT2A 1RP5A 2HCIA 3ND8A 1PLFA 4CJ0B 3M9BA 1EU3A 3E9HA 4JI4Q 2A73B 4A0UA 5IYDG 3ZJYC 2ZQVA 4A3JG 5C0XG 3S16B 3MEFA 3GTOB 3H3VC 2O2LD 4CDCC 1U9RA 1MI2A 2IJ0A 2H1EA 1V1PB 3D4DA 1AFPA 2XP8A 1RL2A 3QO2A 3NWSA 1E22A 4KD4A 2K01A 3F2UA 5E62A 2F0JA 1VF5C 3EA6A 1IYVA 1HCZA 3TC5A 1BCPC 3LWUA 4WRDA 3GTMH 1QB5D 1ICFB 4FXKC 2RBMA 1E3PA 4DUYQ 2JA7B 2TMPA 1PYBA 1XX8A 2ZM6Q 1KDBA 4FF4A 4DV4Q 3JAMi 2LMCB 3BZCA 1Y1VG 1BDOA 3NELA 3NXWA 1HUMA 4PG3A 5GADC 1H9SB 2K75A 1VQHA 4PMBA 4XXEA 3AYHB 1QILA 3CQZB 1D2BA 4IOCA 4IFDJ 1TWCH 1SJED 1TS4A 2ID0A 1VQIA 2YSBA 5M5WH 2F0SA 1DXMA 1MGSA 1L0YB 4GKJQ 1VCIA 2VQFQ 4JYAL 1QVCA 2XGTA 2PQAA 2L4NA 2RE3A 4DAPA 5JJZA 4HJAA 1Z47A 1KDCA 2DMVA 3BU2A 5C4JB 1E1OA 1HQRD 1RJTA 4A3KB 3F2DA 3CCUA 1ENCA 4GKKQ 4ME5A 3LX0A 4JI8L 1K8AC 5CGKA 1I5FA 4KHPL 1IXRA 2E75C 1BBXC 3RLNA 2C5CA 3S2HH 3E0EA 1PTOF 4IPGA 3L9AX 1S72A 3T51B 1JC7A 5FOBB 3E9IA 4Z9CB 4UP7A 1G51A 1HRJA 3CU7A 2MFIA 2E2JB 1JORA 2JA7G 3U9OA 2AWNA 4BY1B 3DWQA 2RVLA 5LMNL 5H1SE 2F0GA 3S1RB 2RDGA 4DV7Q 3RZDB 1PHJA 3HOUB 5J22A 4C2MB 1GVPA 4FF3A 3ND9A 1OXTA 3C1FA 1NR2A 3HFZB 1RDPD 4JI1Q 3TZUA 2WINB 4P75A 3GTQH 4EQNA 4A3BB 1QUQA 2RKSA 2B63H 4KMUC 4YY3Q 2ZQUA 1UE1A 4XQJA 5G3LF 3I8ZA 1XTCD 4DV1Q 1G6ZA 1YHQA 3KLSA 4DR5Q 4RHRA 1EQVA 1DOKA 1H95A 5C0XI 3DLLA 2EPBA 1J9OA 4A3GH 4IUQA 2NTTA 4A3DB 1Q3LA 4NB3A 3J81c 5L37A 4K5WA 1C4QA 4XDXA 5BN3A 2N3SA 1LTRD 4A3KG 4LF9L 3SK8A 2D2CC 2XP3A 1IKMA 3M4YA 4HAEA 4C3JB 1UUPA 3AB9A 4L8JA 4J1MA 2N55A 5C4ZA 1TK7A 3KFUA 1KNAA 1FJGL 4NXMQ 1T5XD 3I4MH 2O4XA 3OYYA 2C9OA 5IGGA 3MC0B 4LFBQ 2O5JC 2BH8A 1DONA 2Y8NB 1NBWA 2FMCA 2L55A 2LY7A 3HOYB 3D0FA 4YWLA 1B50A 4BY1G 1Q7YC 1CA5A 4DUZL 4KKUA 3T56B 4JG2A 3HOUG 1DJRD 4K5VA 1XYIA 4DK0A 3HKSA 2O5IC 3L4HA 3J7AF 1XNRQ 1F9SA 2DK7A 1WD1A 1STEA 1N32L 1VQNA 4A3CG 1CQFA 3PO3B 4KY6A 2IW3A 3FHWA 2M3OW 3FSCA 1MSGA 1STNA 4A75A 3NQIA 3HKZB 4LMQD 4X65Q 1DZ1A 3CHBD 1RKNA 2OTJA 4DNIA 3OWFA 1JOKA 4N8X1 2ZAJA 4DR3L 4P73A 2QF7A 2ZXRA 4A3DG 2NVXB 4Q5VA 2XNAC 2HUGA 2EYOA 1X54A 3VA7A 4X64L 2FHTA 5M3FB 3TP7A 4IO9A 3C46A 3W1GA 1WYDA 3P20A 4ZUIA 4BBRH 3CMEA 5EPLA 4KHZA 1X32A 4DU9A 2J7ZA 1RIPA 3T1HL 3I91A 1QCBD 1QVFA 1Z9FA 3TBIB 1HZ9A 3TCZA 1BF4A 2XN9C 1VQ9A 1NCVA 5FO8B 2XPBA 3S14B 2KA7A 3HOYG 3WOEA 3MCBA 1A8VA 4BA2I 1EQRA 3CP0A 4OWWB 1ZEQX 5EPJA 4C56C 3G6EA 1ZKOA 5IT9c 1ILQA 4LF7L 3KJOA 5IP9G 1ZYRD 1AZQA 1H9RA 4KKTA 4YHHL 1D6EC 3S2DH 3PO3G 4FNFA 1RCVD 3QR8A 4M8AA 4C1NK 1EEID 1EZ8A 3HKZG 3X3MA 4O0AA 2HIXA 3TEHB 2Z1CA 4ALPA 4WJ3M 5NUCA 4HMJA 1SNCA 1PH3A 1IL8A 2G9DA 1B3AA 5JJIA 2L1BA 3PUYA 1Z7TA 1GKHA 5M3FG 1R4QB 2RSNA 4LK1C 1X55A 5C5MA 1YNND 1PA6A 1PTOB 5IYDH 3U58A 2A6ED 2ES2A 3TS2A 4R8NA 3S17B 5T1GA 3IFDA 4XQNA 5C0XH 1EY7A 2B2TA 1HTPA 2NZ1D 3L3OC 3C2PA 3K81C 4POGA 2EJFC 2I5LX 1GOZA 5JJKA 3A5UA 3GTGB 1O7YA 1SNQA 2K5HA 1YEZA 4OX9Q 4UY8C 5C3WA 3M3YB 3K7AH 1BNZA 2K04A 1O7ZA 1PH5A 2NUCA 5IGCA 2DWVA 5C3XA 4A3LH 5E5WA 4HJ8A 4LFAQ 5IYCG 2MUYA 4XQQA 4U86A 2B2UA 1U4LA 1PZID 3C1EA 1A3VA 4DNRB 2BA1A 1Y1WB 3AQQA 1SMXA 5CMDA 3TZDA 1MKHA 2UUCL 1N33Q 1LO5D 4JOIA 1Y8NB 5KYLA 4AYBB 1HZAA 4GNXA 3V2TA 4GOPC 3KF8B 2UXBL 3RZOB 1UEBA 2L11A 1I4HA 1XMQQ 1PYSB 2LFNA 2LXKA 1SNMA 1UAPA 3GTOH 2XTIA 3E3XA 3J80c 2IHFA 2R7DA 2EYFA 5AJ3L 4H44C 2R61A 4DAYB 3K59A 2VQEQ 4IURA 1PH6A 5AFWA 2ZJRA 5J1ZA 1PRTD 2C35B 3K6OA 1EQQA 1HUNA 2F0LA 4OHJA 3SR1A 4P2CB 1M1KC 2UXDQ 3KLSX 2CH4W 1JMQA 2XWBB 1Q90A 1L0XB 1NUCA 5E7NA 4L5SA 3BYTB 1JJCB 2JA7H 2EJGC 1NMFA 3ICEA 4ZK9B 2JMFA 3FP9A 1NAPA 4N9PA 1CKOA 3CKIB 3KF6A 2R6GA 1FLCA 2B39A 1J5EL 2KHIA 3KAHA 1Y1WG 1Y8PB 3H0GH 2Z6KA 4QB4A 4A3IB 4OWXB 1SE4A 3R2TA 1PH8A 3CQZH 1FR3A 2JJQA 2RSOA 3OMCA 1HA6A 1CTMA 4AYBG 1F8AB 1EY0A 1FNUA 4KV6A 1QNKA 1ZYRC 2BOSA 3MTSA 2RQXA 1MSHA 4PQXA 1LTSD 3M85A 1SE3A 3I2ZA 3TRZA 3AFQA 1JJGA 3F2BA 2YU9B 3KK7A 4G7HC 1VQCA 1HNZQ 1A2TA 3W2DA 2JEAI 1WTHA 2PZWA 1L1OB 4MTNA 2WIIB 5C4JH 1IBLL 1HA5A 4MNOA 2KCMA 3FS8A 4A3KH 2B8FA 4IUUA 2EY5A 5A2QE 2HHHQ 3GTLB 2YTXA 1DD2A 3CRLC 1KHIA 1LT6D 2CWPA 4DV6L 4OL7A 2R3ZA 1QZGA 4G7ZC 3KDFB 2EQSA 2WAQB 3MFGA 1LYLA 3VYTA 5I2XA 4BBSB 1CKNA 4LJZC 1MD2D 3NTKA 3K5NA 3J81j 1QE6A 1X3EA 2E2JH 2Q5AA 5C44H 2LS01 4BY1H 3FMCA 3SEBA 1EG3A 3BJUA 3TP8A 3S1RH 3FDTA 3RZDH 2P5ZX 4C2MH 2IX0A 1WD0A 4OXPA 4H0LC 1B4OA 5C5LA 4EQ5A 1PVOA 1N9WA 1V9PA 3B6YA 1BVSA 2WV6D 1RHPA 4A3BH 1Q81C 3U9SA 2KENA 2QEJC 4DR6L 1PINA 2XRSD 2OEOA 4H13C 4U68A 1BXTA 2MGSA 3S15B 3SK4A 4QQBX 1TR5A 2Q2HA 4IN3A 1Z6HA 2UUBL 2NBFA 1B70B 5CORA 2A8VA 1X65A 1CQVA 3GV3A 1CZWA 1BCPF 3OOCA 4IUNA 4K14A 1TU2B 1B3QA 1KRTA 2R7FA 3T1YL 3KBXA 2BDOA 4R4QA 2K5NA 1TWHB 4C3JH 1HTLD 4FYDA 1QOHA 3I4OA 3LWEA 1K8MA 2WAQG 4UP8A 3A74A 5ISRA 1LTLA 4HSVA 4G4KA 1VQ5A 1Q86C 3T13A 4BBSG 1E2VA 3FRPB 3V96A 1F2MA 1Q8KA 2EVBA 3I4NB 1OXXK 2RHQB 2ZT9C 1K0SA 4TRDA 1DM0B 2WB1B 3O13A 4FF2A 4EQPA 2AQ3B 3AMUA 1Q8IA 2CHBD 1WTPA 4PMCA 1TWFH 5BR8L 2DY8A 4JI7L 2K5QA 3CC7A 4A3EB 2MO0A 4JYAQ 3DM1A 3MFYA 2HIVA 4DK3C 3MA2B 5M5YB 5IP9H 1V1OA 1X3PA 3PO3H 4R4IA 1MJEA 2CFMA 1ML0D 1LTTD 1H9MA 1FYCA 2KHJA 4YCUA 5GAHC 2F4IA 4ILWA 4JI8Q 3K0YA 3TSSA 4DV2L 2VUMH 4KHPQ 1TY0A 4GN4B 4DR7L 3PIPA 4XT1B 2KEEA 5I9OA 2NVXH 3CNGA 4B9XA 2OTLA 3H09A 5M3FH 5CQ2A 3IKJA 1E2ZA 2FFKB 3MXGA 3P1HA 2HQLA 4CDDC 3G6JB 2MNAA 1YIJA 2EYHA 5LMNQ 4LFCQ 3U4VA 3SE0A 3QIAA 4RCNA 3C3LA 3RR5A 1C7YA 2V1CC 1GXDC 2ATWA 1CFMA 2JE6I 3UI2A 1F2YA 3I4NG 4PNYA 1I50B 3OW2A 2GVAA 3ULLA 1YITA 1VQGA 2WB1G 3BVMA 1I5HW 1K83H 1VQ4A 1Q82C 3M4OB 1GJXA 1C9OA 3KLRA 4FF1A 3CMAA 4A3EG 2E74C 2UUAL 4ID6A 5JEAG 1M4VA 1A62A 5I9PA 1G91A 5ELDA 4QY7A 2MQHA 3PV0A 4MN3A 2N88A 4XIGS 4LF9Q 2Q8TA 1IL2A 5FLXE 2R7ZG 2K5VA 2Z0SA 4O2DA 2YV5A 2ZTEA 2OF1A 2PI2E 3H94A 1UNSA 2EY2A 1R9TB 2G9HD 2B2WC 2BCOA 2Z6BA 3MXNA 5CV4A 4DA2A 3D6WA 1FJGQ 1EUJA 2M9VA 4ZKBB 4ZLTF 1EY9A 2EZVA 3GTJH 2ZR4A 1PDQA 1XPRA 4YWKA 3GTPB 4NW2A 1PTOH 3EJIA 5KNCA 4DR1L 2PW5A 1KLUD 2F3VA 4B9WA 3S17H 4MIUA 3CCEA 1MBYA 1IYUA 1I3QB 1AW7A 1N32Q 4EQOA 4DR4Q 4NKLA 2F0VA 1XMOL 5A35A 1O7IA 1LTBD 3HZXA 1EFID 1XNQL 1CM9A 4X62L 1GUWA 1LT4D 5DLQE 3NTIA 2NZHA 1IBKL 1SMYD 4DR3Q 4DR2L 2Y0SE 1EIYB 4KKSA 4IQZA 4LF6L 2MDIA 5IE8A 2DJFC 3GDEA 3G48A 1QWYA 2AMCB 4CJ2C 3Q6SA 2NVTB 3PIOA 1SE2A 1FNWA 1BCPB 1HNWL 3I4LA 3OIQA 3FKIB 1Y1WH 1STBA 3T1HQ 1MIUA 1N36Q 4RH6A 1E7ZA 3KJPA 4IFDG 1JT8A 2DY7A 4R8IA 1TXYA 3NTPA 4B3SL 1H9KA 3D8GA 3A8KE 3K80C 3CCLA 3RZOH 3NUCA 5CV9A 3BVGA 4LF8Q 1T5EA 5FK9C 4A93B 1TWAH 2E2HB 2KHSA 1ENAA 4RG1A 4LF7Q 3CXCA 2IHEA 5A2QL 4Y7NB 1PH4A 3CF5A 5LMNW 4YHHQ 2JYOA 3BDOA 3LNNA 1XJVA 2F4VL 5EQ0A 5C3EH 2KXQA 4R4CA 3G7LA 3WDNA 1S5ED 1W3SA 1PH2A 2QKIC 2K7VA 4QIBA 1P8LA 3DHQA 5LMUL 2F0EA 1YHBA 4OEMB 4ZCKA 4JI0Q 3F2CA 4CDFC 3BYYB 5IY0A 1UWVA 4V0BA 3OW7A 1SFOB 1EY4A 3OTOL 4JI6Q 5HGQA 4G57A 5EKKA 2IL8A 2WACA 3NHHA 1VQ8A 1Y14B 3IFTA 3FKIG 2KOLA 1FGBD 4KHVA 4A3IH 2KUMA 2RHSB 4LF5L 2UXCL 3EQLC 1TWGB 5DAUA 4WJWA 2L9HA 4C3IG 1BQQT 2NYZD 2F0PA 1FD7D 1VQMA 2DJYA 2YU9H 4K0KL 1H9JA 3A7AB 1P16A 4A4IA 4A93G 2A74C 5JPNC 4GLAC 2AHOB 3AU7A 4TSSA 2E2IH 3RLOA 2OQ0A 1YJNA 2PMZE 3QOLA 4K2LA 1WJJA 2QGQA 4HCSA 4TVAB 2F0NA 2F52A 1YNXA 3PUWA 4K2KA 4JK1C 2QCPX 2RDFA 4CJ1B 3KBGA 4BBSH 4DUYL 1ZCNA 2UUCQ 2ZTDA 5E66A 3HOXH 5ELFA 2EYJA 2LSSA 1WCMB 2X69A 2ZJPA 2JA6B 4AQYL 1N8RC 3NBHA 4DV3L 1CK1A 1HFGA 2KCNA 1D1IA 4IJHA 3UE0A 2ZXPA 3NWTA 3TP5A 4DV0L 3S1MB 2UXBQ 3FPUB 4IFDI 2M8JA 1HZBA 4JI3L 4K6DA 5K36G 1PZKD 3CCQA 4K5XA 5F2DA 3LKXA 1STYA 2PQAB 3DWPA 3WH0A 4G7OC 4IUPA 3BDCA 5KRUA 1HNXQ 5EKIA 2J4XA 2DNCA 2K05A 1E2WA 1SMYC 1EOTA 1F9PA 2NN6G 2IT1A 3GO5A 3QWNA 3IL8A 2B3GA 2SNMA 2XRQD 2VS1A 4OELB 5IWAL 2HD3A 4GKJL 2SEBD 3TDQA 4V190 5FLMG 4JC0A 4B3MQ 1XXGA 1PV4A 1WVLA 4BY7H 2A19A 1FGUA 3KADA 2AQ2B 2RCFA 1L0WA 1AN8A 2KQ3A 2HDLA 2K4KA 3URYA 2WKDA 1HJPA 5M9OA 2VNUD 3RNUA 3J81E 1PFMA 4GOPA 2D62A 2B2YA 3H3VI 4KTAA 3WOFA 2PI2A 2XIWA 1ET9A 1J5EQ 1HR0L 3PUZA 3L0OA 2ASBA 3I4NH 1Y8OB 2JSOA 4OO1I 1B9MA 1QUQB 1WCMG 2PZUA 2JA6G 1KXLA 3SXHA 2Z9HA 4ZQ3A 2K50A 1B9NA 4DV7L 2R93B 1VF7A 4H02A 3OMGA 4YCWA 2VZAA 1TVXA 1WTRA 1B53A 2ZQTA 1KNEA 4FVMA 4N9TA 3PUVA 4GN3B 2VY3A 4DK6C 1SNPA 5EBDA 4F8MA 4U85A 3A8IE 5M5YH 4CKCA 3UDXA 4DAMA 2BE5C 5C4HA 5JEAH 1VQJA 3D4WA 1EWHA 1FL0A 4DPGA 3V05A 5M5XB 1HZCA 4DFAA 2QRVA 3RN2A 4A3JH 1VMCA 5FLXL 1OTCA 4L6TB 1OO9B 3RLFA 3RMHA 4DR5L 3T53B 1WTXA 4DV6Q 1JQYD 2CWAA 1TS5A 4UPAA 2E5LQ 2IWHA 3WWVA 4MZ9A 1G6PA 1EIGA 1I94Q 3RUZA 3HOZB 2HT1A 1EIFA 3GTMB 3GP7A 4KN4C 2K6AA 1IYJB 5GAGC 1YW5A 1YHAA 5E64A 3HEJA 5CYUA 3H15A 1NMGA 4QMGA 2WAEA 1CHQD 1EZ6A 3S24A 4FXGC 1X3GA 3ULPA 3PO2G 1EFWA 4A0TA 1K3BC 4QUFA 1QJOA 2K33A 1HXYD 3QJYA 1KL9A 1Y1VH 3LGJA 2SNSA 1K8GA 1IBMQ 1XTDA 1I50H 4DR6Q 2EJMA 2X6LA 2MPMA 3M4OH 2FINB 3OHXC 2R93G 3NSWA 4L5TA 2XP4A 3KAFA 4B08A 2UUBQ 3DMUA 5ELCA 2NN6I 2B2YC 1HFNA 4ZRZA 3MQGA 4C1NI 3BS1A 4APVA 1EIHA 4UP9A 2CH4A 3T1YQ 5IT9E 1DCZA 3I70A 1IHZA 4X3SA 3S16H 4X65L 2UU9L 2KVMA 2EYMA 1B2TA 2YSHA 2L5TA 3CC2A 1BBWA 3HOWB 1AP0A 1VQ6A 2E76C 3HOZG 3A8JE 3L2PA 2MJ8A 1RTOA 2JX8A 3Q24A 4A3FB 4JBMA 5IGBA 1RD9D 1V8QA 1W6JA 1W2BA 2F0DA 3X3NA 3GTKB 1YNJC 1D8LA 3QB3A 3GTPH 1S3OA 5EPKA 1VQAA 2F0FA 5BR8Q 3MCBB 4JI7Q 4O1NA 1CT1D 5CR3A 1VQPA 1EU4A 3GTQB 2L4JA 1KAWA 3CRKC 2EDGA 2RCNA 1I3QH 4R9WA 1L1OC 1PRTF 5C4XB 1C8CA 4F7XA 4GOPB 3T4AC 2CKZB 2I46A 4KK7A 2MO1A 2VB3X 1KIXA 1O7LA 3BG3A 3PIP3 1K28A 4K8JA 4H7BA 2VL6A 1AE3A 4DV2Q 4REXA 4A3GB 1C48A 2YAJB 2A69D 4I65A 1YJ9A 3VR2A 1QZHA 3HG9A 3H3VH 4RWSC 4QF4A 4ULLA 1HQMC 5JOBA 1DYQA 1OXSC 4NP5A 1PH9A 1GUTA 1VDZA 3D4RA 4MTKA 1RODA 2CCZA 2NVTH 1BOSA 1SE8A 1JOOA 1LTGD 2WKCA 1GO3E 1ESRA 3HOWG 3HKZE 2AQ1B 3I4MB 5EBCA 2H4OA 5E65A 3CPFA 1WTQA 4HN7A 1X56A 1G2TA 4HCEA 4A3FG 5EAYA 1EY8A 2F0OA 3M7GA 1K8OA 5I2YA 1Q12A 2CVRA 5U47A 4A93H 3R93A 2OCEA 2E2HH 2UUAQ 2K1BA 2B63G 3HOUH 1LLRD 4GS3A 3I90A 3PMFA 2LAJA 1U4RA 4S3SA 4Y7NH 2PO4A 3CAMA 4JI2L 5C4XG 5DEHA 3JAMc 3CCRA 4IOAA 2EZ5W 1BUVT 3J80E 1O78A 3BZDB 3U50C 1PZJD 5E3FA 4A3CH 4NMZA 1WR7A 3EROA 4A3GG 3OIPA 3FSBA 2ZR5A 3SK5A 3DXJC 1AEXA 3M4PA 1QG7A 2ZR6A 4A3DH 3AFPA 3TS0A 1IW7D 4BWGB 1SFOH 3FVQA 2FXQA 4GNXB 1V1PA 1SEBD 1M90C 2KCCA 5K36H 4DR1Q 4CHTB 5KEEA 5CV5A 2E2DC 3W5OA 2KCTA 3I4MG 2H5XA 2AUKA 2NN6H 1TWGH 1XMOQ 2J0TD 3PUXA 1EWIA 1XMQL 3HOVB 1U4PA 3I3CA 1XNQQ 1LUZA 5FLMH 3R2IA 1B1ZA 3PGZA 3M4QA 1WTVA 2Y0SG 3HOYH 1S4ZA 2X6GA 1IBKQ 3MWYW 4R4OA 1X9NA 4IZ8A 4DR2Q 4JV5L 1FNVA 1WFQA 1H9SA 2B2WA 3Q8DA 3J81L 2IPKD 3PIO3 4HIOA 4X6AH 4PV1C 2YYZA 1EYAA 3ULJA 1VQKA 4AIMA 4WORA 4DV5L 2EIFA 4KY5A 5C6AA 4P72A 1DGSA 3MXPA 5BN4A 2R7ZB 3KF6B 3TREA 1F9RA 2NVQB 4KLKA 1GM5A 1NNXA 4RKLA 5IODA 3K57A 1LT5D 3VDYA 3Q22A 2Q2TA 1VQLA 3FPPA 1WCMH 2DN8A 1S5DD 1SYDA 2JA6H 1F9QA 3KOJA 3CC4A 2OT2A 3VR4A 4LW1A 1UEAB 5KNDA 1O80A 1GUGA 3S1MH 4E5RA 1ICWA 3M7NA 5FKAC 2CQAA 2K5DA 5FJ8G 3K5LA 2NB0A 2A69C 2ZTCA 4FDBA 3JAME 2PCFB 1LABA 4F87A 5HGTA 3MEHA 3P7JA 2PYKA 4QIWE 5GAEC 3SDZA 3E0JA 1FVIA 1HPCA 2M2LA 1A3UA 3HOVG 1K73C 2PQEA 5KIXA 3PQHA 3K7AB 4RFBA 3S14H 1PRTB 3A0JA 1S40A 4DKAC 2D9UA 2WFWA 1U5KA 2YSGA 1QVGA 3PSIA 1CKNB 5LMUQ 5JEAJ 3G71A 1A15A 1JJ2A 1CI3M 3KYHC 5DM73 2RDHA 3S1NB 5C0XJ 1GUOA 2A6HD 1II3A 3I73A 3OTOQ 2Q2UA 4MHEA 3GQBA 2ICEC 4JVZA 5CV8A 2L12A 4Y52H 1SYEA 1MJCA 5IYCH 4RMFA 1BKBA 1SAPA 1KQSA 4YIJA 3AEVA 5JAVA 1STAA 4I7ZC 2XPAA 1Q1BA 4Q0FA 4X3KA 4LF5Q 2UXCQ 4DF7A 4B3RL 1UE5A 2D0PA 1KDAA 2R93H 1JE5A 2QDLA 3I7FA 4K0KQ 2JQOA 2ENBA 1STGA 5TSSA 4DUZQ 4DK1A 5IT9L 1CSQA 4U673 4J6HA 5M5XH 1NSNS 1G2SA 2EY6A 2IX1A 5ELOA 2JN4A 3PF5A 2F0TA 4A3MB 1ASZA 1F2LA 2NVYB 2LKVA 3STBD 1IW7C 4BS9A 3HOZH 3GTGH 5LL6X 3D31A 4WJ4A 3ITPA 1M8AA 1I6VC 1X3FA 5HY6A 3MQHA 1I4RA 3CD6A 1WI5A 4A3LG 3M3YH 4ME3A 5IYBG 4AQYQ 4DV3Q 4RGMA 4JBKA 4HR7B 4UDUC 2F0WA 3VR5A 3ONAB 4X64Q 4DV0Q 2VB2X 2N78A 3NTHA 4I7AA 4JI3Q 2E45A 5M3MB 3GV6A 3OSOA 3W3AA 2WAQE 1A2UA 3H0GB 3P75A 3CW2C 4P71A 3T16A 3NQTA 5CV7A 3BZKA 5J39A 1ILPA 4GZYC 2N8NA 1SBBB 2F0MA 1BO0A 4B3TL 3BVZA 1UE7A 1SDFA 2L0CA 5IWAQ 2G5DA 4LNQA 2ICIA 4LF4L 1N34L 3A56A 2KJXA 2ZQSA 1PTOD 4RGNA 2ZXOA 2JP1A 4C3IB 4JW0A 2I0QA 1XPOA 2A68C 2L15A 5ELBA 1K9QA 3GD7A 1KD1C 2WP8J 1K9RA 4X66L 1C0AA 3PCOB 3QG1A 5LHY1 1F2ZA 3DM3A 4A3MG 4OGQC 3HOWH 5IGEA 5KYIA 4XYOA 1HR0Q 3H6MA 2XSCA 2JA8B 4JI5L 4X3UA 2BE5D 1JE4A 3KCEA 5C44B 5G3LD 1Y69U 4A3FH 2K5WA 4N8FA 5E1FA 4LFCL 4CKBA 4X3TA 3GTKH 1Q46A 2M8IA 2R92B 2A1AA 1DOLA 3S9WA 1TQOA 4QL5A 3VYUA 3PF4A 1SN8A 3F1ZA 1DOMA 1CUKA 5M3MG 2Q8IB 3TN2A 4NXNL 3H0GG 3KLWA 1VQDA 1I4PA 4OO1G 2F03A 2MP1A 5C4XH 1NY4A 1D5ZC 3J80L 3TMEA 4QCLA 3MAQA 1OXUA 3SK6A 2WB1E 3UDGA 4WFN3 3EBEA 5J3BA 1JMCA 1AE2A 4JI4L 3VYSA 2A6HC 1PMRA 4CBVA 2EXDA 3BDLA 4DN4M 2DK1A 3KAGA 1I6HB 4O42A 1ZXTA 1A0IA 3MXNB 4AH6A 2K14A 3SGIA 1PXUA 5EJWA 5AHTA 4KI0A 5D3DA 5IP7G 1ONLA 4L63B 1EL0A 3CCMA 1JOQA 3E6ZX 3GTLH 1K9MC 1B44D 1D5XC 3K0XA 1LV9A 2V4DA 4IPCA 3MXUA 5IOCA 2JA8G 5GQOA 1JB7A 1B8AA 2NWGA 4CDEC 1U4MA 5C44G 3ODKA 2E8GA 5ELNA 4BXXG 1TWFB 3DEPA 4PZ6A 1SXTA 2R92G 4FO2A 2K28A 1PFSA 2ZM6L 2CQOA 4DV4L 2F0IA 1D5MC 4KN7C 3QOJA 4A3BG 4ABNA 5JPMC 4E6IA 4DR4L 3STBC 4L5QA 4K8IA 3TDBA 3NENA 5CBAE 1EG4A 2WADA 5COYA 2K32A 3K8AA 1JCKB 4IUTA 2FMMA 2UU9Q 1YNJD 4LUZA 2VUMB 1VQBA 5HURA 3KF8A 2JXMB 3N52A 1I4XA 2MHVA 3KABA 3CPWA 4HIMA 3S15H 2N49A 5AJ3Q 5ELEA 2VQFL 4HIDA 1G8ZD 1KAAA 3R3OA 1JWSD 2OQKA 4JBWA 1GD7A 4JCVE 2JA5B 1KABA 4C3JG 5EGTA 1SROA 1GUNA 4ZUJA 2Z4HA 3OPOA 2YTVA 4DAYA 4OWTB 4GKKL 1ET6A 2JK8A 1N36L 1TWHH 1S5BD 3PO2B 4RHSA 5FJ8H 3JAML 4C3HB 1PTOC 2K03A 1F77A 3NK9A 2F0QA 3E5SA 2DJGC 3KAIA 3HP3A 4U84A 1K83B 1OXVA 3S1QB 1TIID 1KLGD 3KUPA 5EKLA 4LF8L 1TY2A 1PH1A 3HOVH 1SYFA 3W1BA 1HR0W 2PNHA 3I72A 5I6WA 3EFXD 3TP6A 1NE3A 4DXGA 4K6LA 2Q2IA 4KJNA 4A3EH 1SNDA 4JI1L 2PZTA 3Q0AA 3VR6A 3MVVA 5I4DA 2QEXA 1GHJA 4YY3L 2DUDA 2ITKA 4LAAA 5CC4A 1IBLQ 2VUMG 4DV1L 1VQEA 2R7ZH 2NVQH 4IJLA 2YTYA 1NR4A 4HJ5A 3J7YW 3D3RA 4JI0L 3EIVA 1L1OA 3GTJB 1VMPA 1KC8C 1XPUA 3J7AV 1BBUA 3Q23A 4IUVA 2JA5G 3A7LA 4JI6L 1EQTA 4POFA 4BA1I 4UHVA 2JA9A 2CW0D 1SR3A 3KDFA 1JR0D 4OIJA 3NPPA 3A5ZB 3I56A 4ZKCB 4C3HG 1TS2A 4IALA 4XTCS 3SHLA 2I07B 4NXML 4JI2Q 1CHPD 1WMVA 2BDNA 4RAUC 4IPHA 5E4XA 2BH2A 1HHVA 4LFBL 4TKOB 1TWCB 1S5FD 4RGOS 4FXDA 1EOVA 4EVOA 1XWEA 1QNUA 1IKLA 2OXPA 5M5WB 1TKWB 1JWMD 1E0BA 3J81i 3HGBA 1VQ7A 1EY6A 5IIFA 5IYBH 1XNRL 2PNRC 5JVH3 1CKMA 3NBHB 2PPBC 4J8QA 1STHA 3S1NH 2EOTA 2HCCA 4PZ7A 2BA0A 2M00A 1T9HA 2Z4IA 2IY5B 3LKXB 3JC66 1ENFA 5LL6S 1YZ6A 4QIWB 3S2HB 1AZPA 1BR9A 3LE4A 2OWOA 4HTHA 1R9TH 1LTID 4IFDH 2Q8RE 1TWAB 3MHBA 3J7A5 4HIKA 2JV4A 1I4GA 1HNXL 2I5MX 4NPSA 3PQIA 4JV5Q 1MHWC 5FO7B 2F0HA 1LM0A 3K58A 2VXWA 3K5MA 1EYGA 5DM63 2F3WA 1EYDA 4GLVB 2B63B 4PMWA 2QILA 1SJHD 3VA5A 5C3EB 4B3ML 4A3MH 4DV5Q 2ZJQA 1A63A 4DAVA 2NVYH 1G291 2D0OA 3ERQA 2LXJA 1TS3A 1WOCA 3NBIA 4XYQA 3VR3A 2AKWB 4ZAIA 3ER0A 2VW9A 3RD4A 4DR7Q 2B2TC 4DXFA 1X6OA 5FO9B 3A55A 4J15A 1GUSA 2EXZA 3DWAA 2XP9A 1SSOA 2EYPA 4HEDA 3G4SA 1WTWA 2B2VA 3CCSA 5M3MH 1O6WA 2B29A 1LACA 4FP5D 2KBNA 3J7ZC 2XP7A 4OO1H 4DNTB 4OIKA 1GHKA 1CZGA 1V1QA 3FKIH 1HH2P 2QA4A 3MZ5A 2SOBA 5I6YA 4IPDA 5E4WC 4L5RC 4A76A 1X3QA 4HJ9A 2B2UC 4DGZA 4JBJA 3UDIA 5D65A 4C3IH 4GLXA 2AWOA
chains in the Genus database with same CATH topology
2JEBI 2E2IB 3R8BA 5D3IB 2Y0SB 1NMVA 3I55A 4XT3B 4HSPA 1RF2D 4JOIC 3L7ZC 5IP7H 1PFNA 2Z8LA 2E5LL 3NEMA 5C3EG 1I94L 4GNXC 2I5HA 1YNNC 4ZYSA 5T1IA 2QDBA 4QJFA 2YSFA 3HOXB 2JA8H 2A6EC 2XWJB 4OX9L 1VQFA 2CW0C 2FJ2A 2DNEA 4HMIA 1PH7A 4BXXH 1S5CD 1RTNA 5D14A 4B3RQ 1EEFD 1K3RA 4KJOA 2R92H 4GN5A 1IZ6A 4LFAL 2EYLA 4BBRB 2YSIA 1YI2A 1J6QA 1BCPD 3NP8A 5IGFA 1IBML 2EE1A 4A3IG 2F21A 3H91A 3D6CA 2ALYB 1ASYA 1D1KA 1N33L 1SYGA 1R4PB 3NE5B 1VS0A 5JVG3 4M1UB 2SDFA 1JICA 4TQUS 2HQEA 1U0LA 2GN5A 2XP6A 4BY7B 1JWUD 3K5OA 2RA4A 2JXWA 2F0UA 2PW7A 4RGTA 4LWCA 4X62Q 2B2VC 4RCOA 4LUVA 4HJ7A 1I6HH 2F3IA 1SRUA 3IAYA 2HDMA 2AUJD 4NDXA 4QGUA 2XP5A 1I4QA 2B8GA 4F88A 2Z6KC 2F0KA 1NTGA 2IX3A 5CV6A 1LT3D 5FLXc 4CGYB 1K0RA 3UDFA 3S2DB 4LF6Q 1J8IA 3F8TA 5GROA 3FEWX 1YVCA 2VQEL 5JJLA 3N6RA 3HOXG 1AH9A 1EYCA 2A68D 1HNWQ 2UXDL 1SYCA 4ODGA 1KRSA 4B3TQ 4KD3A 1D7QA 1EY5A 3HRZC 1UE6A 4LF4Q 1N34Q 3VYRA 3SVMA 1CA6A 4BBRG 4B3SQ 3ZYYX 2EY1A 1PRTC 2F1MA 4RA8A 4EX5A 1E1TA 3J80i 4A3JB 4OONA 5CBEE 1W6KA 4X66Q 1A3TA 1V43A 1YBYA 3K7UC 3HS0C 4R1JA 4UAIA 3EN2A 2NZOA 1PYWD 2PMZB 1SLJA 3RN5A 3OWEB 2GVBA 4P74A 1SNOA 4BY7G 4PZ8A 2A5HA 4R4TA 4AYBE 5KNBA 4QUCA 4YWMA 2F4VQ 3IRBA 5IGDA 1Q1EA 4JI5Q 2KEDA 1TR8A 1HNZL 5BN5A 5K5PA 2D5DA 4EGVA 2JA5H 5DNFA 5KGUA 2GA4B 4KY7A 1KTKA 2XVSA 1B7YB 1WTOA 2HHHL 2K52A 2RF4A 3CCVA 1JB3A 1EWCA 1L2FA 2TSSA 3DUZA 1NJIC 1YJWA 3CCJA 1Y1VB 3TQYA 4NXNQ 3PO2H 3ERSX 3OOBA 4C3HH 1SYBA 1ESFA 1LTAD 4LUOA 3A54A 2KECA 4CKEA 3U4ZA 1VQOA 1A6XA 3EVQA 3S1QH 3DEOA 1E24A 2DGYA 4YCVA 1CSPA 3UE1A 4RKBA 2NTSA 1PFBA 1TT2A 1RP5A 2HCIA 3ND8A 1PLFA 4CJ0B 3M9BA 1EU3A 3E9HA 4JI4Q 2A73B 4A0UA 5IYDG 3ZJYC 2ZQVA 4A3JG 5C0XG 3S16B 3MEFA 3GTOB 3H3VC 2O2LD 1U9RA 1MI2A 2IJ0A 2H1EA 1V1PB 3D4DA 1AFPA 2XP8A 1RL2A 3QO2A 3NWSA 1E22A 4KD4A 2K01A 3F2UA 5E62A 2F0JA 1VF5C 3EA6A 1IYVA 1HCZA 3TC5A 1BCPC 3LWUA 4WRDA 3GTMH 1QB5D 4FXKC 2RBMA 1E3PA 4DUYQ 2JA7B 2TMPA 1PYBA 1XX8A 2ZM6Q 1KDBA 4FF4A 4DV4Q 3JAMi 2LMCB 3BZCA 1Y1VG 1BDOA 3NELA 3NXWA 1HUMA 4PG3A 5GADC 1H9SB 2K75A 4PMBA 1VQHA 4XXEA 3AYHB 1QILA 3CQZB 1D2BA 4IOCA 4IFDJ 1TWCH 1SJED 1TS4A 2ID0A 1VQIA 2YSBA 5M5WH 2F0SA 1DXMA 1MGSA 1L0YB 4GKJQ 1VCIA 2VQFQ 4JYAL 1QVCA 2XGTA 2PQAA 2L4NA 2RE3A 4DAPA 5JJZA 4HJAA 1Z47A 1KDCA 2DMVA 3BU2A 5C4JB 1E1OA 1HQRD 1RJTA 4A3KB 3F2DA 3CCUA 1ENCA 4GKKQ 4ME5A 3LX0A 4JI8L 1K8AC 5CGKA 1I5FA 4KHPL 1IXRA 2E75C 1BBXC 3RLNA 2C5CA 3S2HH 3E0EA 1PTOF 4IPGA 3L9AX 1S72A 3T51B 1JC7A 5FOBB 3E9IA 4Z9CB 4UP7A 1G51A 1HRJA 3CU7A 2MFIA 2E2JB 1JORA 2JA7G 3U9OA 2AWNA 4BY1B 3DWQA 2RVLA 5LMNL 5H1SE 2F0GA 3S1RB 2RDGA 3RZDB 3HOUB 4DV7Q 1PHJA 5J22A 4C2MB 4FF3A 1GVPA 3ND9A 1OXTA 3C1FA 1NR2A 3TZUA 1RDPD 3HFZB 4JI1Q 2WINB 4P75A 4A3BB 4EQNA 3GTQH 2RKSA 1QUQA 2B63H 4KMUC 4YY3Q 2ZQUA 4XQJA 1UE1A 5G3LF 3I8ZA 1XTCD 1G6ZA 4DV1Q 1YHQA 3KLSA 4DR5Q 4RHRA 1EQVA 1DOKA 1H95A 5C0XI 3DLLA 2EPBA 1J9OA 4A3GH 4IUQA 2NTTA 4A3DB 1Q3LA 4NB3A 3J81c 4K5WA 1C4QA 4XDXA 5BN3A 2N3SA 1LTRD 4A3KG 4LF9L 3SK8A 2D2CC 2XP3A 1IKMA 3M4YA 4HAEA 4C3JB 1UUPA 3AB9A 4L8JA 4J1MA 2N55A 5C4ZA 1TK7A 3KFUA 1KNAA 1FJGL 4NXMQ 1T5XD 3I4MH 2O4XA 3OYYA 2C9OA 5IGGA 3MC0B 4LFBQ 2O5JC 2BH8A 1DONA 2Y8NB 2FMCA 3HOYB 2L55A 2LY7A 1NBWA 3D0FA 4YWLA 1B50A 4BY1G 1Q7YC 1CA5A 4DUZL 4KKUA 3T56B 4JG2A 3HOUG 1DJRD 4K5VA 1XYIA 4DK0A 3HKSA 2O5IC 3L4HA 3J7AF 1XNRQ 1F9SA 2DK7A 1WD1A 1STEA 1N32L 1VQNA 4A3CG 1CQFA 3PO3B 4KY6A 2IW3A 3FHWA 2M3OW 3FSCA 1MSGA 1STNA 4A75A 3NQIA 3HKZB 4LMQD 1DZ1A 4X65Q 3CHBD 1RKNA 2OTJA 4DNIA 3OWFA 1JOKA 2ZAJA 4DR3L 4P73A 2QF7A 2ZXRA 2NVXB 4A3DG 4Q5VA 2XNAC 2HUGA 2EYOA 1X54A 3VA7A 4X64L 2FHTA 5M3FB 3TP7A 4IO9A 3C46A 3W1GA 1WYDA 3P20A 4ZUIA 4BBRH 3CMEA 5EPLA 4KHZA 1X32A 4DU9A 2J7ZA 1RIPA 3T1HL 3I91A 1QCBD 1QVFA 1Z9FA 3TBIB 1HZ9A 3TCZA 1BF4A 2XN9C 1VQ9A 1NCVA 5FO8B 2XPBA 3S14B 2KA7A 3HOYG 3WOEA 3MCBA 4BA2I 1A8VA 1EQRA 3CP0A 4OWWB 1ZEQX 5EPJA 4C56C 3G6EA 1ZKOA 5IT9c 1ILQA 4LF7L 3KJOA 5IP9G 1ZYRD 1AZQA 1H9RA 4KKTA 4YHHL 1D6EC 3S2DH 3PO3G 4FNFA 1RCVD 4M8AA 4C1NK 1EEID 1EZ8A 3X3MA 3HKZG 4O0AA 2HIXA 3TEHB 2Z1CA 4ALPA 4WJ3M 5NUCA 4HMJA 1SNCA 1PH3A 1IL8A 2G9DA 1B3AA 5JJIA 2L1BA 3PUYA 1Z7TA 1GKHA 5M3FG 1R4QB 2RSNA 4LK1C 5C5MA 1X55A 1YNND 1PA6A 1PTOB 5IYDH 3U58A 2A6ED 2ES2A 3TS2A 4R8NA 3S17B 5T1GA 3IFDA 4XQNA 5C0XH 1EY7A 2B2TA 1HTPA 2NZ1D 3L3OC 3C2PA 3K81C 4POGA 2EJFC 2I5LX 1GOZA 5JJKA 3A5UA 3GTGB 1O7YA 1SNQA 2K5HA 1YEZA 4OX9Q 4UY8C 5C3WA 3M3YB 3K7AH 1BNZA 2K04A 1O7ZA 1PH5A 2NUCA 5IGCA 2DWVA 5C3XA 4A3LH 5E5WA 4HJ8A 4LFAQ 5IYCG 2MUYA 4XQQA 4U86A 2B2UA 1U4LA 1PZID 3C1EA 1A3VA 4DNRB 2BA1A 1Y1WB 3AQQA 1SMXA 5CMDA 3TZDA 1MKHA 2UUCL 1N33Q 1LO5D 4JOIA 1Y8NB 5KYLA 4AYBB 1HZAA 4GNXA 3V2TA 4GOPC 3KF8B 2UXBL 3RZOB 1UEBA 2L11A 1I4HA 1XMQQ 2LFNA 1PYSB 2LXKA 1SNMA 1UAPA 3GTOH 2XTIA 3J80c 2IHFA 2R7DA 2EYFA 5AJ3L 4H44C 2R61A 4DAYB 3K59A 2VQEQ 4IURA 1PH6A 5AFWA 2ZJRA 5J1ZA 1PRTD 2C35B 3K6OA 1HUNA 1EQQA 2F0LA 4OHJA 3SR1A 4P2CB 1M1KC 2UXDQ 3KLSX 1JMQA 2XWBB 1Q90A 1L0XB 1NUCA 5E7NA 4L5SA 3BYTB 1JJCB 2JA7H 2EJGC 1NMFA 3ICEA 4ZK9B 2JMFA 4N9PA 1NAPA 3FP9A 1CKOA 3CKIB 3KF6A 2R6GA 1FLCA 2B39A 1J5EL 2KHIA 3KAHA 1Y1WG 1Y8PB 3H0GH 2Z6KA 4QB4A 4A3IB 4OWXB 1SE4A 3R2TA 1PH8A 3CQZH 1FR3A 2JJQA 2RSOA 3OMCA 1HA6A 1CTMA 4AYBG 1F8AB 1EY0A 1FNUA 4KV6A 1QNKA 1ZYRC 2BOSA 3MTSA 2RQXA 1MSHA 4PQXA 1LTSD 3M85A 1SE3A 3I2ZA 3TRZA 3AFQA 1JJGA 2YU9B 3F2BA 3KK7A 4G7HC 1VQCA 1HNZQ 1A2TA 3W2DA 2JEAI 2PZWA 1L1OB 4MTNA 2WIIB 5C4JH 1IBLL 1HA5A 4MNOA 2KCMA 3FS8A 4A3KH 2B8FA 4IUUA 2EY5A 5A2QE 3GTLB 2HHHQ 2YTXA 1DD2A 3CRLC 1KHIA 1LT6D 2CWPA 4DV6L 4OL7A 2R3ZA 1QZGA 4G7ZC 3KDFB 2EQSA 2WAQB 3MFGA 1LYLA 3VYTA 5I2XA 4BBSB 1CKNA 4LJZC 1MD2D 3NTKA 3K5NA 3J81j 1QE6A 1X3EA 2E2JH 2Q5AA 5C44H 2LS01 4BY1H 3FMCA 3SEBA 1EG3A 3BJUA 3TP8A 3S1RH 3FDTA 3RZDH 4C2MH 2IX0A 1WD0A 4OXPA 4H0LC 1B4OA 5C5LA 4EQ5A 1PVOA 1N9WA 1V9PA 3B6YA 1BVSA 2WV6D 1RHPA 4A3BH 1Q81C 3U9SA 2KENA 2QEJC 4DR6L 1PINA 2XRSD 2OEOA 4H13C 4U68A 1BXTA 2MGSA 3S15B 3SK4A 4QQBX 1TR5A 2Q2HA 4IN3A 1Z6HA 2UUBL 2NBFA 1B70B 5CORA 2A8VA 1X65A 1CQVA 3GV3A 1CZWA 1BCPF 3OOCA 4IUNA 4K14A 1TU2B 1KRTA 2R7FA 3T1YL 3KBXA 2BDOA 4R4QA 2K5NA 1TWHB 4C3JH 1HTLD 4FYDA 1QOHA 3I4OA 3LWEA 1K8MA 2WAQG 4UP8A 3A74A 5ISRA 1LTLA 4HSVA 4G4KA 1VQ5A 1Q86C 3T13A 4BBSG 1E2VA 3FRPB 3V96A 1F2MA 3I4NB 2EVBA 1Q8KA 1OXXK 2ZT9C 2RHQB 4TRDA 1DM0B 2WB1B 3O13A 4FF2A 4EQPA 2AQ3B 3AMUA 1Q8IA 2CHBD 1WTPA 4PMCA 1TWFH 5BR8L 2DY8A 4JI7L 2K5QA 4A3EB 3CC7A 2MO0A 4JYAQ 3DM1A 3MFYA 2HIVA 4DK3C 3MA2B 5M5YB 5IP9H 1V1OA 1X3PA 3PO3H 4R4IA 1MJEA 2CFMA 1ML0D 1LTTD 1H9MA 1FYCA 2KHJA 4YCUA 5GAHC 2F4IA 4ILWA 4JI8Q 3K0YA 3TSSA 4DV2L 2VUMH 4KHPQ 1TY0A 4GN4B 4DR7L 3PIPA 4XT1B 2KEEA 5I9OA 2NVXH 3CNGA 4B9XA 2OTLA 3H09A 5M3FH 5CQ2A 3IKJA 1E2ZA 2FFKB 3MXGA 3P1HA 2HQLA 3G6JB 2MNAA 1YIJA 2EYHA 5LMNQ 4LFCQ 3U4VA 3SE0A 3QIAA 4RCNA 3C3LA 3RR5A 1C7YA 2V1CC 1GXDC 2ATWA 1CFMA 2JE6I 3UI2A 1F2YA 3I4NG 4PNYA 1I50B 3OW2A 2GVAA 3ULLA 1YITA 1VQGA 3BVMA 2WB1G 1I5HW 1K83H 1VQ4A 3M4OB 1GJXA 1Q82C 1C9OA 3KLRA 4FF1A 3CMAA 4A3EG 2E74C 2UUAL 4ID6A 5JEAG 1M4VA 1G91A 5I9PA 1A62A 5ELDA 4QY7A 2MQHA 3PV0A 4MN3A 2N88A 4XIGS 4LF9Q 2Q8TA 1IL2A 5FLXE 2R7ZG 2K5VA 2Z0SA 4O2DA 2YV5A 2ZTEA 2OF1A 2PI2E 3H94A 1UNSA 2EY2A 1R9TB 2G9HD 2B2WC 2BCOA 3MXNA 5CV4A 4DA2A 1FJGQ 3D6WA 2M9VA 1EUJA 4ZKBB 4ZLTF 1EY9A 2EZVA 3GTJH 2ZR4A 1PDQA 1XPRA 4YWKA 3GTPB 4NW2A 1PTOH 3EJIA 5KNCA 4DR1L 2PW5A 1KLUD 2F3VA 4B9WA 3S17H 4MIUA 3CCEA 1MBYA 1IYUA 1I3QB 1AW7A 1N32Q 4EQOA 4DR4Q 4NKLA 2F0VA 1XMOL 5A35A 1O7IA 1LTBD 3HZXA 1EFID 1XNQL 1CM9A 1GUWA 4X62L 1LT4D 5DLQE 3NTIA 2NZHA 1IBKL 1SMYD 4DR3Q 4DR2L 2Y0SE 1EIYB 4KKSA 4IQZA 4LF6L 2MDIA 5IE8A 3GDEA 3G48A 1QWYA 2AMCB 4CJ2C 3Q6SA 2NVTB 3PIOA 1SE2A 1FNWA 1BCPB 1HNWL 3I4LA 3OIQA 3FKIB 1Y1WH 1STBA 3T1HQ 1MIUA 1N36Q 4RH6A 1E7ZA 4IFDG 3KJPA 1JT8A 2DY7A 4R8IA 1TXYA 3NTPA 4B3SL 1H9KA 3D8GA 3A8KE 3K80C 3CCLA 3RZOH 3NUCA 5CV9A 3BVGA 4LF8Q 1T5EA 5FK9C 4A93B 1TWAH 2E2HB 2KHSA 1ENAA 4RG1A 4LF7Q 3CXCA 5A2QL 2IHEA 4Y7NB 1PH4A 3CF5A 5LMNW 4YHHQ 2JYOA 3BDOA 3LNNA 1XJVA 2F4VL 5EQ0A 5C3EH 2KXQA 4R4CA 3G7LA 3WDNA 1S5ED 1W3SA 1PH2A 2QKIC 2K7VA 4QIBA 1P8LA 3DHQA 5LMUL 2F0EA 1YHBA 4JI0Q 3F2CA 5IY0A 3BYYB 1UWVA 4V0BA 3OW7A 1SFOB 1EY4A 3OTOL 4JI6Q 5HGQA 4G57A 5EKKA 2IL8A 2WACA 3NHHA 1VQ8A 1Y14B 3IFTA 3FKIG 2KOLA 1FGBD 4KHVA 4A3IH 2KUMA 2RHSB 4LF5L 2UXCL 3EQLC 1TWGB 5DAUA 4WJWA 2L9HA 4C3IG 1BQQT 2NYZD 2F0PA 1FD7D 1VQMA 2DJYA 2YU9H 4K0KL 1H9JA 3A7AB 1P16A 4A4IA 4A93G 2A74C 5JPNC 4GLAC 3AU7A 2AHOB 4TSSA 2E2IH 3RLOA 2OQ0A 1YJNA 4K2LA 3QOLA 2PMZE 1WJJA 2QGQA 4HCSA 4TVAB 2F0NA 2F52A 3PUWA 4K2KA 4JK1C 1YNXA 2QCPX 2RDFA 4CJ1B 3KBGA 4BBSH 4DUYL 1ZCNA 2UUCQ 2ZTDA 5E66A 3HOXH 5ELFA 2EYJA 2LSSA 1WCMB 2X69A 2JA6B 2ZJPA 4AQYL 1N8RC 3NBHA 4DV3L 1CK1A 1HFGA 2KCNA 1D1IA 4IJHA 3UE0A 2ZXPA 3NWTA 3TP5A 3S1MB 4DV0L 2UXBQ 3FPUB 4IFDI 2M8JA 1HZBA 4JI3L 4K6DA 5K36G 1PZKD 3CCQA 4K5XA 5F2DA 3LKXA 1STYA 2PQAB 3DWPA 3WH0A 4G7OC 4IUPA 3BDCA 5KRUA 1HNXQ 5EKIA 2J4XA 2DNCA 2K05A 1E2WA 1SMYC 1EOTA 1F9PA 2NN6G 2IT1A 3GO5A 3QWNA 3IL8A 2B3GA 2SNMA 2XRQD 2VS1A 5IWAL 4GKJL 2SEBD 3TDQA 4V190 5FLMG 4JC0A 4B3MQ 1XXGA 1PV4A 1WVLA 4BY7H 2A19A 1FGUA 3KADA 2AQ2B 1L0WA 1AN8A 2KQ3A 2HDLA 2K4KA 3URYA 2WKDA 5M9OA 2VNUD 1HJPA 3RNUA 3J81E 1PFMA 4GOPA 2D62A 2B2YA 3H3VI 4KTAA 3WOFA 2PI2A 2XIWA 1ET9A 1J5EQ 1HR0L 3PUZA 3L0OA 2ASBA 4OO1I 1Y8OB 2JSOA 3I4NH 1B9MA 1QUQB 1WCMG 2PZUA 2JA6G 1KXLA 3SXHA 4ZQ3A 2K50A 1B9NA 4DV7L 2R93B 1VF7A 4H02A 3OMGA 4YCWA 2VZAA 1TVXA 1WTRA 1B53A 2ZQTA 1KNEA 4FVMA 4N9TA 3PUVA 4GN3B 2VY3A 4DK6C 1SNPA 5EBDA 4F8MA 4U85A 3A8IE 5M5YH 4CKCA 5C4HA 5JEAH 2BE5C 3UDXA 4DAMA 1VQJA 3D4WA 1EWHA 1FL0A 4DPGA 3V05A 5M5XB 4DFAA 1HZCA 2QRVA 3RN2A 4A3JH 1VMCA 5FLXL 1OTCA 4L6TB 1OO9B 3RLFA 3RMHA 4DR5L 3T53B 1WTXA 4DV6Q 1JQYD 2CWAA 1TS5A 4UPAA 2E5LQ 2IWHA 3WWVA 4MZ9A 1G6PA 1EIGA 1I94Q 3RUZA 3HOZB 2HT1A 1EIFA 3GTMB 3GP7A 4KN4C 2K6AA 1IYJB 5GAGC 1YW5A 1YHAA 5E64A 3HEJA 5CYUA 3H15A 1NMGA 4QMGA 2WAEA 1CHQD 1EZ6A 3S24A 4FXGC 1X3GA 3ULPA 3PO2G 1EFWA 4A0TA 4QUFA 1QJOA 2K33A 1HXYD 3QJYA 1KL9A 1Y1VH 3LGJA 2SNSA 1K8GA 1IBMQ 1XTDA 1I50H 4DR6Q 2EJMA 2X6LA 2MPMA 3M4OH 2FINB 3OHXC 2R93G 3NSWA 4L5TA 2XP4A 3KAFA 4B08A 2UUBQ 5ELCA 3DMUA 2NN6I 2B2YC 1HFNA 4ZRZA 3MQGA 4C1NI 3BS1A 1EIHA 4APVA 4UP9A 3T1YQ 5IT9E 1DCZA 3I70A 1IHZA 4X3SA 3S16H 4X65L 2UU9L 2KVMA 2EYMA 1B2TA 2YSHA 2L5TA 3CC2A 1BBWA 3HOWB 1AP0A 1VQ6A 2E76C 3HOZG 3A8JE 3L2PA 2MJ8A 1RTOA 2JX8A 3Q24A 4A3FB 4JBMA 5IGBA 1RD9D 1V8QA 1W6JA 1W2BA 2F0DA 3X3NA 3GTKB 1YNJC 3QB3A 1D8LA 3GTPH 1S3OA 5EPKA 1VQAA 2F0FA 5BR8Q 3MCBB 4JI7Q 4O1NA 1CT1D 5CR3A 1VQPA 1EU4A 3GTQB 2L4JA 1KAWA 3CRKC 2EDGA 2RCNA 1I3QH 4R9WA 1L1OC 1PRTF 5C4XB 1C8CA 4F7XA 4GOPB 3T4AC 2I46A 2CKZB 4KK7A 2MO1A 2VB3X 1KIXA 1O7LA 3BG3A 3PIP3 4K8JA 4H7BA 2VL6A 1AE3A 4DV2Q 4REXA 4A3GB 1C48A 2YAJB 2A69D 4I65A 1YJ9A 3VR2A 1QZHA 3HG9A 3H3VH 4RWSC 4QF4A 4ULLA 1HQMC 5JOBA 1DYQA 1OXSC 4NP5A 1PH9A 1GUTA 1VDZA 3D4RA 1RODA 2CCZA 2NVTH 1BOSA 1SE8A 1JOOA 1LTGD 2WKCA 1GO3E 1ESRA 3HOWG 3HKZE 2AQ1B 3I4MB 5EBCA 2H4OA 5E65A 3CPFA 1WTQA 4HN7A 1X56A 1G2TA 4HCEA 4A3FG 5EAYA 1EY8A 2F0OA 3M7GA 1K8OA 5I2YA 1Q12A 2CVRA 5U47A 4A93H 3R93A 2OCEA 2E2HH 2UUAQ 2K1BA 2B63G 3HOUH 1LLRD 4GS3A 3I90A 3PMFA 2LAJA 1U4RA 4S3SA 4Y7NH 2PO4A 3CAMA 4JI2L 5C4XG 5DEHA 3JAMc 3CCRA 4IOAA 2EZ5W 1BUVT 3J80E 1O78A 3BZDB 3U50C 1PZJD 5E3FA 4A3CH 4NMZA 1WR7A 3EROA 4A3GG 3OIPA 3FSBA 2ZR5A 3SK5A 3DXJC 1AEXA 3M4PA 1QG7A 2ZR6A 4A3DH 3AFPA 3TS0A 1IW7D 4BWGB 1SFOH 3FVQA 2FXQA 4GNXB 1V1PA 1SEBD 1M90C 2KCCA 5K36H 4DR1Q 4CHTB 5KEEA 5CV5A 2E2DC 3W5OA 2KCTA 3I4MG 2H5XA 2AUKA 2NN6H 1TWGH 1XMOQ 2J0TD 3PUXA 1EWIA 1XMQL 3HOVB 1U4PA 3I3CA 1XNQQ 1LUZA 5FLMH 3R2IA 1B1ZA 3PGZA 1WTVA 3M4QA 2Y0SG 3HOYH 1S4ZA 2X6GA 1IBKQ 3MWYW 4R4OA 1X9NA 4IZ8A 4DR2Q 4JV5L 1FNVA 2B2WA 1H9SA 1WFQA 3Q8DA 3J81L 2IPKD 3PIO3 4HIOA 4X6AH 4PV1C 2YYZA 1EYAA 3ULJA 1VQKA 4AIMA 4WORA 4DV5L 4KY5A 2EIFA 5C6AA 4P72A 1DGSA 3MXPA 5BN4A 2R7ZB 3KF6B 2NVQB 1F9RA 3TREA 4KLKA 1GM5A 4RKLA 5IODA 3K57A 1LT5D 3VDYA 3Q22A 2Q2TA 1VQLA 3FPPA 2DN8A 1WCMH 1S5DD 1SYDA 2JA6H 1F9QA 3KOJA 3CC4A 2OT2A 3VR4A 4LW1A 1UEAB 5KNDA 1O80A 1GUGA 3S1MH 4E5RA 1ICWA 3M7NA 5FKAC 2CQAA 2K5DA 5FJ8G 3K5LA 2NB0A 2A69C 2ZTCA 4FDBA 3JAME 2PCFB 1LABA 4F87A 5HGTA 3MEHA 3P7JA 2PYKA 4QIWE 5GAEC 3SDZA 3E0JA 1HPCA 1FVIA 2M2LA 1A3UA 3HOVG 1K73C 2PQEA 5KIXA 3PQHA 3K7AB 4RFBA 3S14H 1PRTB 3A0JA 1S40A 4DKAC 2D9UA 1U5KA 2YSGA 2WFWA 1QVGA 3PSIA 1CKNB 5LMUQ 5JEAJ 3G71A 1A15A 1JJ2A 1CI3M 5DM73 3KYHC 2RDHA 3S1NB 5C0XJ 1GUOA 2A6HD 1II3A 3I73A 3OTOQ 2Q2UA 4MHEA 3GQBA 2ICEC 5CV8A 2L12A 4Y52H 1SYEA 1MJCA 5IYCH 4RMFA 1BKBA 1SAPA 1KQSA 4YIJA 3AEVA 5JAVA 1STAA 4I7ZC 2XPAA 1Q1BA 4Q0FA 4X3KA 4LF5Q 2UXCQ 4DF7A 4B3RL 1UE5A 2D0PA 1KDAA 2R93H 1JE5A 3I7FA 4K0KQ 2JQOA 2ENBA 1STGA 5TSSA 4DUZQ 4DK1A 5IT9L 1CSQA 4U673 4J6HA 5M5XH 1NSNS 1G2SA 2EY6A 2IX1A 5ELOA 3PF5A 2F0TA 4A3MB 1ASZA 1F2LA 2NVYB 2LKVA 3STBD 1IW7C 4BS9A 3HOZH 3GTGH 5LL6X 3D31A 4WJ4A 3ITPA 1M8AA 1I6VC 1X3FA 5HY6A 3MQHA 1I4RA 3CD6A 1WI5A 4A3LG 3M3YH 4ME3A 5IYBG 4AQYQ 4DV3Q 4RGMA 4JBKA 4HR7B 4UDUC 2F0WA 3VR5A 3ONAB 4X64Q 4DV0Q 2VB2X 2N78A 3NTHA 4JI3Q 2E45A 5M3MB 3GV6A 3OSOA 3W3AA 3H0GB 1A2UA 3P75A 2WAQE 3CW2C 4P71A 3T16A 3NQTA 5CV7A 5J39A 1ILPA 3BZKA 4GZYC 2N8NA 1SBBB 2F0MA 1BO0A 4B3TL 3BVZA 1UE7A 1SDFA 2L0CA 5IWAQ 4LNQA 2ICIA 4LF4L 1N34L 3A56A 2KJXA 2ZQSA 1PTOD 4RGNA 2ZXOA 2JP1A 4C3IB 2I0QA 1XPOA 2A68C 2L15A 5ELBA 1K9QA 3GD7A 1KD1C 2WP8J 1K9RA 4X66L 1C0AA 3PCOB 3QG1A 5LHY1 1F2ZA 3DM3A 4A3MG 4OGQC 3HOWH 5IGEA 5KYIA 4XYOA 2JA8B 3H6MA 2XSCA 1HR0Q 4JI5L 4X3UA 2BE5D 1JE4A 3KCEA 5C44B 5G3LD 1Y69U 4A3FH 2K5WA 5E1FA 4LFCL 4CKBA 4X3TA 3GTKH 1Q46A 2M8IA 2R92B 2A1AA 1DOLA 3S9WA 1TQOA 4QL5A 3VYUA 3PF4A 1SN8A 3F1ZA 1DOMA 1CUKA 5M3MG 2Q8IB 3TN2A 4NXNL 3H0GG 4OO1G 1VQDA 1I4PA 3KLWA 2F03A 2MP1A 5C4XH 1NY4A 1D5ZC 3J80L 3TMEA 4QCLA 3MAQA 1OXUA 3SK6A 2WB1E 3UDGA 4WFN3 3EBEA 5J3BA 1JMCA 1AE2A 4JI4L 3VYSA 2A6HC 1PMRA 4CBVA 2EXDA 3BDLA 4DN4M 2DK1A 3KAGA 1I6HB 4O42A 1ZXTA 1A0IA 3MXNB 4AH6A 2K14A 3SGIA 1PXUA 5EJWA 5AHTA 4KI0A 5D3DA 5IP7G 1ONLA 4L63B 1EL0A 1JOQA 3CCMA 3E6ZX 3GTLH 1K9MC 1B44D 1D5XC 3K0XA 1LV9A 2V4DA 4IPCA 3MXUA 5IOCA 2JA8G 5GQOA 1JB7A 2NWGA 1B8AA 1U4MA 5C44G 3ODKA 2E8GA 5ELNA 4BXXG 1TWFB 3DEPA 4PZ6A 1SXTA 2R92G 4FO2A 2K28A 1PFSA 2ZM6L 2CQOA 4DV4L 2F0IA 1D5MC 4KN7C 3QOJA 4A3BG 4ABNA 5JPMC 4E6IA 4DR4L 3STBC 4L5QA 4K8IA 3TDBA 5CBAE 3NENA 1EG4A 2WADA 5COYA 2K32A 3K8AA 1JCKB 4IUTA 2FMMA 2UU9Q 1YNJD 2VUMB 4LUZA 1VQBA 5HURA 3KF8A 2JXMB 3N52A 1I4XA 2MHVA 3KABA 3CPWA 4HIMA 3S15H 2N49A 5AJ3Q 5ELEA 2VQFL 4HIDA 1G8ZD 1KAAA 3R3OA 1JWSD 4JBWA 2OQKA 1GD7A 4JCVE 2JA5B 1KABA 4C3JG 5EGTA 1SROA 1GUNA 4ZUJA 2Z4HA 3OPOA 2YTVA 4DAYA 4OWTB 4GKKL 1ET6A 2JK8A 1N36L 1TWHH 1S5BD 3PO2B 4RHSA 3JAML 5FJ8H 4C3HB 1PTOC 2K03A 1F77A 3NK9A 2F0QA 3E5SA 3KAIA 3HP3A 4U84A 1K83B 1OXVA 3S1QB 1TIID 1KLGD 3KUPA 5EKLA 4LF8L