2BA1A

Archaeal exosome core
Total Genus 36
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
36
sequence length
179
structure length
179
Chain Sequence
MRFVMPGDRIGSAEEYVKGEGVYEEGGELFAAVAGKLIIKDRVAKVESISPIPEIVKGDVVLGRVVDLRNSIALIEVSSKKGENRGPSNRGIGILHVSNVDEGYVKEISEAVGYLDILKARVIGDNLRLSTKEEEMGVLRALCSNCKTEMVREGDILKCPECGRVEKRKISTDYGKGEW
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Archaeal exosome RNA binding protein CSL4
publication title Structural framework for the mechanism of archaeal exosomes in RNA processing.
pubmed doi rcsb
source organism Archaeoglobus fulgidus
molecule tags Rna binding protein
total genus 36
structure length 179
sequence length 179
chains with identical sequence B, C
ec nomenclature
pdb deposition date 2005-10-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF10447 EXOSC1 Exosome component EXOSC1/CSL4
A PF14382 ECR1_N Exosome complex exonuclease RRP4 N-terminal region
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.20.70.10 Mainly Beta Single Sheet Ubiquitin Ligase Nedd4; Chain: W; Ubiquitin Ligase Nedd4; Chain: W; 2ba1A03
2.40.50.100 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 2ba1A01
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 2ba1A02
1CI3M 4JI7L 1X3FA 1V9PA 1GKHA 1U0LA 4GZYC 3U58A 4A3DG 4DR1L 1LACA 1HZCA 2M8JA 4L5QA 1W2BA 4HR7B 2KHIA 3NTPA 4AYBE 4K0KL 1E22A 4NXMQ 2K32A 2R7FA 4MNOA 3BG3A 1VQKA 3CD6A 4YHHQ 2XGTA 1NMGA 3RLFA 2MFIA 4ALPA 1K8GA 3T53B 1E24A 4LF8Q 4LFAL 2JA5G 5ELOA 1HTPA 3A8JE 4J15A 4QIWE 1XTDA 3A5ZB 5IP7H 1HCZA 2Z6KC 2HQLA 5C3EG 4IO9A 5IYCG 4JI4L 4H0LC 2E75C 3KJPA 3PUXA 4JI5Q 3F2BA 1HZAA 3RR5A 4E5RA 3W1BA 2DK7A 1Y69U 2L15A 2UU9L 3ERSX 3UDIA 2VQFQ 2Z0SA 1I3QH 3FKIH 4NXNL 1N33L 4DV1Q 2HIXA 1Q1BA 4HIDA 2IX1A 1OXTA 1M1KC 1QUQA 1NMFA 2IX0A 2F4VQ 4A3IG 3PIPA 4QQBX 2WFWA 4GOPA 2N8NA 2WB1E 3CCJA 1TU2B 2VQEL 1X3EA 4GKKQ 1Q81C 1HNZQ 1XPRA 4C3IH 4HJ7A 2IY5B 2DN8A 4HJAA 4IFDH 2E76C 2HHHQ 4GLAC 2O5JC 1JT8A 3K81C 3STBC 1ZKOA 3GQBA 2PPBC 2IHEA 2UUBQ 1ZCNA 4AQYL 5M3FG 2ZR6A 3CP0A 2ZQUA 3HKZG 3LGJA 3CF5A 4KHZA 1A6XA 2AKWB 5M5WH 1H9MA 2CCZA 5IYBG 5BN4A 2YSFA 1EWHA 1OXXK 1EIYB 5AJ3Q 1FVIA 4DR5L 1U5KA 2XP6A 1E2WA 5KNCA 2EZ5W 2ZQTA 4OGQC 4X65L 1JJ2A 1QVCA 2JA5H 4JI7Q 3TZUA 1H9KA 3AEVA 4PZ6A 2XPAA 1Z6HA 2BDOA 2KCCA 4DR1Q 3RNUA 3BZCA 3RLOA 2PQAA 5C3EH 4R4CA 2K75A 3E9HA 5IYDH 2B8FA 5IYCH 1H9SA 4K0KQ 2EQSA 3CCEA 2OCEA 2QF7A 4QL5A 4X62L 1JE5A 3M4QA 4KKTA 1E2ZA 1P16A 2Q8IB 3SDZA 4JI8Q 2NVTH 2CKZB 1QZHA 3CC2A 1T9HA 1K8OA 2A6ED 4DK0A 4JI4Q 5KNDA 4A3IH 3H15A 2AHOB 5C0XG 1YJWA 3KFUA 5JJIA 4H44C 2JA8H 3D4RA 1VQLA 4LUZA 1CUKA 4LF9L 4LF5L 1ASYA 2Y0SE 3L4HA 2UU9Q 1Q46A 4GN4B 1Y1WH 2K5NA 3ND9A 4NXNQ 1N33Q 3PF5A 1Y8NB 3HOUG 3I4OA 4JG2A 2A68D 1A8VA 2ATWA 4C3HH 3J81c 3U9SA 1CKNA 4LF6Q 2PNRC 4A3LG 1PH4A 2ZJPA 3VR3A 2E2HH 4GNXC 5HY6A 5M3FH 1G51A 2A8VA 2O5IC 4PMWA 5GQOA 1SRUA 2VQEQ 2DMVA 2E74C 4DV7Q 3A74A 2WAQG 4UP8A 1VQHA 1PH9A 4DV0L 3H0GH 2D62A 4DK1A 1WYDA 4GN3B 5FJ8G 4MTNA 1YHBA 4Y7NH 4AQYQ 2XP9A 4A3KG 2ZJQA 3G6EA 3JAMc 4X64L 2BA0A 3CMEA 2ITKA 3OOCA 2JXWA 3I4LA 2NVQH 4H13C 3M3YH 2R93G 3M7NA 5LMUL 2XTIA 5IP9G 2YSHA 1EWIA 4B3TQ 1Q12A 4RMFA 2NVYH 1GUSA 2YTVA 2XP4A 2Z6KA 3PF4A 1YHQA 5LMNQ 1WJJA 4X65Q 3CCLA 3NE5B 4OO1G 1L2FA 4YWKA 4KN7C 4DV4L 1HNXL 2PCFB 1BBUA 4C3JH 5GAHC 4A75A 2JA6G 2PI2A 3KADA 3HOXG 4IPDA 3AFPA 1BVSA 1YI2A 2OQKA 5C0XH 2R6GA 2YV5A 1B70B 3VR5A 3DXJC 4DAYB 1GHJA 3T1HL 4P75A 1Y8OB 5JEAJ 4IOCA 2A6EC 4BY1G 1SMXA 1UWVA 3E0EA 1V8QA 3HOUH 1OXSC 1V1QA 2VY3A 1FR3A 3S17H 4A3LH 2LSSA 3TEHB 3A7AB 1KIXA 4B3RQ 3A5UA 3J81i 2A6HD 3I7FA 2CFMA 2F52A 2A68C 5DLQE 2JV4A 4R4IA 4DK3C 4JI5L 2D5DA 4DV5Q 3QIAA 4B3ML 1VDZA 5IP7G 2AMCB 3K8AA 3KABA 2PNHA 2RE3A 4DV1L 3A0JA 3M4OH 4A3KH 2JXMB 1H95A 1EFWA 2PI2E 4A3EH 2OWOA 2UXCQ 4DV3L 1HQMC 1WOCA 4DV0Q 1VQBA 4KMUC 4DR6L 2R93H 3GTGH 3JAMi 5IP9H 1UE6A 5C4XH 2WP8J 1YVCA 4GKKL 2NZOA 2QGQA 4O2DA 1LM0A 1I6HH 1OXUA 3FKIG 1KQSA 4JC0A 1PH6A 4LK1C 3LNNA 4OO1H 1HR0W 3KF6A 1YNNC 4X64Q 2AUKA 5FLXc 5HGQA 5LMUQ 2JA6H 3H3VI 4JBJA 1VQPA 3HOXH 3IFTA 3UDGA 3ZJYC 2A69D 3W3AA 1VS0A 1GUTA 4IFDG 2DNCA 4LFBQ 2XP3A 2UUAQ 1IL2A 4UPAA 2ZAJA 3GTQH 2E2IH 4DV2L 4DV4Q 1HNXQ 1CTMA 4DNTB 4KHPQ 1GO3E 3TCZA 1J5EQ 3OW2A 3I4MG 1SE8A 3HOWG 1C7YA 1VQJA 4HJ8A 1R9TH 2K4KA 1K3RA 4R4QA 4LF7Q 3T1HQ 3CMAA 1E2VA 1L0WA 1WI5A 3AYHB 4GNXA 2DWVA 4JI2Q 1KD1C 2AWOA 4APVA 2R7ZH 4JI8L 2Q2TA 3EBEA 1RIPA 4IPCA 4DPGA 2OTJA 5IYDG 2AWNA 3ER0A 4YCUA 3PSIA 5BN5A 4DNIA 4B3MQ 2MO0A 4QY7A 2I5LX 5BR8Q 3FMCA 3UE1A 5IWAQ 2NVXH 1YJ9A 1BDOA 2H5XA 1HZBA 2I5HA 3M85A 2CWAA 4C2MH 4LF6L 4A3GG 4JI0Q 4TKOB 1S72A 1FJGQ 3T56B 3HKZE 4DV3Q 4HJ9A 2JA8G 3Q8DA 3W1GA 1QZGA 4DR6Q 1O78A 3CPFA 3AFQA 1VCIA 1W3SA 4DV7L 4KKUA 1Y1WG 2R7DA 2EJMA 2OQ0A 4MZ9A 2YYZA 2BA1A 3EN2A 2E5LL 1YHAA 1JMQA 1YITA 5GAEC 2LXKA 4OWWB 1JMCA 1YZ6A 4IFDI 3FPPA 2D0PA 1CSQA 2JK8A 2A69C 1E1OA 3I4MH 3GTPH 1X56A 3S24A 1SN8A 4R1JA 3HOWH 4LUVA 4DUYL 3H0GG 1EYGA 4DUZL 3KCEA 1Z47A 5FLMG 2ZTCA 2A19A 4B3TL 1VF7A 1ZYRC 4DV2Q 2UUCL 4BBSG 3D31A 4JBWA 5LMNL 3J7ZC 4JCVE 4JI1L 1O7IA 5IY0A 2ID0A 3KDFA 3S2DH 4OWXB 1UE5A 3A7LA 4YY3L 3OOBA 1K9QA 1O7LA 1TXYA 1LYLA 2PMZE 4YCVA 3A8KE 2Q2HA 5H1SE 4A3MH 1DCZA 1LTLA 1DD2A 1K8MA 2GVBA 2ZM6L 4IQZA 3BZKA 4GLVB 1HZ9A 1TWCH 3OPOA 4G7HC 1B8AA 1YNJC 2VZAA 1A62A 3EIVA 1X9NA 4A3GH 3PO2G 4B3RL 3HOZG 1XMQQ 2WAQE 1K0RA 1YJNA 3CCMA 1CKMA 3CW2C 4QGUA 3G48A 1OXVA 1I5HW 4DV5L 2F1MA 2HIVA 3KYHC 2KXQA 3RZDH 2K7VA 1Q90A 4L5SA 2BH2A 3ULLA 4UP7A 2GN5A 4HJ5A 1IXRA 1PHJA 1KC8C 1NE3A 1E3PA 5BN3A 2B63H 2UXCL 3L7ZC 3PGZA 3AQQA 2RCNA 2K52A 2KHJA 5FLMH 1QVFA 1VQ4A 1XNQQ 2B29A 2E5LQ 3P20A 2K14A 4BA2I 4A4IA 3ICEA 4BBSH 3CCUA 3NBHB 3KAFA 3U4VA 2M3OW 2XP7A 3MXUA 2DGYA 1UE1A 4A3EG 4DUYQ 1YIJA 2NN6G 4A3CG 4DUZQ 1CFMA 3T1YL 5C4XG 1A63A 3N6RA 2UUCQ 2GVAA 3U4ZA 1I6VC 2ZR4A 1EQQA 4L5RC 4LFBL 4U86A 4JI1Q 2UUAL 4X66L 4UP9A 4P71A 4PZ8A 4KHPL 3QG1A 1IZ6A 1SLJA 3F1ZA 1J5EL 3PIOA 3CCSA 4O0AA 3DLLA 4YY3Q 3HGBA 3K7AH 3PO2H 3HOZH 3PCOB 4EX5A 4BBRG 4LF7L 5C0XI 1GUGA 4DR3Q 1WMVA 1X3GA 2ZM6Q 4GOPB 3CC4A 4NB3A 2VS1A 2YSIA 4WJ3M 4JI2L 1B9MA 1FYCA 1XPUA 1N8RC 3MXNB 1HNWL 3GTKH 1GVPA 2EJFC 2N78A 3M9BA 2R92G 3ULJA 4U84A 2V1CC 4NPSA 1YEZA 5GROA 5C4JH 1TWHH 3JC66 2XP5A 4R4OA 2BE5D 5K36H 4GKJQ 1S3OA 3BU2A 1O6WA 1WR7A 2JE6I 3OTOL 3H94A 2R7ZG 5BR8L 1VQ5A 4JI3L 4YWLA 5IWAL 1N36Q 1KXLA 4LF4Q 3GTMH 2EIFA 1XPOA 1YBYA 4JI0L 5IE8A 4GN5A 2D0OA 3CAMA 1DGSA 1FJGL 4JV5L 4LWCA 2ZJRA 4PV1C 3CQZH 3CNGA 2NN6H 4RCNA 2JEAI 4AIMA 4A3CH 2LAJA 4IFDJ 4TQUS 4BA1I 1I94Q 3HOYG 1KRTA 4GS3A 3KLRA 3VA7A 4H02A 2PQAB 1Y1VH 3PUWA 1PV4A 3S16H 1TWAH 5CQ2A 5IT9c 4IPHA 2B8GA 4IOAA 2JMFA 2HT1A 4KN4C 1WCMH 4OO1I 2XP8A 3TS0A 3TQYA 1GD7A 4JI6L 4OX9L 1N32Q 1N34Q 1PH8A 1FGUA 1AE2A 3TDBA 4DV6Q 3UE0A 2L4JA 3T1YQ 4DNRB 2AUJD 4DR2L 2RHSB 2ZTEA 3KJOA 1SFOH 4BBRH 2BH8A 1IYUA 1QVGA 2I0QA 3UDXA 2KCMA 4X66Q 3STBD 5A35A 2ZT9C 3GTLH 2JA7H 4KKSA 4JBKA 1KAWA 3J80c 3I55A 1KRSA 3I4NG 4A3JG 3VDYA 2JJQA 2KENA 3E9IA 3SE0A 1GJXA 2VW9A 2R92H 1VF5C 4DKAC 3ULPA 1CKNB 5JJLA 1X55A 2ALYB 3NENA 1Y8PB 1VQ6A 3K7UC 1B7YB 1X54A 4P73A 2EVBA 3SGIA 4R4TA 2E45A 3FHWA 4BY7H 2A6HC 1E7ZA 1Z9FA 1HNWQ 3CXCA 1ASZA 1VQMA 1K83H 1JJGA 4OONA 3RLNA 3RN5A 1DXMA 3TRZA 2BE5C 3UDFA 1HR0L 3PUVA 4DR7L 5M3MH 3CCQA 5KNBA 2ASBA 2KBNA 5JEAH 3BDOA 1XNRL 2VUMH 1XMQL 4XTCS 4I7ZC 2K50A 3HOYH 4JOIA 1SROA 4A3MG 4FDBA 3ODKA 3I72A 3OTOQ 1QJOA 2ZQVA 4JI3Q 4AYBG 3F2CA 3T51B 4LW1A 4DR4L 2I5MX 2OTLA 1K8AC 4G7ZC 2DK1A 2FXQA 5LMNW 4POGA 4A3FH 1BKBA 1A0IA 1LUZA 2C35B 4JV5Q 2YTYA 2ES2A 1PH1A 5AHTA 3WDNA 1YW5A 3OW7A 3BJUA 2MNAA 2IT1A 4IJHA 2XPBA 4QJFA 1T5EA 3KLWA 1G291 1XNQL 1AE3A 4PG3A 3TS2A 1GHKA 2D2CC 4REXA 1VQAA 4OX9Q 4JI6Q 1P8LA 3I4NH 4A3JH 3KOJA 2F21A 2B63G 3DM3A 4X6AH 4DR2Q 4EQ5A 1C9OA 1MIUA 3J80i 4JYAL 1N9WA 3PO3H 4A93H 1PH2A 2F3IA 4L5TA 2JEBI 3KF8B 5C44G 1EIFA 3AB9A 3W5OA 2WB1G 4A3DH 4YWMA 3OYYA 3RN2A 3TREA 4RG1A 2NZHA 4BXXG 5C0XJ 3M4PA 4PZ7A 3F8TA 3I2ZA 2VNUD 1I5FA 1PYSB 1UEBA 3G4SA 1F8AB 1NTGA 4AH6A 2QA4A 1I50H 3IRBA 3MEFA 3CCRA 1C0AA 1RL2A 3PUZA 1TWGH 1VQGA 1MJCA 1J6QA 4DR3L 1KL9A 1AH9A 2M8IA 1X65A 3MFYA 4IJLA 1IBKL 3KAGA 1K9RA 3NELA 2EDGA 1V43A 1HR0Q 1GM5A 4LFAQ 3GO5A 4DR7Q 2MDIA 4XIGS 4A3BG 4KLKA 1YNXA 5E7NA 1IYVA 5GADC 2QEXA 1XNRQ 1L1OC 2UXDL 2LMCB 2ZTDA 3KF6B 4TVAB 4LFCL 3GTJH 1ONLA 3HKSA 2YSBA 1S40A 1VQFA 1PVOA 4GKJL 3S1RH 4HIOA 4DR4Q 2LXJA 1XMOL 1UE7A 1B9NA 5EAYA 1PINA 1L1OB 1N36L 4A76A 1PA6A 4LF4L 1IW7D 3CRKC 4LNQA 1VQIA 1VQ8A 3F2DA 5K36G 2K5VA 1WFQA 3GD7A 3CC7A 4DK6C 1JB7A 2MO1A 3M4YA 2DNEA 4OXPA 1I94L 1VQ7A 1IBML 3A8IE 2YTXA 5C44H 1NY4A 2KCTA 2N49A 5M5XH 3S15H 1CSPA 1VQDA 5IYBH 2Y0SG 2IHFA 3S1NH 3PUYA 4JOIC 5ELNA 1Q82C 1VQNA 1TKWB 4B3SL 3EQLC 4BXXH 3NEMA 2MQHA 1N32L 1NBWA 1N34L 4GNXB 3I73A 4JYAQ 1TK7A 2DJYA 1IBLL 4HIKA 3LWUA 4DV6L 2L5TA 3LE4A 4LJZC 1XJVA 3VR4A 2KA7A 3J7A5 1MJEA 1Y1VG 3CCVA 1PYBA 1EUJA 1VQEA 1WCMG 4KI0A 3RZOH 4DR5Q 3B6YA 4Y52H 3ND8A 3FP9A 2UXBL 2CQOA 3K0XA 4GOPC 1NJIC 1PH5A 2JX8A 2N3SA 4OWTB 4A3BH 5GAGC 3S1MH 1HH2P 1QUQB 1CKOA 1OTCA 2JA9A 1E1TA 1Q8KA 1GUNA 1IBKQ 2JA7G 1G6PA 1EG4A 1PMRA 1K9MC 3HOVG 4GLXA 1IYJB 2K5HA 4X62Q 5JJKA 1FL0A 3VR2A 2ZR5A 4LUOA 1PH7A 3D0FA 1EQRA 4NXML 3PV0A 2RHQB 4YHHL 3S1QH 2UXDQ 2E8GA 4LF8L 3HFZB 1Q86C 4LFCQ 2V4DA 1VQ9A 2CWPA 2Q2IA 3CRLC 1Q1EA 4DAMA 1K73C 1XMOQ 1SR3A 4YCWA 4BY7G 3K80C 2A1AA 1IW7C 3U50C 4LF9Q 4LF5Q 5J3BA 3GTOH 4QIBA 3S14H 1NMVA 1GUOA 1SMYC 3WH0A 3TC5A 1HPCA 5M3MG 2VQFL 3KAIA 5FJ8H 5JEAG 3S2HH 2YU9H 2VUMG 4P72A 1JJCB 3VR6A 1KHIA 3KAHA 4JK1C 3L0OA 3KDFB 2NN6I 1IBMQ 1D7QA 1H9RA 1VQOA 1X6OA 3QJYA 2F4VL 2DUDA 2Q2UA 2ZQSA 2K33A 4P74A 1H9SB 2EXDA 4G7OC 4U85A 1PFSA 4A3FG 3L2PA 4B3SQ 3I56A 4POFA 1HNZL 2VL6A 1Z7TA 1LABA 2E2JH 1PH3A 1M90C 1IBLQ 5M5YH 2HHHL 2B3GA 3WWVA 1EOVA 3GDEA 1D8LA 2RF4A 4ME3A 2UUBL 4UY8C 3H3VH 4IPGA 2EJGC 1HJPA 1EG3A 1H9JA 1VQCA 3G71A 2JQOA 1TWFH 1Q7YC 3HOVH 2Q5AA 2UXBQ 1BBWA 4WJ4A 1L1OA 4L8JA 5AJ3L 2CW0C 1MKHA 4JBMA 1Y14B 2YSGA 3CPWA 4HIMA 3J81j 4BY1H 3IKJA 3PO3G 4A93G
chains in the Genus database with same CATH superfamily
1PRTD 5CR3A 5LL6X 1CI3M 3X3MA 4JI7L 1X3FA 4EGVA 1QILA 1V9PA 1BQQT 1D1KA 1XX8A 1GKHA 1ZYRD 5E65A 1U0LA 5EBCA 5DM63 1G2SA 4GZYC 3U58A 4A3DG 4DR1L 1F77A 1LACA 1HZCA 2M8JA 5EJWA 5M9OA 1UAPA 4RGMA 1SJED 4L5QA 3NK9A 1W2BA 4HR7B 1SNOA 3NTPA 1STHA 2KHIA 4AYBE 4K0KL 1E22A 3NBHA 1CZWA 4B9WA 4NXMQ 2K32A 2R7FA 1TS2A 2Z4IA 3BG3A 4MNOA 4YHHQ 1VQKA 3CD6A 2XGTA 1NMGA 3RLFA 2MFIA 4IALA 4ALPA 4MHEA 2X6GA 1K8GA 3T53B 1E24A 4LF8Q 4LFAL 2L11A 2JA5G 1RDPD 5ELOA 2XWJB 1QG7A 4K2LA 1ZEQX 5JJZA 1SYEA 2B2VC 3NXWA 1HTPA 5EKKA 3A8JE 4J15A 4QIWE 1XTDA 3A5ZB 5IP7H 1HCZA 4K8JA 1ICFB 1WD1A 2Z6KC 5I2YA 2HQLA 3TMEA 5C3EG 4F7XA 4IO9A 3HP3A 5IYCG 1JOQA 3MA2B 1RTOA 4JI4L 4H0LC 5T1GA 1LT3D 2E75C 1ENAA 4QMGA 3KJPA 3PUXA 4DA2A 4JI5Q 3F2BA 1HZAA 3RR5A 4E5RA 2Q8RE 2IW3A 3A56A 3QR8A 3W1BA 2DK7A 2VXWA 2SDFA 1Y69U 2L15A 2UU9L 3ERSX 3UDIA 2F0KA 2VQFQ 5IT9E 2Z0SA 1I3QH 1I3QB 1SYGA 2K05A 3FKIH 4NXNL 3FKIB 1N33L 4DV1Q 2HIXA 4WFN3 1Q1BA 3EROA 5TSSA 1PFMA 4HIDA 4I7AA 1OXTA 2IX1A 4LMQD 1M1KC 1QUQA 2Z8LA 1NMFA 3N52A 2IX0A 5CV7A 1STNA 5CMDA 2F4VQ 4A3IG 3PIPA 4QQBX 2XNAC 1JC7A 2WFWA 1QE6A 4GOPA 5JVG3 4MN3A 2N8NA 1I4PA 2F0JA 2WB1E 5KRUA 1TU2B 5EPJA 3CCJA 1F9RA 2QW7A 4C1NI 2VQEL 3C46A 1X3EA 3ITPA 4GKKQ 2EYFA 1Q81C 1PLFA 1HNZQ 1XPRA 4C3IH 4IUNA 5E1FA 4RGOS 4HJ7A 2IY5B 5J1ZA 2DN8A 1E0BA 4HJAA 4IFDH 4C3HG 2E76C 1EY9A 2HHHQ 4GLAC 2O5JC 3MTSA 1TVXA 1JT8A 3DEPA 1KLGD 3K81C 3J80E 3STBC 1ZKOA 3GQBA 4FP5D 2PPBC 2PZUA 5U47A 2IHEA 2UUBQ 1ZCNA 4AQYL 2KUMA 5M3FG 2ZR6A 3CP0A 1QOHA 4BWGB 2TMPA 2ZQUA 4ODGA 3HKZG 3LGJA 3CF5A 1TY0A 4KHZA 1PTOF 1AFPA 2AKWB 5T1IA 5M5WH 4FVMA 5M5WB 1A6XA 1H9MA 2CCZA 2G5DA 1FLCA 3EJIA 1O7ZA 1K0SA 5IYBG 1EIHA 5BN4A 3DEOA 2YSFA 2EY6A 1EWHA 1OXXK 4KHVA 1PTOD 4FXDA 1EIYB 5AJ3Q 1FVIA 3EA6A 2F0EA 3TDQA 1PRTC 1R4PB 4DR5L 2WINB 1S4ZA 1U5KA 2XP6A 3K6OA 1E2WA 5KNCA 3QWNA 5G3LF 2NB0A 2EZ5W 2ZQTA 4OGQC 4FF1A 4X65L 1JJ2A 1QVCA 1JOKA 2JA5H 4JI7Q 4RA8A 2JA5B 1KABA 1C48A 3TZUA 1NSNS 4J8QA 2PQEA 2N88A 5G3LD 1H9KA 1QCBD 3AEVA 4PZ6A 2XPAA 1Z6HA 2BDOA 2KCCA 4DR1Q 3RNUA 3BZCA 3RLOA 3EFXD 2PQAA 3C2PA 2B39A 5C3EH 5C3EB 1PRTB 4R4CA 5A2QL 2K75A 1MD2D 2OT2A 4JVZA 3E9HA 5IYDH 2B8FA 5IYCH 1H9SA 4K0KQ 2EQSA 3CCEA 2OCEA 1PZJD 2NYZD 2QF7A 1B1ZA 4QL5A 4X62L 3I3CA 1JE5A 3M4QA 4KKTA 1E2ZA 1P16A 5K5PA 2Q8IB 1EY0A 5E3FA 1KDBA 2K5WA 3FSCA 2HCIA 3SDZA 2KECA 4JI8Q 4MIUA 2NVTH 2NVTB 2CKZB 1CZGA 5D3DA 1QZHA 2L1BA 1EU4A 1CT1D 3CC2A 5I2XA 1PZID 1T9HA 4XDXA 1K8OA 2A6ED 1SYCA 4E6IA 5CC4A 4DK0A 4JI4Q 5KNDA 4A3IH 4A3IB 3H15A 2AHOB 2RDHA 5C0XG 1YJWA 3KFUA 5JJIA 4H44C 2JA8H 3S1RB 4I65A 3D4RA 1X32A 4RFBA 2F3VA 1VQLA 1F2YA 4LUZA 3K57A 1CUKA 4LF9L 4LF5L 1ASYA 1GUWA 2Y0SE 3L4HA 2UU9Q 1GXDC 1Q46A 3MFGA 4N9TA 4GN4B 1Y1WH 1Y1WB 2K5NA 3ND9A 4NXNQ 1N33Q 3PF5A 4KV6A 1UNSA 1Y8NB 3BYYB 3I4OA 3HOUG 4JG2A 2A68D 1A8VA 2B2UA 2ATWA 4C3HH 4C3HB 3J81c 3U9SA 1EWCA 1CKNA 1K28A 2ICIA 2K1BA 4IURA 4LF6Q 2PNRC 4A3LG 1PH4A 1CQVA 2ZJPA 3VR3A 4N9PA 2E2HH 3KLSA 1EOTA 1UUPA 2E2HB 4Q0FA 4GNXC 5HY6A 5IGEA 5M3FH 1S5CD 5M3FB 1G51A 2A8VA 3KBXA 2O5IC 4PMWA 5GQOA 1SRUA 4ZK9B 1HHVA 2VQEQ 2DMVA 2MPMA 2EYPA 2QDLA 2QEJC 4X3UA 2E74C 3A74A 2Z6BA 2F0UA 2WAQG 1TR8A 1VQHA 4UP8A 2R61A 4DV7Q 1DZ1A 1PH9A 4DV0L 3H0GH 1RKNA 3H0GB 2D62A 4CKBA 4DK1A 1B44D 2FMCA 1WYDA 1AP0A 4GN3B 4YIJA 3RMHA 1EL0A 5FJ8G 4MTNA 2FMMA 1SNCA 1YHBA 1F2ZA 4Y7NH 4Y7NB 4AQYQ 2XP9A 2AQ3B 1JQYD 4A3KG 3J7AF 4CKCA 2ZJQA 3D4DA 3OWFA 3G6EA 1MSGA 4X64L 2BA0A 3JAMc 3CMEA 2ITKA 3MXPA 3OOCA 2R3ZA 4X3SA 1ZXTA 2JXWA 3I4LA 4O1NA 2NVQH 2NVQB 4H13C 3M3YH 2R93G 3M3YB 3M7NA 5LMUL 1JICA 2XTIA 5IP9G 3MWYW 2YSHA 3WOFA 1EWIA 4PMCA 2B2VA 4XT1B 4B3TQ 1Q12A 2O2LD 5J22A 4RMFA 1WTPA 2OXPA 2NVYH 1GUSA 2NVYB 2YTVA 2XP4A 2Z6KA 1PTOH 3PF4A 1PTOB 1YHQA 5LMNQ 1WJJA 4X65Q 3IL8A 3CCLA 3NE5B 4OO1G 1L2FA 2HUGA 4YWKA 5KYLA 2G9DA 1JWUD 4KN7C 3I8ZA 4DV4L 1HNXL 2PCFB 2Z9HA 2RSOA 5CV6A 3H91A 3OHXC 3OSOA 3HS0C 1BBUA 2I46A 4C3JH 2K03A 1ICWA 4C3JB 5CV4A 2RA4A 2BOSA 2F4IA 3D6CA 5GAHC 1B50A 4A75A 3NTIA 2JA6G 1SAPA 1I4RA 2PI2A 3KADA 3HOXG 4IPDA 3A55A 3AFPA 1BVSA 1JB3A 1YI2A 2EYLA 2OQKA 5C0XH 2R6GA 2YV5A 4J6HA 1PDQA 1B70B 3VR5A 3DXJC 4DAYB 1GHJA 2PMZB 3T1HL 2QRVA 4P75A 4RKBA 1CHPD 4FF4A 1Y8OB 5JEAJ 1SNQA 4IOCA 5I6WA 1ESFA 3I91A 2A6EC 1EEID 1SMXA 4BY1G 1A2UA 1UWVA 3E0EA 1V8QA 1G8ZD 2QILA 1BCPD 3HOUH 3HOUB 4QUFA 1OXSC 1V1QA 2VY3A 1FR3A 1L0YB 3S17H 3S17B 3WOEA 4A3LH 2LSSA 3TEHB 2F3WA 3RUZA 3A7AB 2CHBD 1KIXA 3Q23A 3H09A 3NPPA 2EOTA 4B3RQ 2SEBD 3J81i 3A5UA 2A6HD 3I7FA 2ZXRA 3NSWA 2CFMA 3BZDB 2F52A 2WAEA 2A68C 5DLQE 2JV4A 4DN4M 4R4IA 2ZXOA 1EEFD 4DK3C 3C3LA 4JI5L 2D5DA 4F87A 4U68A 1BOSA 4ZKBB 4DV5Q 2SNMA 2MHVA 4RWSC 3QIAA 3GV3A 5JAVA 1SSOA 4DXGA 3BDLA 4B3ML 1VDZA 5IP7G 2AMCB 3K8AA 3KABA 2PNHA 1EY8A 2RE3A 4DV1L 3A0JA 3IFDA 2XSCA 4K6LA 3M4OH 3M4OB 4A3KH 2JXMB 4A3KB 5A2QE 1TT2A 3J7AV 1D6EC 1H95A 1IL8A 1EFWA 2PI2E 4A3EH 2OWOA 4A3EB 3TP6A 2UXCQ 4DV3L 1HRJA 1HQMC 1WOCA 4DV0Q 1VQBA 4KMUC 4DR6L 2R93H 2R93B 1AN8A 3GTGH 3JAMi 3GTGB 5IP9H 1UE6A 4TSSA 5C4XH 2WP8J 1BR9A 4C56C 1YVCA 4GKKL 2NZOA 4UDUC 3TZDA 2I07B 3FEWX 5C6AA 2QGQA 4O2DA 1LM0A 1I6HH 1I6HB 1OXUA 3FKIG 1KQSA 2E2JB 1HTLD 3SHLA 4JC0A 1KNEA 1PH6A 4LK1C 3LNNA 4PNYA 4OO1H 2PW7A 1HR0W 3KF6A 1YNNC 3E6ZX 4X64Q 1FGBD 1KAAA 2K04A 1FD7D 4HCSA 2AUKA 5FLXc 4QUCA 5HGQA 4N8FA 5IOCA 1STBA 3E0JA 5LMUQ 3TBIB 2JA6H 2JA6B 3H3VI 4JBJA 1VQPA 3HOXH 3HOXB 3IFTA 1F9QA 1NUCA 4G57A 3UDGA 3PIO3 3ZJYC 2A69D 1O80A 2F0WA 3T4AC 1KTKA 4C3IG 3W3AA 4ME5A 1VS0A 1GUTA 2FHTA 1VMCA 3NTHA 2KEEA 1BF4A 4IFDG 3TP5A 2DNCA 4LFBQ 2XP3A 2H4OA 3ERQA 3SK5A 5D65A 2UUAQ 1WTVA 4UPAA 2Z4HA 1IL2A 2ZAJA 3GTQH 2E2IH 4DV2L 4DV4Q 1HNXQ 1BBXC 1CTMA 4DNTB 4FF3A 1L0XB 3NQTA 2E2IB 4KHPQ 5DM73 1GO3E 3TCZA 4XYOA 4ZKCB 3P1HA 1J5EQ 1LT5D 4V190 3OW2A 3I4MG 1SE8A 4FF2A 4CDFC 3HOWG 1I4XA 1C7YA 1VQJA 4HJ8A 1NR4A 1R9TH 1R9TB 3K5NA 2K4KA 1K3RA 3Q24A 4R4QA 4LF7Q 5IODA 1M8AA 3T1HQ 2B2WC 3UI2A 2O4XA 3LWEA 3CMAA 4RHSA 3QOLA 1E2VA 1KDCA 1EU3A 3OWEB 3SXHA 1L0WA 3QOJA 1WI5A 1WTOA 3K5LA 2HQEA 3AYHB 4GNXA 2DWVA 4JI2Q 1KD1C 2AWOA 4APVA 1WTRA 2R7ZH 2R7ZB 2EXZA 2F0SA 4JI8L 5CORA 1PXUA 2Q2TA 3EBEA 4HAEA 4IUTA 3QO2A 3T13A 1LTSD 1EY7A 2RSNA 1WTHA 3KLSX 1RIPA 4IPCA 1BCPB 5FK9C 4DPGA 2OTJA 5IYDG 2AWNA 3ER0A 2OEOA 4YCUA 2X69A 3GV6A 1YNJD 3PSIA 5FO8B 2EZVA 5BN5A 4DNIA 4RHRA 1LO5D 5E4XA 4B3MQ 2MO0A 4QY7A 2I5LX 5BR8Q 4G4KA 2RDGA 3FMCA 1RCVD 3BVGA 3FRPB 3UE1A 2F0LA 5IWAQ 2NVXH 2NVXB 1HA6A 1YJ9A 1BDOA 3PQHA 2H5XA 2RKSA 4NMZA 1HZBA 2I5HA 2RBMA 3M85A 2CWAA 4C2MH 3V96A 4C2MB 5KIXA 4LF6L 4A3GG 3D4WA 4JI0Q 1MBYA 4CGYB 4TKOB 1S72A 1FJGQ 3HKZE 2G9HD 3T56B 1LV9A 2CH4W 5KGUA 4DV3Q 4HJ9A 3Q8DA 3W1GA 1QZGA 2JA8G 4DR6Q 1O78A 2DY8A 1A2TA 4B08A 2L12A 3CPFA 3AFQA 3DUZA 4DAYA 1A3UA 1IKLA 1VCIA 1W3SA 4DV7L 4KKUA 4C3IB 1Y1WG 2XN9C 2R7DA 2EJMA 3PQIA 2OQ0A 4MZ9A 2YYZA 1EY6A 2BA1A 3EN2A 2E5LL 1YHAA 2EYOA 1JMQA 1YITA 5C3XA 5GAEC 2LXKA 4OWWB 1EZ8A 4ZLTF 1JMCA 1YZ6A 4IFDI 3FPPA 1S5DD 2D0PA 1CSQA 2JK8A 3TP8A 2A69C 2PZTA 1E1OA 3I4MH 3R93A 3I4MB 3GTPH 1X56A 3GTPB 3S24A 2SNSA 1SN8A 1F2MA 2Q8TA 4R1JA 3HOWH 3HOWB 2RQXA 1X3PA 4LUVA 4DUYL 1TY2A 3J81L 1LTBD 1U4LA 3H0GG 1EYGA 4DUZL 3KCEA 1Z47A 1BUVT 5FLMG 1JCKB 2KEDA 2ZTCA 5D14A 4DFAA 2A19A 2Y8NB 5FO7B 4B3TL 1VF7A 1ZYRC 3KUPA 4DV2Q 2UUCL 3MC0B 4BBSG 3D31A 1LTAD 4JBWA 4KJNA 5LMNL 3J7ZC 4JCVE 4JI1L 3URYA 4KTAA 1O7IA 1X3QA 1HUMA 3F2UA 5IY0A 2ID0A 1A3VA 3KDFA 4EVOA 2JP1A 2WV6D 3S2DH 4OWXB 3S2DB 1UE5A 1GOZA 1RJTA 1HFGA 2P5ZX 1AW7A 1R4QB 3A7LA 4YY3L 5CV5A 3OOBA 2F03A 1K9QA 1O7LA 3Q22A 2B2YC 5ELCA 1MHWC 5HURA 4ULLA 1TXYA 3JAML 1LYLA 2JYOA 2PMZE 2XIWA 3OMCA 4YCVA 1EIGA 3A8KE 2Q2HA 5H1SE 3R3OA 4A3MH 1DCZA 1LTLA 4A3MB 2VB3X 1DD2A 2NTTA 1K8MA 2GVBA 2ZM6L 4IQZA 1JE4A 3E3XA 3BZKA 4JPBW 3K59A 4GLVB 3L9AX 1HZ9A 1TWCH 1TWCB 3OPOA 4G7HC 1B8AA 1MGSA 1YNJC 2H1EA 4C3JG 2VZAA 1EQVA 1I4GA 1B3QA 5FO9B 1A62A 2KHSA 3EIVA 1X9NA 4A3GH 4A3GB 3PO2G 4XYQA 4ZQ3A 2KOLA 5L37A 1ET6A 4B3RL 2QKIC 3HOZG 2JA8B 1XMQQ 4QIWB 2M9VA 5COYA 4NW2A 2WAQE 1K0RA 2CVRA 1YJNA 3CCMA 1CKMA 4FNFA 4QF4A 5FKAC 3CW2C 4QGUA 3G48A 1OXVA 1I5HW 4CDEC 4DV5L 4IUQA 2F1MA 2HIVA 3KYHC 1F9SA 2KXQA 1XTCD 3M7GA 5CBAE 3RZDH 3RZDB 2K7VA 1Q90A 4L5SA 2BH2A 1TR5A 1M4VA 4UP7A 3ULLA 4IUVA 4HEDA 2GN5A 4HJ5A 1IXRA 1HFNA 4ZUJA 1G6ZA 2F0IA 3NHHA 1PHJA 1KC8C 4HSPA 1NE3A 1E3PA 5I9OA 1G91A 5BN3A 2B63H 2B63B 1A3TA 1DM0B 2K5QA 2KJXA 5CYUA 5LL6S 5C3WA 2UXCL 3L7ZC 3PGZA 1EYAA 2ZXPA 3AQQA 2RCNA 2K52A 5FOBB 2RVLA 1SMYD 4BS9A 4K8IA 2LKVA 4HMIA 2KHJA 4H7BA 5FLMH 1QVFA 1VQ4A 1XNQQ 2B29A 2E5LQ 4KY6A 2K14A 3P20A 2NTSA 4BA2I 5IGCA 4HCEA 4A4IA 3ICEA 4BBSH 4BBSB 3CCUA 4O42A 4XQJA 5E66A 3NBHB 3KAFA 4XT3B 3U4VA 1PTOC 1ILPA 3FSBA 2B2WA 3SK4A 2M3OW 3E5SA 2XP7A 1HUNA 3MXUA 2DGYA 3DWPA 3P7JA 1B4OA 1QWYA 1UE1A 2EPBA 4A3EG 4DUYQ 1C8CA 1YIJA 1JWMD 2NN6G 4A3CG 4R8NA 4DUZQ 4KK7A 1CFMA 3T1YL 5C4XG 2F0MA 1A63A 4DXFA 1AEXA 3VYTA 3N6RA 2UUCQ 2GVAA 3NWTA 5ELEA 3U4ZA 1I6VC 2ZR4A 1EQQA 2K28A 4L5RC 3DWAA 4LFBL 4U86A 4JI1Q 4Q5VA 2UUAL 4UAIA 4X66L 4UP9A 4P71A 3VYRA 1CHQD 2BCOA 4PZ8A 4KHPL 4ZCKA 3QG1A 1IZ6A 1BO0A 1SLJA 3F1ZA 1J5EL 1O7YA 2A74C 3PIOA 3CCSA 3T16A 4O0AA 3RD4A 3DLLA 3I70A 4YY3Q 3HGBA 3K7AH 3K7AB 1WTWA 3PO2H 3PO2B 1SE3A 2D9UA 3HOZH 3HOZB 3PCOB 4EX5A 4BBRG 2CW0D 1HXYD 2K5DA 5C0XI 4LF7L 1GUGA 4DR3Q 3IAYA 1OO9B 5FLXL 2XRSD 1WMVA 1X3GA 2WKDA 2ZM6Q 4K14A 4GOPB 2J4XA 3CC4A 4NB3A 4NP5A 2Z1CA 1MI2A 2VS1A 4R8IA 2YSIA 4WJ3M 4JI2L 5DEHA 1B9MA 1CQFA 4NDXA 2EE1A 1LTID 4K5VA 1FYCA 4K5WA 1XPUA 1C4QA 1N8RC 3MXNB 1HNWL 3GTKH 3GTKB 1GVPA 3X3NA 4KD4A 2AQ1B 2EJFC 1VMPA 1ET9A 1NAPA 1FNVA 2N78A 3J81E 3M9BA 2R92G 1S5FD 3ULJA 4U84A 1Q3LA 2V1CC 4NPSA 1YEZA 5GROA 4TRDA 5C4JH 1TWHH 5C4JB 1TWHB 3JC66 3D6WA 2XP5A 4R4OA 4RGTA 2BE5D 5K36H 1ENFA 4RH6A 4DGZA 4GKJQ 1S3OA 3BU2A 3BS1A 1O6WA 5D3IB 3HRZC 1WR7A 4NKLA 3FVQA 5C4HA 2MUYA 2JE6I 3OTOL 3H94A 2R7ZG 1FNWA 2F0OA 5BR8L 2NUCA 1VQ5A 1T5XD 4JI3L 4YWLA 4RAUC 1QNKA 5IWAL 1N36Q 1KXLA 4N8X1 4LF4Q 3GTMH 3GTMB 2EIFA 1XPOA 4B9XA 1YBYA 1ENCA 2KVMA 1DOMA 4JI0L 1Q8IA 5IE8A 4GN5A 2M2LA 2D0OA 2L55A 3CAMA 1DGSA 1FJGL 4JV5L 4LWCA 3R2IA 1D1IA 2ZJRA 4MTKA 1I4QA 3CQZH 4PV1C 3CNGA 2NN6H 4RCNA 2JEAI 4AIMA 3JAME 2LAJA 4A3CH 4IFDJ 3D8GA 4TQUS 1ML0D 2EY1A 5C4XB 4BA1I 1WVLA 1I94Q 3HOYG 2EYMA 2F0NA 1KRTA 4GS3A 2IPKD 3KLRA 3VA7A 4H02A 1RODA 1XYIA 2PQAB 4QB4A 1Y1VH 3PUWA 1Y1VB 1PV4A 3S16H 3SK6A 1TWAH 4OIKA 1TWAB 5CQ2A 5IT9c 4IPHA 1TQOA 5AFWA 2B8GA 5I4DA 4IOAA 2JMFA 2HT1A 2PW5A 4KN4C 2PYKA 1WCMH 4CHTB 1WCMB 5I6YA 2B2YA 4OO1I 2XP8A 4IN3A 3TS0A 4XQNA 3TQYA 1GD7A 4JI6L 4OX9L 1N32Q 1N34Q 1PH8A 1W6JA 1FGUA 1HA5A 3KBGA 1AE2A 1MSHA 3TDBA 4DV6Q 3UE0A 1EZ6A 2L4JA 3T1YQ 4DNRB 1U4RA 2AUJD 2RHSB 3BVZA 4DR2L 4L6TB 2ZTEA 2B2TC 1A15A 4QCLA 3NQIA 3KJOA 4PMBA 5E62A 4ILWA 1SFOH 1SFOB 3ZYYX 4BBRH 4BBRB 1DOKA 1RP5A 2BH8A 1IYUA 1QVGA 2I0QA 3UDXA 2KCMA 5F2DA 4X66Q 3STBD 5A35A 2HDLA 2ZT9C 2J0TD 3GTLH 2VB2X 2JA7H 3GTLB 2ENBA 2JA7B 1RD9D 2FJ2A 1IKMA 4KKSA 5IIFA 4JBKA 2HD3A 1KAWA 3VYUA 1B3AA 1KRSA 3BYTB 4U673 3J80c 3I55A 3I4NG 4A3JG 3VDYA 3P75A 5EKLA 1PRTF 2JJQA 1U9RA 4FXGC 2KENA 3E9IA 2FINB 3SE0A 1GJXA 2FFKB 2VW9A 2R92H 1VF5C 2R92B 3DHQA 4DKAC 3ULPA 1CKNB 5JJLA 1X55A 2ALYB 3MQHA 3NENA 1XXGA 1Y8PB 1VQ6A 1BCPC 3K7UC 2NWGA 3V2TA 2PO4A 4EQPA 1W6KA 1B7YB 1X54A 3Q6SA 2EVBA 4P73A 3SGIA 3AMUA 4R4TA 2E45A 3TN2A 2TSSA 3FHWA 4BY7H 4BY7B 2A6HC 1E7ZA 1QNUA 1Z9FA 1HNWQ 3CXCA 4CKEA 1ASZA 1VQMA 2MGSA 1K83H 1JJGA 1K83B 4OONA 3RLNA 2F0FA 2XVSA 3BDCA 4EQNA 3RN5A 1HQRD 1DXMA 3TRZA 1SE2A 2BE5C 2J7ZA 3UDFA 3VA5A 1HR0L 2F0DA 3PUVA 3HEJA 4DR7L 1NCVA 5DNFA 5M3MH 5M3MB 3CCQA 1F9PA 5KNBA 4OHJA 3D3RA 2ASBA 2KBNA 5JEAH 3BDOA 1XNRL 3MCBB 2VUMH 2VUMB 1XMQL 4XTCS 4M1UB 2WACA 1JR0D 2QDBA 4Z9CB 4I7ZC 4A0UA 2K50A 1TS3A 4JOIA 1SROA 4A3MG 3HOYH 4FDBA 3HOYB 4PQXA 3ODKA 3I72A 3OTOQ 5E64A 1QJOA 4A0TA 2ZQVA 4JI3Q 1SYFA 2F0QA 1WTXA 4AYBG 3F2CA 3T51B 1ESRA 4LW1A 4DR4L 2I5MX 1F2LA 2MP1A 2OTLA 1K8AC 4G7ZC 2DK1A 2FXQA 5LMNW 4POGA 4A3FH 4A3FB 1BKBA 2JN4A 1A0IA 1LUZA 3LKXB 1KNAA 2C35B 4JV5Q 1NNXA 4IZ8A 1IHZA 1LTGD 2YTYA 2ES2A 1PH1A 5AHTA 3BJUA 1YW5A 3OW7A 3WDNA 5EKIA 4DF7A 2LS01 2MNAA 1TS4A 1D5XC 3J7YW 2IT1A 4KJOA 2F0VA 4IJHA 2XPBA 4QJFA 5FLXE 5JOBA 5E4WC 4LAAA 1T5EA 3KLWA 1SEBD 3NBIA 1NR2A 1UEAB 2DJGC 2L0CA 2F0HA 1G291 1XNQL 5CGKA 4ZRZA 3CKIB 3MHBA 3NP8A 2F0PA 1AE3A 4PG3A 3TS2A 1GHKA 3MXNA 2D2CC 4REXA 1VQAA 4X3TA 4OX9Q 4JI6Q 1ILQA 2EY5A 1P8LA 3I4NH 3I4NB 4A3JH 4A3JB 5KYIA 3KOJA 4CJ0B 2F21A 2B63G 3DM3A 4RKLA 3PMFA 4X6AH 4DR2Q 4EQ5A 1C9OA 4V0BA 1MIUA 3J80i 4JYAL 1I4HA 5DAUA 1N9WA 4FYDA 5C4ZA 3QB3A 3PO3H 4A93H 3PO3B 4A93B 1PH2A 2F3IA 1JORA 4L5TA 2JEBI 2WKCA 3KF8B 1J8IA 5C44G 1EIFA 3AB9A 4ZUIA 5JPNC 1QB5D 3W5OA 2WB1G 3ONAB 2K6AA 4A3DH 1AZQA 4YWMA 5J39A 4A3DB 3OYYA 1J9OA 3DM1A 3KK7A 4ABNA 2K01A 2E2DC 3RN2A 3TREA 4RG1A 4ZYSA 2NZHA 1KDAA 3SEBA 1BXTA 4BXXG 3G6JB 5C0XJ 1EFID 3M4PA 4F88A 5EQ0A 4PZ7A 3F8TA 3I2ZA 2VNUD 1I5FA 3CHBD 3L3OC 3K0YA 1PYSB 1UEBA 2C5CA 3G4SA 1DOLA 1XWEA 1F8AB 1NTGA 2CQAA 4AH6A 1I50H 3IRBA 1I50B 2QA4A 3MEFA 4OELB 1LTTD 3CCRA 5IGBA 3SR1A 2IWHA 1C0AA 1RL2A 3PUZA 1TWGH 1V1PB 1TWGB 2DY7A 4ID6A 1VQGA 5JPMC 1MJCA 1J6QA 4XXEA 4DR3L 1G2TA 1STEA 1KL9A 1AH9A 2M8IA 1X65A 4RGNA 3MFYA 2IJ0A 4IJLA 1D5MC 1IBKL 1II3A 3MXGA 3LX0A 3KAGA 4AYBB 1K9RA 4HTHA 4FO2A 3NELA 2EDGA 1K3BC 4WJWA 1V43A 1HR0Q 1EYDA 1GM5A 4LFAQ 3GO5A 4DR7Q 2MDIA 4FXKC 4XIGS 4A3BG 3FS8A 4KLKA 3EVQA 1YNXA 5E7NA 5GADC 3K58A 1IYVA 5ISRA 1TIID 3MZ5A 2QEXA 1XNRQ 1L1OC 2UXDL 2LMCB 2ZTDA 2PZWA 3KF6B 4K5XA 4TVAB 1SNPA 4LFCL 4IUPA 3GTJH 3OMGA 3GTJB 1ONLA 3HKSA 2YSBA 1S40A 1VQFA 1PVOA 3U9OA 4GKJL 2OF1A 4X3KA 2RDFA 4JW0A 3S1RH 4HIOA 4DR4Q 2LXJA 1XMOL 1UE7A 4OL7A 1B9NA 5EAYA 3PIP3 4K2KA 1PZKD 1PINA 1LT6D 1L1OB 2B2TA 1CA6A 1N36L 2EY2A 4A76A 1EYCA 1PA6A 1STAA 4LF4L 2WIIB 1IW7D 3CRKC 2KCNA 4LNQA 1VQIA 4OIJA 3H6MA 1VQ8A 3HZXA 5I9PA 4IUUA 3F2DA 5K36G 2K5VA 1WFQA 3GD7A 3S9WA 3CC7A 4DK6C 1JB7A 2MO1A 3M4YA 2DNEA 4OXPA 5HGTA 2DJFC 4WORA 1I94L 3OIPA 1VQ7A 1IBML 3A8IE 3HKZB 4UHVA 4CDDC 5ELFA 2YTXA 5C44H 5C44B 1NY4A 2KCTA 4CBVA 2N49A 2WB1B 4S3SA 5M5XH 5M5XB 3S15H 1U4MA 3S15B 1CSPA 1VQDA 5IYBH 3FDTA 2Y0SG 2IHFA 3S1NH 3S1NB 1STYA 1WTQA 2HDMA 4R9WA 3PUYA 2GA4B 5IGGA 4JOIC 5EGTA 5ELNA 1Q82C 1VQNA 1TKWB 4B3SL 3EQLC 4BXXH 3NEMA 2MQHA 2LY7A 1SBBB 1NBWA 1N34L 4GNXB 1N32L 1AZPA 3I73A 4JYAQ 3R2TA 1TK7A 2DJYA 2EYJA 1IBLL 4HIKA 2F0GA 3LWUA 4DV6L 2L5TA 3MCBA 3TSSA 3LE4A 4LJZC 4DAVA 1XJVA 3VR4A 2KA7A 3J7A5 1LLRD 1MJEA 1Y1VG 1PYWD 5C5LA 3CCVA 1PYBA 1EUJA 3R8BA 1PFNA 1VQEA 1YNND 2F0TA 1WCMG 5CV9A 4KI0A 1DYQA 3RZOH 3RZOB 4DR5Q 1D5ZC 3B6YA 4HN7A 4OEMB 2KQ3A 3V05A 4Y52H 3ND8A 3FP9A 2UXBL 1STGA 2CQOA 2NZ1D 3K0XA 4GOPC 3LKXA 1NJIC 1D2BA 1PH5A 1CK1A 3TP7A 3GTQB 1SYBA 2RCFA 5IT9L 2N55A 2C9OA 2JX8A 2L4NA 2N3SA 4OWTB 4A3BH 4A3BB 2CH4A 5GAGC 4K6DA 3S1MH 3S1MB 1HH2P 1QUQB 1CKOA 1OTCA 1RTNA 3NUCA 2A73B 3AU7A 2JA9A 1SXTA 1E1TA 1Q8KA 3NWSA 2IL8A 1GUNA 1IBKQ 2JA7G 1G6PA 1TS5A 1EG4A 1PMRA 2YAJB 4L63B 1K9MC 4WRDA 3HOVG 4GLXA 2ICEC 1IYJB 5ELDA 2K5HA 4X62Q 5JJKA 5E5WA 2EYHA 1FL0A 3VR2A 3VYSA 2ZR5A 4LUOA 4RCOA 1PH7A 1BCPF 3D0FA 1DONA 1EQRA 4ZAIA 4NXML 3PV0A 2RHQB 4YHHL 2M00A 2XWBB 3S1QH 3S1QB 2UXDQ 4CJ1B 3Q0AA 2E8GA 4LF8L 3HFZB 3GP7A 1S5ED 1Q86C 4LFCQ 1LT4D 3J80L 2V4DA 1VQ9A 5IGFA 3MVVA 2X6LA 3KF8A 2A5HA 2CWPA 1WD0A 2Q2IA 2XRQD 1B53A 3CRLC 1Q1EA 4KY5A 4DAMA 1EY4A 2AQ2B 1EY5A 1K73C 1KLUD 2MJ8A 1XMOQ 1SR3A 4YCWA 4BY7G 1DJRD 4P2CB 2WADA 3K80C 2A1AA 1IW7C 3K5OA 3U50C 4LF9Q 4LF5Q 5J3BA 3GTOH 4QIBA 3GTOB 1JOOA 3C1EA 2WAQB 5ELBA 3S14H 2Y0SB 3S14B 1NMVA 2BDNA 1FNUA 1GUOA 4HMJA 1SMYC 3WH0A 1V1OA 3TC5A 1HPCA 5M3MG 3C1FA 2VQFL 3KAIA 5EBDA 5FJ8H 1RHPA 3A54A 5JEAG 5EPKA 2YU9H 1PFBA 3CU7A 2YU9B 4P72A 3CQZB 2VUMG 3S2HH 3S2HB 1JJCB 3VR6A 4XQQA 2IX3A 1KHIA 3KAHA 3L0OA 4JK1C 3KDFB 2LFNA 5CV8A 1V1PA 2NN6I 1EQTA 1SNMA 1IBMQ 1D7QA 1H9RA 2L9HA 1VQOA 4F8MA 1X6OA 3MQGA 3QJYA 2F4VL 3S16B 2DUDA 2Q2UA 2ZQSA 2K33A 4P74A 5NUCA 2NBFA 1H9SB 2EXDA 4G7OC 3NTKA 5LHY1 5IGDA 4DU9A 4DAPA 4U85A 3OIQA 1PFSA 3H3VC 4A3FG 3L2PA 1JWSD 4B3SQ 3I56A 4M8AA 5CBEE 2QCPX 4POFA 1HNZL 2VL6A 1SNDA 1S5BD 1Z7TA 3SVMA 1LABA 2E2JH 1PH3A 1M90C 5JVH3 1IBLQ 1LTRD 4CDCC 3MEHA 3DWQA 5M5YH 5M5YB 2HHHL 3SK8A 3O13A 1BNZA 2B3GA 1SYDA 3WWVA 3GDEA 1EOVA 1SDFA 1D8LA 3DMUA 1CA5A 2RF4A 4ME3A 2UUBL 4UY8C 3H3VH 4C1NK 2JSOA 4IPGA 2B2UC 2EJGC 4EQOA 1HJPA 5KEEA 4HSVA 4J1MA 1EG3A 3K5MA 4KD3A 2HCCA 1H9JA 1VQCA 4KY7A 2SOBA 3HG9A 3G71A 5EPLA 2JQOA 1TWFH 1Q7YC 1TWFB 2Q5AA 3HOVH 3HOVB 2UXBQ 1BBWA 1SJHD 3G7LA 4WJ4A 1L1OA 1U4PA 4L8JA 5AJ3L 3W2DA 1MKHA 2CW0C 3BVMA 4JBMA 1SE4A 1Y14B 4CJ2C 2YSGA 3I90A 5C5MA 3CPWA 1B2TA 3MAQA 4HIMA 1CM9A 1RF2D 3J81j 3FPUB 4BY1H 3IKJA 4BY1B 3PO3G 4A93G
chains in the Genus database with same CATH topology
1PRTD 5CR3A 5LL6X 1CI3M 3X3MA 4JI7L 1X3FA 4EGVA 1QILA 1V9PA 1BQQT 1D1KA 1XX8A 1ZYRD 1GKHA 5E65A 1U0LA 5EBCA 5DM63 1G2SA 4GZYC 3U58A 4A3DG 4DR1L 1F77A 1LACA 1HZCA 2M8JA 5EJWA 5M9OA 1UAPA 4RGMA 1SJED 4L5QA 3NK9A 1W2BA 4HR7B 1SNOA 3NTPA 1STHA 2KHIA 4AYBE 4K0KL 3NBHA 1E22A 1CZWA 4B9WA 4NXMQ 2K32A 2R7FA 1TS2A 2Z4IA 3BG3A 4MNOA 4YHHQ 1VQKA 3CD6A 2XGTA 1NMGA 3RLFA 4IALA 2MFIA 4ALPA 4MHEA 2X6GA 1K8GA 3T53B 1E24A 4LF8Q 4LFAL 2L11A 2JA5G 1RDPD 5ELOA 2XWJB 1QG7A 4K2LA 1ZEQX 5JJZA 1SYEA 2B2VC 3NXWA 1HTPA 5EKKA 3A8JE 4J15A 4QIWE 1XTDA 3A5ZB 5IP7H 1HCZA 4K8JA 1WD1A 2Z6KC 5I2YA 2HQLA 3TMEA 5C3EG 4F7XA 4IO9A 3HP3A 1JOQA 5IYCG 3MA2B 1RTOA 4JI4L 4H0LC 5T1GA 1LT3D 2E75C 1ENAA 4QMGA 3KJPA 3PUXA 4DA2A 4JI5Q 3F2BA 1HZAA 3RR5A 4E5RA 2Q8RE 2IW3A 3A56A 3W1BA 2DK7A 2VXWA 2SDFA 1Y69U 2L15A 2UU9L 5IT9E 3ERSX 2F0KA 3UDIA 2VQFQ 2Z0SA 1I3QH 1I3QB 1SYGA 2K05A 3FKIH 4NXNL 3FKIB 1N33L 4DV1Q 2HIXA 4WFN3 1Q1BA 3EROA 5TSSA 1PFMA 4HIDA 2IX1A 1OXTA 4LMQD 1M1KC 2Z8LA 1QUQA 1NMFA 3N52A 2IX0A 5CV7A 1STNA 5CMDA 2F4VQ 4A3IG 3PIPA 4QQBX 2XNAC 1JC7A 2WFWA 1QE6A 4GOPA 5JVG3 4MN3A 2N8NA 1I4PA 2F0JA 2WB1E 5KRUA 1TU2B 5EPJA 3CCJA 1F9RA 4C1NI 2VQEL 3C46A 3ITPA 1X3EA 4GKKQ 2EYFA 1Q81C 1PLFA 1HNZQ 1XPRA 4C3IH 4IUNA 5E1FA 4RGOS 4HJ7A 2IY5B 5J1ZA 2DN8A 1E0BA 4HJAA 4IFDH 4C3HG 2E76C 1EY9A 2HHHQ 4GLAC 2O5JC 3MTSA 1TVXA 1JT8A 3DEPA 1KLGD 3K81C 3J80E 3STBC 1ZKOA 3GQBA 4FP5D 2PPBC 2PZUA 5U47A 2IHEA 2UUBQ 1ZCNA 4AQYL 2KUMA 5M3FG 2ZR6A 3CP0A 1QOHA 4BWGB 2TMPA 2ZQUA 4ODGA 3HKZG 3LGJA 3CF5A 1TY0A 4KHZA 1PTOF 1AFPA 5T1IA 1A6XA 2AKWB 4FVMA 5M5WB 5M5WH 1H9MA 2CCZA 1FLCA 3EJIA 1O7ZA 1EIHA 5IYBG 5BN4A 3DEOA 2YSFA 2EY6A 1EWHA 1OXXK 4KHVA 1PTOD 4FXDA 1EIYB 5AJ3Q 1FVIA 3EA6A 2F0EA 3TDQA 1PRTC 1R4PB 4DR5L 2WINB 1S4ZA 1U5KA 2XP6A 3K6OA 1E2WA 2E2IH 5KNCA 3QWNA 5G3LF 2NB0A 2EZ5W 2ZQTA 4OGQC 4FF1A 4X65L 1JJ2A 1QVCA 1JOKA 2JA5H 4JI7Q 4RA8A 2JA5B 1KABA 1C48A 3TZUA 1NSNS 4J8QA 2PQEA 2N88A 5G3LD 1H9KA 1QCBD 3AEVA 4PZ6A 2XPAA 1Z6HA 2BDOA 2KCCA 4DR1Q 3RNUA 3BZCA 3RLOA 3EFXD 2PQAA 3C2PA 2B39A 5C3EH 5C3EB 1PRTB 5A2QL 4R4CA 2K75A 1MD2D 2OT2A 3E9HA 5IYDH 2B8FA 5IYCH 1H9SA 4K0KQ 2EQSA 3CCEA 2OCEA 1PZJD 2NYZD 2QF7A 1B1ZA 4QL5A 4X62L 3I3CA 1JE5A 3M4QA 4KKTA 1E2ZA 5K5PA 1P16A 2Q8IB 1EY0A 5E3FA 1KDBA 2K5WA 3FSCA 2HCIA 3SDZA 2KECA 4JI8Q 4MIUA 2NVTH 2NVTB 2CKZB 1CZGA 5D3DA 1QZHA 2L1BA 1EU4A 1CT1D 3CC2A 5I2XA 1PZID 1T9HA 4XDXA 1K8OA 2A6ED 1SYCA 4E6IA 5CC4A 4DK0A 4JI4Q 5KNDA 4A3IH 4A3IB 3H15A 2AHOB 2RDHA 5C0XG 1YJWA 3KFUA 5JJIA 4H44C 2JA8H 3S1RB 4I65A 3D4RA 1X32A 4RFBA 2F3VA 1VQLA 1F2YA 4LUZA 3K57A 1CUKA 4LF9L 4LF5L 1ASYA 1GUWA 2Y0SE 3L4HA 2UU9Q 1GXDC 1Q46A 3MFGA 4N9TA 4GN4B 1Y1WH 1Y1WB 2K5NA 3ND9A 4NXNQ 1N33Q 3PF5A 4KV6A 1UNSA 1Y8NB 3BYYB 3I4OA 3HOUG 4JG2A 2A68D 1A8VA 2B2UA 2ATWA 4C3HH 4C3HB 3J81c 3U9SA 1EWCA 1CKNA 2ICIA 2K1BA 4IURA 4LF6Q 2PNRC 4A3LG 1PH4A 1CQVA 2ZJPA 3VR3A 4N9PA 2E2HH 3KLSA 1EOTA 1UUPA 2E2HB 4Q0FA 4GNXC 5IGEA 5HY6A 5M3FH 1S5CD 5M3FB 1G51A 2A8VA 3KBXA 2O5IC 4PMWA 5GQOA 1SRUA 4ZK9B 1HHVA 2VQEQ 4X3UA 2DMVA 2EYPA 2MPMA 2QEJC 2E74C 2F0UA 3A74A 2WAQG 4UP8A 1TR8A 1VQHA 4DV7Q 2R61A 1DZ1A 1PH9A 4DV0L 3H0GH 1RKNA 3H0GB 2D62A 4CKBA 4DK1A 1B44D 2FMCA 1WYDA 1AP0A 4GN3B 4YIJA 3RMHA 1EL0A 5FJ8G 4MTNA 2FMMA 1SNCA 1YHBA 1F2ZA 4Y7NH 4Y7NB 4AQYQ 2XP9A 2AQ3B 1JQYD 4A3KG 3J7AF 4CKCA 2ZJQA 3D4DA 3OWFA 3G6EA 1MSGA 4X64L 2BA0A 3JAMc 3CMEA 2ITKA 3MXPA 3OOCA 2R3ZA 4X3SA 1ZXTA 2JXWA 3I4LA 4O1NA 2NVQH 2NVQB 4H13C 3M3YH 2R93G 3M3YB 3M7NA 5LMUL 1JICA 2XTIA 5IP9G 3MWYW 2YSHA 3WOFA 1EWIA 4PMCA 2B2VA 4XT1B 4B3TQ 1Q12A 2O2LD 5J22A 4RMFA 1WTPA 2OXPA 2NVYH 1GUSA 2NVYB 2YTVA 2XP4A 2Z6KA 1PTOH 3PF4A 1PTOB 1YHQA 5LMNQ 1WJJA 4X65Q 3IL8A 3CCLA 3NE5B 4OO1G 1L2FA 2HUGA 5KYLA 4YWKA 2G9DA 1JWUD 4KN7C 3I8ZA 4DV4L 1HNXL 2PCFB 2RSOA 5CV6A 3H91A 3OHXC 3OSOA 3HS0C 1BBUA 2I46A 4C3JB 2K03A 1ICWA 4C3JH 5CV4A 2RA4A 2BOSA 2F4IA 3D6CA 1B50A 5GAHC 4A75A 3NTIA 2JA6G 1SAPA 1I4RA 2PI2A 3KADA 3HOXG 4IPDA 3A55A 3AFPA 1BVSA 1JB3A 1YI2A 2EYLA 5C0XH 2OQKA 2R6GA 2YV5A 4J6HA 1PDQA 1B70B 3VR5A 3DXJC 4DAYB 1GHJA 2PMZB 3T1HL 2QRVA 4P75A 4RKBA 1CHPD 4FF4A 1Y8OB 5JEAJ 1SNQA 4IOCA 5I6WA 1ESFA 3I91A 2A6EC 1EEID 1SMXA 4BY1G 1A2UA 1UWVA 3E0EA 1V8QA 1G8ZD 2QILA 1BCPD 3HOUB 3HOUH 4QUFA 1OXSC 1V1QA 2VY3A 1FR3A 1L0YB 3S17H 3S17B 3WOEA 4A3LH 2LSSA 3TEHB 2F3WA 3RUZA 3A7AB 2CHBD 1KIXA 3Q23A 3H09A 3NPPA 2EOTA 4B3RQ 2SEBD 3J81i 3A5UA 2A6HD 3I7FA 2ZXRA 3NSWA 2CFMA 3BZDB 2F52A 2WAEA 2A68C 5DLQE 2JV4A 4DN4M 4R4IA 2ZXOA 1EEFD 4DK3C 3C3LA 4F87A 2D5DA 4JI5L 4U68A 1BOSA 4ZKBB 4DV5Q 2SNMA 2MHVA 4RWSC 3QIAA 3GV3A 5JAVA 1SSOA 4DXGA 3BDLA 4B3ML 1VDZA 5IP7G 2AMCB 3K8AA 3KABA 2PNHA 1EY8A 2RE3A 4DV1L 3A0JA 3IFDA 2XSCA 4K6LA 3M4OH 3M4OB 4A3KH 2JXMB 4A3KB 5A2QE 1TT2A 3J7AV 1D6EC 1H95A 1IL8A 1EFWA 2PI2E 4A3EH 2OWOA 4A3EB 3TP6A 2UXCQ 4DV3L 1HRJA 1HQMC 1WOCA 4DV0Q 1VQBA 4KMUC 4DR6L 2R93H 2R93B 1AN8A 3GTGH 3JAMi 3GTGB 5IP9H 1UE6A 4TSSA 5C4XH 2WP8J 1BR9A 4C56C 1YVCA 4GKKL 4UDUC 3TZDA 2NZOA 2I07B 3FEWX 5C6AA 2QGQA 4O2DA 1LM0A 1I6HB 1I6HH 1OXUA 3FKIG 2E2JB 1KQSA 1HTLD 3SHLA 4JC0A 1KNEA 1PH6A 4LK1C 3LNNA 4PNYA 4OO1H 2PW7A 1HR0W 3KF6A 1YNNC 3E6ZX 4X64Q 1FGBD 1KAAA 2K04A 1FD7D 4HCSA 2AUKA 5FLXc 4QUCA 5HGQA 5IOCA 1STBA 3E0JA 5LMUQ 3TBIB 2JA6B 2JA6H 3H3VI 4JBJA 1VQPA 3HOXH 3HOXB 3IFTA 1F9QA 1NUCA 4G57A 3UDGA 3PIO3 3ZJYC 2A69D 1O80A 2F0WA 3T4AC 1KTKA 4C3IG 3W3AA 4ME5A 1VS0A 1GUTA 2FHTA 1VMCA 3NTHA 2KEEA 1BF4A 4IFDG 3TP5A 2DNCA 4LFBQ 2XP3A 2H4OA 3ERQA 3SK5A 5D65A 2UUAQ 1WTVA 4UPAA 2Z4HA 1IL2A 2ZAJA 3GTQH 3GTQB 4DV2L 4FF3A 2E2IB 1BBXC 1CTMA 4DNTB 4DV4Q 1L0XB 3NQTA 1HNXQ 4KHPQ 5DM73 1GO3E 3TCZA 4XYOA 4ZKCB 3P1HA 1J5EQ 1LT5D 4V190 3OW2A 3I4MG 1SE8A 4FF2A 3HOWG 1I4XA 1C7YA 1VQJA 4HJ8A 1NR4A 1R9TH 1R9TB 3K5NA 2K4KA 3Q24A 1K3RA 4R4QA 4LF7Q 5IODA 1M8AA 3T1HQ 2B2WC 3UI2A 2O4XA 3LWEA 3CMAA 4RHSA 3QOLA 1E2VA 1KDCA 1EU3A 3OWEB 3SXHA 1L0WA 3QOJA 1WI5A 1WTOA 3K5LA 2HQEA 3AYHB 4GNXA 2DWVA 4JI2Q 1KD1C 2AWOA 4APVA 1WTRA 2R7ZH 2R7ZB 2EXZA 2F0SA 4JI8L 5CORA 1PXUA 2Q2TA 4HAEA 4IUTA 3EBEA 3QO2A 3T13A 1LTSD 1EY7A 2RSNA 3KLSX 1RIPA 4IPCA 1BCPB 5FK9C 4DPGA 2OTJA 5IYDG 2AWNA 3ER0A 2OEOA 4YCUA 2X69A 3GV6A 1YNJD 3PSIA 5FO8B 2EZVA 5BN5A 4DNIA 4RHRA 1LO5D 5E4XA 4B3MQ 2MO0A 4QY7A 2I5LX 5BR8Q 4G4KA 2RDGA 3FMCA 1RCVD 3BVGA 3FRPB 3UE1A 2F0LA 5IWAQ 2NVXH 2NVXB 1HA6A 1YJ9A 1BDOA 3PQHA 2H5XA 2RKSA 4NMZA 1HZBA 2RBMA 2I5HA 3M85A 2CWAA 4C2MH 3V96A 4C2MB 5KIXA 4LF6L 4A3GG 3D4WA 4JI0Q 1MBYA 4CGYB 4TKOB 1S72A 1FJGQ 3T56B 2G9HD 3HKZE 1LV9A 5KGUA 4DV3Q 4HJ9A 2JA8G 3Q8DA 3W1GA 1QZGA 4DR6Q 1O78A 2DY8A 1A2TA 4B08A 2L12A 3CPFA 3AFQA 3DUZA 4DAYA 1A3UA 1IKLA 1VCIA 1W3SA 4DV7L 4KKUA 4C3IB 1Y1WG 2XN9C 2R7DA 2EJMA 2OQ0A 4MZ9A 2YYZA 1EY6A 2BA1A 3EN2A 2E5LL 1YHAA 2EYOA 1JMQA 1YITA 5C3XA 5GAEC 2LXKA 4OWWB 1EZ8A 4ZLTF 1JMCA 1YZ6A 4IFDI 3FPPA 1S5DD 2D0PA 1CSQA 2JK8A 3TP8A 2A69C 2PZTA 1E1OA 3I4MH 3R93A 3I4MB 3GTPH 3GTPB 1X56A 3S24A 2SNSA 1SN8A 1F2MA 2Q8TA 4R1JA 3HOWH 3HOWB 2RQXA 1X3PA 4LUVA 4DUYL 1TY2A 3J81L 1LTBD 1U4LA 3H0GG 1EYGA 4DUZL 3KCEA 1Z47A 1BUVT 5FLMG 1JCKB 2KEDA 5D14A 2ZTCA 4DFAA 2A19A 2Y8NB 5FO7B 4B3TL 1VF7A 1ZYRC 3KUPA 4DV2Q 2UUCL 3MC0B 4BBSG 3D31A 1LTAD 4JBWA 4KJNA 5LMNL 3J7ZC 4JCVE 3URYA 4JI1L 4KTAA 1O7IA 1X3QA 1HUMA 3F2UA 5IY0A 2ID0A 1A3VA 3KDFA 4EVOA 2JP1A 2WV6D 3S2DH 3S2DB 4OWXB 1UE5A 1GOZA 1RJTA 1HFGA 1AW7A 1R4QB 3A7LA 4YY3L 5CV5A 3OOBA 2F03A 1K9QA 1O7LA 3Q22A 2B2YC 5ELCA 5HURA 4ULLA 1TXYA 3JAML 1LYLA 2JYOA 2PMZE 2XIWA 3OMCA 4YCVA 1EIGA 3A8KE 2Q2HA 5H1SE 3R3OA 4A3MH 1DCZA 4A3MB 1LTLA 2VB3X 1DD2A 2NTTA 1K8MA 2GVBA 2ZM6L 4IQZA 1JE4A 3BZKA 3K59A 4GLVB 3L9AX 1HZ9A 1TWCH 1TWCB 3OPOA 4G7HC 1B8AA 1MGSA 1YNJC 2H1EA 4C3JG 2VZAA 1EQVA 1I4GA 5FO9B 1A62A 2KHSA 3EIVA 1X9NA 4A3GH 4A3GB 3PO2G 4XYQA 4ZQ3A 2KOLA 1ET6A 4B3RL 2QKIC 3HOZG 2JA8B 1XMQQ 4QIWB 2M9VA 5COYA 4NW2A 2WAQE 1K0RA 2CVRA 1YJNA 3CCMA 1CKMA 4FNFA 4QF4A 5FKAC 3CW2C 4QGUA 3G48A 1OXVA 1I5HW 4DV5L 4IUQA 2F1MA 2HIVA 3KYHC 1F9SA 2KXQA 1XTCD 3M7GA 5CBAE 3RZDH 3RZDB 2K7VA 1Q90A 4L5SA 2BH2A 1TR5A 1M4VA 4UP7A 3ULLA 4IUVA 4HEDA 2GN5A 4HJ5A 1HFNA 1IXRA 4ZUJA 1G6ZA 2F0IA 3NHHA 1PHJA 1KC8C 4HSPA 1NE3A 1E3PA 5I9OA 1G91A 5BN3A 2B63H 2B63B 1A3TA 1DM0B 2K5QA 2KJXA 5CYUA 5LL6S 5C3WA 2UXCL 3L7ZC 3PGZA 1EYAA 2ZXPA 3AQQA 2RCNA 5FOBB 2K52A 2RVLA 1SMYD 4BS9A 4K8IA 2LKVA 4HMIA 2KHJA 4H7BA 5FLMH 1QVFA 1VQ4A 1XNQQ 2B29A 2E5LQ 4KY6A 3P20A 2K14A 2NTSA 4BA2I 5IGCA 4HCEA 4A4IA 3ICEA 4BBSH 4BBSB 3CCUA 4O42A 4XQJA 5E66A 3NBHB 3KAFA 4XT3B 3U4VA 1PTOC 1ILPA 3FSBA 2B2WA 3SK4A 2M3OW 3E5SA 2XP7A 1HUNA 3MXUA 3DWPA 2DGYA 3P7JA 1B4OA 1QWYA 1UE1A 2EPBA 4A3EG 4DUYQ 1C8CA 1YIJA 1JWMD 2NN6G 4A3CG 4R8NA 4DUZQ 4KK7A 1CFMA 3T1YL 5C4XG 2F0MA 1A63A 4DXFA 1AEXA 3VYTA 3N6RA 2UUCQ 2GVAA 3NWTA 5ELEA 3U4ZA 1I6VC 2ZR4A 1EQQA 2K28A 4L5RC 3DWAA 4LFBL 4U86A 4JI1Q 4Q5VA 2UUAL 4UAIA 4X66L 4UP9A 4P71A 3VYRA 1CHQD 2BCOA 4PZ8A 4KHPL 3QG1A 1IZ6A 1BO0A 1SLJA 3F1ZA 1J5EL 1O7YA 2A74C 3PIOA 3CCSA 3T16A 4O0AA 3RD4A 3DLLA 3I70A 4YY3Q 3HGBA 3K7AH 3K7AB 1WTWA 3PO2H 3PO2B 1SE3A 2D9UA 3HOZH 3HOZB 3PCOB 4EX5A 4BBRG 2CW0D 1HXYD 2K5DA 5C0XI 4LF7L 1GUGA 4DR3Q 3IAYA 1OO9B 5FLXL 2XRSD 1WMVA 1X3GA 2WKDA 2ZM6Q 4K14A 4GOPB 2J4XA 3CC4A 4NB3A 4NP5A 2Z1CA 1MI2A 4R8IA 2VS1A 2YSIA 4WJ3M 4JI2L 5DEHA 1B9MA 1CQFA 4NDXA 2EE1A 1LTID 4K5VA 1FYCA 4K5WA 1XPUA 1C4QA 1N8RC 3MXNB 1HNWL 3GTKH 3GTKB 1GVPA 3X3NA 4KD4A 2AQ1B 2EJFC 1VMPA 1ET9A 1NAPA 1FNVA 2N78A 3J81E 3M9BA 2R92G 1S5FD 3ULJA 4U84A 1Q3LA 2V1CC 4NPSA 1YEZA 5GROA 4TRDA 5C4JH 1TWHH 5C4JB 1TWHB 3JC66 3D6WA 2XP5A 4R4OA 4RGTA 2BE5D 5K36H 1ENFA 4RH6A 4DGZA 4GKJQ 1S3OA 3BU2A 3BS1A 1O6WA 5D3IB 3HRZC 1WR7A 4NKLA 3FVQA 5C4HA 2MUYA 2JE6I 3OTOL 3H94A 2R7ZG 1FNWA 2F0OA 5BR8L 2NUCA 1VQ5A 1T5XD 4JI3L 4YWLA 4RAUC 1QNKA 5IWAL 1N36Q 1KXLA 4LF4Q 3GTMH 3GTMB 2EIFA 1XPOA 4B9XA 1YBYA 1ENCA 2KVMA 1DOMA 4JI0L 1Q8IA 5IE8A 4GN5A 2M2LA 2L55A 2D0OA 3CAMA 1DGSA 1FJGL 4JV5L 4LWCA 3R2IA 1D1IA 2ZJRA 1I4QA 4PV1C 3CQZH 3CNGA 2NN6H 4RCNA 2JEAI 4AIMA 3JAME 2LAJA 4A3CH 4IFDJ 3D8GA 4TQUS 1ML0D 2EY1A 5C4XB 4BA1I 1WVLA 1I94Q 3HOYG 2EYMA 2F0NA 1KRTA 4GS3A 2IPKD 3KLRA 3VA7A 4H02A 1RODA 1XYIA 2PQAB 4QB4A 1Y1VH 3PUWA 1Y1VB 1PV4A 3S16H 3SK6A 1TWAH 4OIKA 1TWAB 5CQ2A 5IT9c 4IPHA 1TQOA 5AFWA 2B8GA 5I4DA 4IOAA 2JMFA 2HT1A 4KN4C 2PW5A 2PYKA 4CHTB 1WCMH 1WCMB 5I6YA 2B2YA 4OO1I 2XP8A 4IN3A 3TS0A 4XQNA 3TQYA 1GD7A 4JI6L 4OX9L 1N32Q 1N34Q 1PH8A 1W6JA 1FGUA 1HA5A 3KBGA 1AE2A 1MSHA 3TDBA 4DV6Q 3UE0A 1EZ6A 2L4JA 3T1YQ 4DNRB 1U4RA 2AUJD 3BVZA 2RHSB 4DR2L 4L6TB 2ZTEA 2B2TC 1A15A 4QCLA 3NQIA 3KJOA 4PMBA 5E62A 4ILWA 1SFOH 1SFOB 3ZYYX 4BBRH 4BBRB 1DOKA 1RP5A 2BH8A 1IYUA 1QVGA 2I0QA 3UDXA 5F2DA 2KCMA 4X66Q 3STBD 5A35A 2HDLA 2ZT9C 2J0TD 3GTLB 2VB2X 2JA7H 2JA7B 2ENBA 3GTLH 1RD9D 2FJ2A 1IKMA 4KKSA 5IIFA 4JBKA 1KAWA 3VYUA 1B3AA 3BYTB 4U673 1KRSA 3J80c 3I55A 3I4NG 4A3JG 3VDYA 3P75A 5EKLA 1PRTF 2JJQA 1U9RA 4FXGC 2KENA 3E9IA 2FINB 3SE0A 1GJXA 2FFKB 2VW9A 2R92H 1VF5C 2R92B 3DHQA 4DKAC 3ULPA 1CKNB 5JJLA 1X55A 2ALYB 3MQHA 3NENA 1XXGA 1Y8PB 1VQ6A 1BCPC 3K7UC 2NWGA 3V2TA 2PO4A 4EQPA 1W6KA 1B7YB 1X54A 3Q6SA 2EVBA 4P73A 3SGIA 3AMUA 4R4TA 2E45A 3TN2A 2TSSA 3FHWA 4BY7H 4BY7B 2A6HC 1E7ZA 1QNUA 1Z9FA 1HNWQ 3CXCA 4CKEA 1ASZA 1VQMA 2MGSA 1K83H 1JJGA 1K83B 4EQNA 4OONA 2F0FA 2XVSA 3BDCA 3RLNA 3RN5A 1HQRD 1DXMA 3TRZA 1SE2A 2BE5C 2J7ZA 3UDFA 3VA5A 1HR0L 2F0DA 3PUVA 3HEJA 4DR7L 1NCVA 5DNFA 5M3MB 5M3MH 3CCQA 1F9PA 5KNBA 4OHJA 3D3RA 2ASBA 2KBNA 5JEAH 3BDOA 1XNRL 3MCBB 2VUMH 2VUMB 1XMQL 4XTCS 4M1UB 2WACA 1JR0D 2QDBA 4Z9CB 4I7ZC 4A0UA 2K50A 1TS3A 4JOIA 3HOYB 1SROA 4A3MG 4FDBA 3HOYH 4PQXA 3ODKA 3I72A 3OTOQ 5E64A 1QJOA 4A0TA 2ZQVA 4JI3Q 1SYFA 2F0QA 1WTXA 4AYBG 3F2CA 3T51B 1ESRA 4LW1A 4DR4L 2I5MX 1F2LA 2MP1A 2OTLA 1K8AC 4G7ZC 2DK1A 2FXQA 5LMNW 4POGA 4A3FH 4A3FB 1BKBA 1A0IA 1LUZA 3LKXB 1KNAA 2C35B 4JV5Q 4IZ8A 1IHZA 1LTGD 2YTYA 2ES2A 1PH1A 5AHTA 3WDNA 1YW5A 3OW7A 3BJUA 5EKIA 4DF7A 2LS01 2MNAA 1TS4A 1D5XC 3J7YW 2IT1A 4KJOA 2F0VA 4IJHA 2XPBA 4QJFA 5FLXE 5JOBA 5E4WC 4LAAA 1T5EA 3KLWA 1SEBD 3NBIA 1NR2A 1UEAB 2L0CA 2F0HA 1G291 1XNQL 5CGKA 4ZRZA 3CKIB 3MHBA 3NP8A 2F0PA 1AE3A 4PG3A 3TS2A 1GHKA 3MXNA 2D2CC 4REXA 1VQAA 4X3TA 4OX9Q 4JI6Q 1ILQA 2EY5A 1P8LA 3I4NH 3I4NB 4A3JH 4A3JB 5KYIA 3KOJA 4CJ0B 2F21A 2B63G 3DM3A 4RKLA 3PMFA 4X6AH 4DR2Q 4EQ5A 1C9OA 4V0BA 1MIUA 3J80i 4JYAL 1I4HA 5DAUA 1N9WA 4FYDA 5C4ZA 3QB3A 3PO3H 4A93H 3PO3B 4A93B 1PH2A 2F3IA 1JORA 4L5TA 2JEBI 2WKCA 3KF8B 1J8IA 5C44G 1EIFA 3AB9A 4ZUIA 5JPNC 1QB5D 3W5OA 2WB1G 3ONAB 2K6AA 4A3DH 1AZQA 4A3DB 5J39A 4YWMA 3OYYA 1J9OA 3DM1A 3KK7A 4ABNA 2K01A 2E2DC 3RN2A 3TREA 4RG1A 4ZYSA 2NZHA 1KDAA 3SEBA 1BXTA 4BXXG 3G6JB 5C0XJ 1EFID 3M4PA 4F88A 5EQ0A 4PZ7A 3F8TA 3I2ZA 2VNUD 1I5FA 3CHBD 3L3OC 3K0YA 1PYSB 2C5CA 1UEBA 3G4SA 1DOLA 1XWEA 1F8AB 2CQAA 1NTGA 4AH6A 1I50H 3IRBA 1I50B 2QA4A 3MEFA 1LTTD 3CCRA 5IGBA 3SR1A 2IWHA 1C0AA 1RL2A 3PUZA 1TWGH 1V1PB 1TWGB 2DY7A 4ID6A 1VQGA 5JPMC 1G2TA 1J6QA 4XXEA 1MJCA 4DR3L 1STEA 1KL9A 1AH9A 2M8IA 1X65A 4RGNA 3MFYA 2IJ0A 4IJLA 1D5MC 1IBKL 1II3A 3MXGA 3LX0A 3KAGA 4AYBB 1K9RA 4HTHA 4FO2A 3NELA 2EDGA 4WJWA 1V43A 1HR0Q 1EYDA 1GM5A 4LFAQ 3GO5A 4DR7Q 2MDIA 4FXKC 4XIGS 4A3BG 3FS8A 4KLKA 3EVQA 3K58A 1YNXA 1IYVA 5E7NA 5GADC 5ISRA 1TIID 3MZ5A 2QEXA 1XNRQ 1L1OC 2UXDL 2LMCB 2ZTDA 2PZWA 3KF6B 4K5XA 4TVAB 1SNPA 4LFCL 4IUPA 3GTJH 3OMGA 3GTJB 1ONLA 3HKSA 2YSBA 1S40A 1VQFA 1PVOA 3U9OA 4GKJL 2OF1A 4X3KA 2RDFA 3S1RH 4HIOA 4DR4Q 2LXJA 1XMOL 4OL7A 1UE7A 1B9NA 3PIP3 5EAYA 4K2KA 1PZKD 1PINA 1LT6D 1L1OB 2B2TA 1CA6A 1N36L 2EY2A 4A76A 1EYCA 1PA6A 1STAA 4LF4L 2WIIB 1IW7D 3CRKC 2KCNA 4LNQA 1VQIA 4OIJA 3H6MA 1VQ8A 3HZXA 5I9PA 4IUUA 3F2DA 5K36G 2K5VA 1WFQA 3GD7A 3S9WA 3CC7A 4DK6C 1JB7A 2MO1A 3M4YA 2DNEA 5HGTA 4OXPA 4WORA 1I94L 1VQ7A 3OIPA 1IBML 3A8IE 3HKZB 5ELFA 2YTXA 5C44H 5C44B 1NY4A 2KCTA 4CBVA 4S3SA 2WB1B 3S15B 5M5XB 2N49A 5M5XH 1U4MA 3S15H 1CSPA 1VQDA 5IYBH 3FDTA 2Y0SG 2IHFA 3S1NH 3S1NB 1STYA 1WTQA 2HDMA 4R9WA 3PUYA 2GA4B 5IGGA 4JOIC 5EGTA 5ELNA 1Q82C 1VQNA 1TKWB 4B3SL 3EQLC 4BXXH 3NEMA 2MQHA 2LY7A 1SBBB 1NBWA 1N34L 4GNXB 1N32L 1AZPA 3I73A 4JYAQ 3R2TA 1TK7A 2DJYA 2EYJA 1IBLL 4HIKA 2F0GA 3LWUA 4DV6L 2L5TA 3MCBA 3TSSA 3LE4A 4LJZC 4DAVA 1XJVA 3VR4A 2KA7A 3J7A5 1LLRD 1MJEA 1Y1VG 1PYWD 5C5LA 3CCVA 1PYBA 1EUJA 3R8BA 1PFNA 1VQEA 1YNND 2F0TA 1WCMG 5CV9A 4KI0A 1DYQA 3RZOH 3RZOB 4DR5Q 1D5ZC 4HN7A 3B6YA 2KQ3A 3V05A 4Y52H 3ND8A 3FP9A 2UXBL 1STGA 2NZ1D 2CQOA 3K0XA 4GOPC 3LKXA 1NJIC 1D2BA 1PH5A 1CK1A 3TP7A 1SYBA 5IT9L 2N55A 2C9OA 2JX8A 2L4NA 2N3SA 4OWTB 4A3BH 4A3BB 5GAGC 4K6DA 3S1MH 3S1MB 1HH2P 1QUQB 1CKOA 1OTCA 1RTNA 3NUCA 2A73B 3AU7A 2JA9A 1SXTA 1E1TA 1Q8KA 3NWSA 2IL8A 1GUNA 1IBKQ 2JA7G 1G6PA 1TS5A 1EG4A 1PMRA 2YAJB 4L63B 1K9MC 4WRDA 3HOVG 4GLXA 2ICEC 1IYJB 5ELDA 2K5HA 4X62Q 5JJKA 5E5WA 2EYHA 1FL0A 3VR2A 3VYSA 2ZR5A 4LUOA 4RCOA 1PH7A 1BCPF 3D0FA 1DONA 1EQRA 4ZAIA 4NXML 3PV0A 2RHQB 4YHHL 2M00A