2BA1A

Archaeal exosome core
Total Genus 36
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
36
sequence length
179
structure length
179
Chain Sequence
MRFVMPGDRIGSAEEYVKGEGVYEEGGELFAAVAGKLIIKDRVAKVESISPIPEIVKGDVVLGRVVDLRNSIALIEVSSKKGENRGPSNRGIGILHVSNVDEGYVKEISEAVGYLDILKARVIGDNLRLSTKEEEMGVLRALCSNCKTEMVREGDILKCPECGRVEKRKISTDYGKGEW
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural framework for the mechanism of archaeal exosomes in RNA processing.
pubmed doi rcsb
source organism Archaeoglobus fulgidus
molecule tags Rna binding protein
molecule keywords Archaeal exosome RNA binding protein CSL4
total genus 36
structure length 179
sequence length 179
chains with identical sequence B, C
ec nomenclature
pdb deposition date 2005-10-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF10447 EXOSC1 Exosome component EXOSC1/CSL4
A PF14382 ECR1_N Exosome complex exonuclease RRP4 N-terminal region
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.20.70.10 Mainly Beta Single Sheet Ubiquitin Ligase Nedd4; Chain: W; Ubiquitin Ligase Nedd4; Chain: W; 2ba1A03
2.40.50.100 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 2ba1A01
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 2ba1A02
3M85A 1YIJA 1IYJB 2OQ0A 1HZBA 2D0PA 4A3EH 2E74C 2DN8A 4L8JA 3CC7A 1I5FA 2NN6G 4H02A 1VF5C 5JEAG 5M5WH 1CI3M 4BBSH 4QJFA 2DJYA 5AHTA 1K9QA 1MJCA 1EOVA 2PMZE 3J81c 3W3AA 2KXQA 3J81j 3K7UC 1L1OC 3I4NH 4Y52H 2UXDL 1B70B 3GTQH 2XGTA 3HGBA 3K81C 4BBSG 4A75A 1WOCA 1VDZA 2ZQVA 1VF7A 3KLRA 1QZGA 4AYBG 3MXUA 4DUZL 2RHSB 2ZJRA 3CD6A 5IYDH 3AB9A 4LFCQ 1K8OA 3HKZE 3OYYA 4A3CH 3GTJH 1JJCB 1AH9A 5C0XJ 4JC0A 2PPBC 5GAGC 4LW1A 4A3LH 3UDGA 3A5ZB 4OO1H 2UUBQ 3A8IE 2IHFA 3HOZG 1Z6HA 3HOXG 3VR2A 2MDIA 1PH9A 3OTOQ 2XP8A 2JA6H 1W2BA 1Q1EA 3A0JA 2A68C 1YNNC 4BY7G 1CKMA 1Y1WG 5C3EG 3ULPA 2NN6I 1ZCNA 4DK1A 4AIMA 3M4QA 2K5HA 4A3BH 2A6HC 5C4XH 1TKWB 2L5TA 1KQSA 5IT9c 4NPSA 1PH3A 3A5UA 4DUYQ 4L5QA 4GNXA 1N32L 2UU9Q 3A74A 2OTLA 4DR2L 1IYUA 4GN3B 1HNXQ 4A3EG 2K33A 3NTPA 3D31A 4DUZQ 4LF5Q 2VQEQ 1N34Q 3PF5A 4LF6L 4DAMA 4A93G 4IJLA 4OONA 3OPOA 2HIXA 2BE5D 1GUGA 2ZTDA 3CC2A 3CC4A 4IPHA 1Y14B 1I3QH 1JJ2A 1MKHA 1B8AA 4DPGA 3T1HQ 2VS1A 4JYAQ 1E7ZA 1I50H 4IQZA 3HOVH 3KF6A 4KKSA 2RF4A 1JJGA 4KHPL 3K0XA 3KOJA 5LMNQ 2GVAA 3H94A 3W1GA 2EVBA 4DR6Q 5HGQA 2EXDA 1H9SB 2K32A 3EN2A 1J6QA 1SR3A 1VQCA 3A8KE 2ZT9C 4DR7L 2Y0SE 3QIAA 3ULLA 1YHQA 1FL0A 1HTPA 3DM3A 5IE8A 4X65Q 1E1OA 2DUDA 5JJIA 4AQYQ 1HNWQ 2UXCL 3PUZA 2CCZA 4TKOB 3GTMH 3OOBA 4QQBX 1AE3A 2YSBA 1VCIA 5LMNL 3RLFA 4IOCA 1N33L 4LFBQ 1QUQB 5M3FG 2I5HA 4JI5Q 3A7AB 4KKUA 2JA5G 1VQ4A 2XP4A 3GTKH 4QIBA 4YWLA 1XMQQ 3I7FA 2R7DA 1XPRA 3T1HL 4JYAL 5IYBG 4BA1I 5A35A 4OX9L 2NVYH 3Q8DA 1KHIA 2VQFL 4XTCS 3AYHB 3HOYH 1QUQA 1UEBA 4DV5L 2UXBL 2N8NA 1YEZA 1IYVA 4QGUA 2F4VL 4YCUA 4A3BG 4KMUC 1X3FA 3FHWA 1OXSC 3RZOH 4DR4L 1Y8OB 4BY7H 4GZYC 5K36G 2UUCQ 1A63A 4ALPA 4IPCA 2B63G 2NZOA 3A8JE 3PUYA 1K3RA 4RCNA 3FKIG 4IO9A 3BZCA 1X6OA 3STBD 1EWHA 3PO2G 5BR8L 4GN4B 2NVTH 1H95A 5LMUL 1B7YB 4JBMA 1V1QA 5FJ8G 4LJZC 5GAEC 1CSPA 4U85A 4YY3L 4GNXB 1X54A 1S40A 3I2ZA 2N78A 1YW5A 1HPCA 4LUVA 4DV2L 4JI7L 2RHQB 4BXXG 4KN4C 1LACA 3K7AH 5M3FH 3BG3A 2QGQA 4A3JH 1YVCA 1N34L 1YHBA 1H9JA 1I5HW 4A76A 3RN2A 2BH8A 2ES2A 4U84A 3W5OA 1VQJA 2ZQSA 3PF4A 1EYGA 1OXXK 4DNTB 2JXWA 4DKAC 2OTJA 1XJVA 2JA5H 4B3SL 3BZKA 2QF7A 1K73C 2E75C 2K7VA 2ZM6Q 3I4NG 2R92G 5EAYA 4JI8L 3PSIA 1PYBA 2F4VQ 3VR4A 4PMWA 2M3OW 4DV5Q 2UXDQ 2E2HH 1B9MA 4H13C 3J80c 1YNJC 3ZJYC 3NE5B 3B6YA 4IOAA 4B3RL 1VQIA 4X66Q 4AYBE 4JI0Q 3H3VI 2XTIA 2L15A 1K9RA 1ONLA 1KIXA 3H15A 4DR2Q 4WJ3M 1L2FA 4P75A 4LFBL 4JI5L 4APVA 1FJGQ 1P16A 1NE3A 3KFUA 2XPAA 4B3TQ 4DR5L 3F2DA 1GJXA 1N9WA 4DUYL 1H9RA 3PIPA 1YZ6A 4JBJA 1KD1C 4HJ9A 4DK6C 3T1YL 4UP7A 5JJLA 1M1KC 1YHAA 1IZ6A 4NXNQ 1BDOA 3CCSA 2JK8A 1YI2A 1UE1A 2R93H 4RMFA 3U50C 3GTLH 3CPWA 2ZTEA 1TWHH 2YTYA 3K80C 4DV1L 4R4OA 1CKNA 1NY4A 2UUBL 3HKSA 2ID0A 2K4KA 5KNCA 5C4JH 4JBWA 2R6GA 2JA9A 4DV6Q 1GHJA 4JV5Q 4POGA 2XP9A 1QVFA 2R92H 3F2CA 4HJAA 1A8VA 1N33Q 4JI4Q 1E2WA 1XTDA 2AHOB 5GAHC 2ZM6L 2DWVA 3KAGA 4DV3Q 1CFMA 5JEAJ 2K5VA 1K9MC 2CQOA 4HJ7A 4LF9L 4LF9Q 1E2VA 1X3EA 1QVCA 1KC8C 2VQEL 4UP9A 2AUJD 4DR7Q 3HOYG 3S17H 3PGZA 4B3TL 2GN5A 4BXXH 4NXMQ 4BBRH 3TREA 1SMYC 2K75A 4Y7NH 1N32Q 3G48A 1GUTA 4G7HC 1JB7A 3S14H 2ZR5A 4JK1C 2N3SA 4PV1C 2EJGC 1G291 2ZJPA 3T56B 2I0QA 5LMUQ 4OWWB 1T5EA 3CCLA 2A6HD 3PO2H 3OTOL 2YYZA 2YSGA 2UUAQ 4P72A 1ASZA 4JI8Q 2XPBA 4DK0A 2Y0SG 2F3IA 5BN4A 4R4IA 1I94Q 3TC5A 1GUNA 1VQNA 1YBYA 1TWCH 1VQ6A 1VQLA 1CUKA 3I72A 2LAJA 3HOUG 2RE3A 5C4XG 3WWVA 3ICEA 4LUOA 3STBC 4LF7L 2PNHA 4HIOA 2PQAB 2AUKA 4H0LC 1XNQL 2VQFQ 2JA6G 4RG1A 1D7QA 2EZ5W 5IYBH 4X62Q 1Y1VH 5IWAL 3EQLC 2ZQTA 2JMFA 4A3LG 1X56A 4JI6Q 3L2PA 3CCVA 1CTMA 3QJYA 3T53B 5BN3A 3CF5A 1J5EQ 5FLMG 4LF8Q 3T51B 3UE0A 2JE6I 2DNCA 4LF4L 3GD7A 2UXBQ 2JA8H 1GM5A 5BN5A 1GUSA 3G71A 2AMCB 1Q46A 5IYCH 3PIOA 4GKKQ 4JI3Q 1PH2A 5M3MH 1SROA 4DR4Q 1ASYA 1Q8KA 1S72A 1YJ9A 4LF8L 5FLMH 3KAIA 3VR5A 4DV6L 4A3FH 4KHPQ 1R9TH 2PCFB 2QA4A 1KRSA 1VQ9A 2OWOA 3HFZB 1VQDA 2KHIA 2JA7H 1HNZQ 4XIGS 4A93H 2KCMA 3S1MH 2CW0C 3KCEA 4JBKA 1YJNA 4O2DA 1Z47A 1E22A 2NZHA 5GROA 4NXML 1L1OA 2YV5A 3S1RH 1H9KA 4GOPA 3L0OA 2E8GA 4YCVA 5IP7G 3PO3H 3CRKC 2AWNA 1VQKA 3CAMA 4DV3L 2A1AA 2M8JA 1HR0Q 4QY7A 1I94L 2BA1A 1RIPA 4JI6L 2ZR6A 3GO5A 3A7LA 3BJUA 1X65A 5C0XH 3H3VH 1PV4A 2VZAA 1K0RA 2JV4A 2JQOA 1N36L 1Z9FA 1JT8A 1VS0A 3RN5A 5FJ8H 2WB1E 3PO3G 4HIKA 1K8AC 3PUWA 2M8IA 2JA8G 3QG1A 3KJOA 3CCUA 3F8TA 5HY6A 4K0KQ 2MQHA 4YCWA 4KHZA 1YJWA 2R93G 1P8LA 1Q1BA 5C44G 4YY3Q 2KBNA 1KXLA 4PZ8A 1EQRA 2VY3A 2BDOA 1Z7TA 1TWAH 4B3SQ 4E5RA 4LWCA 3U9SA 3I56A 1WR7A 1HNWL 1GD7A 2KCTA 1PH4A 2R7ZH 1TXYA 2A68D 5M5YH 2UU9L 2PI2E 4LF4Q 1VQPA 2ITKA 1I6VC 4P71A 1IBMQ 3G6EA 3SGIA 4A3FG 3AEVA 1Q90A 3CCMA 1C7YA 1QVGA 3W1BA 2EIFA 3OW2A 2HHHL 1AE2A 3ULJA 3MEFA 3HOWH 4A4IA 4JG2A 2HQLA 2YSIA 1K8MA 3NENA 3HOUH 4JI7Q 4LFAL 4R1JA 3TDBA 2IX1A 3RLOA 1F8AB 3TCZA 1BKBA 1E3PA 3S2HH 5ELOA 1HZ9A 3K8AA 1D8LA 1HH2P 4R4TA 4A3GG 1KAWA 1PHJA 2Q5AA 3WDNA 1CKNB 3VA7A 1VQBA 5AJ3Q 1TK7A 4DNIA 1IW7D 2OQKA 3M4OH 1MIUA 4JOIC 2K5NA 4EX5A 2ASBA 1C9OA 3KAFA 3BDOA 3KYHC 4MTNA 3I4OA 2V1CC 5C0XG 5JJKA 3S1QH 4GS3A 5IYCG 3LNNA 3J80i 3IRBA 3UDFA 1WYDA 1X55A 1H9MA 3AFQA 3CCEA 1DXMA 3TS0A 1DCZA 3U4VA 4IPDA 5DLQE 5C3EH 5IP7H 4JCVE 2F52A 4REXA 4DV4L 4GNXC 4OO1I 4I7ZC 1J5EL 1YITA 4OX9Q 3DLLA 1XPUA 3CMEA 2O5IC 3WH0A 3HOVG 3S16H 1O7IA 4X66L 1LYLA 4OGQC 1XPOA 1HNZL 4UP8A 4QL5A 2PI2A 3D0FA 3BU2A 1N8RC 4BY1G 4C3IH 3IFTA 5C44H 3CCJA 4X62L 4L5SA 1S3OA 1ZKOA 2WAQG 1LABA 4MNOA 1NMVA 4PZ7A 1VQFA 2CKZB 3M9BA 1XMOQ 3OOCA 2WB1G 4C3JH 4GKKL 2KCCA 4A3DG 4YWMA 4GLVB 1JMQA 4TQUS 1VQOA 5KNBA 2R7ZG 1BBWA 5AJ3L 3CMAA 3RLNA 4C3HH 3EIVA 1PH6A 2Z0SA 1PFSA 5C0XI 4B3ML 2YSFA 2Z6KA 1KRTA 2UUAL 2EJMA 1PH8A 1MJEA 2PQAA 3CNGA 1CSQA 3TS2A 1X3GA 2CFMA 5JEAH 2JXMB 3I73A 2YU9H 1PVOA 3ERSX 1FYCA 3SDZA 1IBML 3G4SA 2ZJQA 2BH2A 4U86A 3HOZH 5KNDA 2K52A 3MFYA 1EWIA 3VR6A 1M90C 1PA6A 1DD2A 2D5DA 1LM0A 1NMGA 3KDFA 1A6XA 1OXVA 1FVIA 3ND9A 1PH7A 2F1MA 3M4PA 2A19A 3FP9A 4MZ9A 3VDYA 1EQQA 3AQQA 1TU2B 2B29A 2ATWA 3M3YH 1EG4A 1B9NA 4HIMA 4PZ6A 1Q82C 4BA2I 1O6WA 3H0GG 2VNUD 4B3RQ 2IT1A 4DV7Q 4DV7L 1HR0W 3TQYA 1K8GA 1VQMA 4L5TA 1ZYRC 4A3MH 4KKTA 1HQMC 1PINA 4DR1Q 4A3IG 1LUZA 2GVBA 4H44C 2A8VA 3TRZA 3P20A 4FDBA 1GKHA 1OTCA 2AKWB 5BR8Q 2JJQA 2ALYB 2HT1A 4HJ5A 2NN6H 4JI3L 1G51A 2N49A 1CKOA 1GO3E 4X65L 3M4YA 1A62A 2VUMG 2A69D 4YHHL 1Y8NB 4ME3A 3UDIA 4JI4L 2NVQH 1VQEA 1WI5A 1GUOA 1HJPA 1EIFA 3S15H 2A69C 3I4MG 1EFWA 4HR7B 5H1SE 4UY8C 3EBEA 2JA7G 1TWFH 1XMQL 2Q8IB 4K0KL 2Q2HA 1FGUA 2B8FA 3RZDH 2LSSA 3I4LA 2K14A 5IWAQ 1V43A 4LFAQ 2ZTCA 4HIDA 1O7LA 3HOWG 4DV1Q 1SRUA 4GN5A 2B3GA 2C35B 3E0EA 2A6EC 2H5XA 1TWGH 4GOPC 1NBWA 1Q7YC 2UXCQ 3JAMc 4OWXB 4WJ4A 4LF5L 1IL2A 1FR3A 4HJ8A 3TZUA 2FXQA 4DNRB 1GHKA 1UE5A 3LGJA 3CRLC 1VQ5A 2K50A 2JEBI 2Z6KC 1SFOH 1SE8A 3PCOB 1SMXA 4G7ZC 3NEMA 4KN7C 4GLXA 4GKJL 4JI2Q 4P73A 1E2ZA 4DV2Q 5CQ2A 1JE5A 1Y8PB 4A3IH 4GLAC 2EJFC 2JEAI 4JV5L 2BE5C 4DR3Q 1DGSA 5IP9G 1HZAA 2IX0A 2B63H 2KA7A 1VQGA 1VQHA 3U4ZA 4DR1L 3S24A 3GDEA 2MFIA 3S1NH 1OXUA 4DR6L 2Q2IA 1C0AA 1GVPA 4A3KH 2I5LX 4A3DH 3ODKA 4G7OC 4AH6A 2HHHQ 2E2IH 2EDGA 1WCMG 1QJOA 4X64Q 4LUZA 3KF8B 3J81i 4X6AH 1NJIC 2DMVA 2VUMH 1XNRL 4DK3C 1EIYB 1XNRQ 3D4RA 3IKJA 5M5XH 2DK7A 2KHJA 4POFA 1A0IA 2ZQUA 3RR5A 4PG3A 4O0AA 4BBRG 1EG3A 5FLXc 4IPGA 4IFDH 2EQSA 1I6HH 2VW9A 3CCQA 2DGYA 2I5MX 3JAMi 3SE0A 1UWVA 3KADA 2E76C 3H0GH 2ZR4A 2E2JH 3GTGH 4EQ5A 3L4HA 1WJJA 2IY5B 1Q81C 2MO0A 4LNQA 2KENA 1YNXA 1X9NA 3DXJC 2HIVA 3S2DH 3ND8A 2LMCB 4JI2L 2YTVA 3NELA 1SN8A 2CWPA 4GOPB 4L5RC 4JI1L 1EUJA 1XNQQ 1U0LA 4DAYB 1N36Q 2AWOA 4NXNL 1IBLQ 1KL9A 4P74A 1WFQA 2MO1A 2L4JA 1E24A 4AQYL 3JC66 2R7FA 3F1ZA 3N6RA 1Q86C 2JX8A 3PV0A 2XP3A 4IJHA 1BBUA 2E45A 1PYSB 1HCZA 3KAHA 5K36H 2LXKA 1UE6A 2E5LQ 4JOIA 1NTGA 3CQZH 1SLJA 3KJPA 2WFWA 4TVAB 2F21A 3VR3A 5IP9H 4A3JG 1JMCA 4YWKA 3TEHB 1G6PA 2NVXH 1H9SA 4NB3A 4R4QA 1IW7C 2D2CC 5GADC 1HZCA 1Y69U 1VQ8A 1O78A 1V8QA 1T9HA 4LF7Q 3J7A5 1HNXL 3T1YQ 2BA0A 5J3BA 3I55A 5IY0A 3CXCA 4DV0L 1LTLA 2WP8J 2YTXA 4BY1H 1FJGL 2DK1A 2PNRC 4C2MH 1W3SA 1PH1A 1OXTA 1PMRA 3NBHB 1IBKQ 3OW7A 4IFDG 3MXNB 4A3MG 3E9HA 4X64L 4R4CA 3HKZG 4OWTB 5LMNW 4JI1Q 3PUVA 5E7NA 1IXRA 3LWUA 2QEXA 1L0WA 3CP0A 1UE7A 2RCNA 4LK1C 1WCMH 1QZHA 3GTPH 3RNUA 1U5KA 3I4MH 2Q2TA 3LE4A 1V9PA 2XP5A 4LF6Q 4GKJQ 3M7NA 1K83H 3CCRA 1PH5A 3UE1A 4IFDI 3KABA 3GTOH 1L1OB 2V4DA 4A3KG 4J15A 4OO1G 5IYDG 3HOXH 1IBLL 1RL2A 2OCEA 2DNEA 1VQAA 3KLWA 3UDXA 4DR3L 1WMVA 4DR5Q 2B8GA 2VL6A 1VQ7A 4A3CG 1Y1VG 4KLKA 4DV0Q 3AFPA 4A3GH 4QIWE 1NMFA 3KDFB 3U58A 3FMCA 3FPPA 2CWAA 4JI0L 1Q12A 3CPFA 3E9IA 4OXPA 2WAQE 2D0OA 2XP7A 4IFDJ 3KF6B 3L7ZC 3FKIH 2O5JC 3CW2C 1Y1WH 2LXJA 2D62A 2YSHA 2IHEA 3GQBA 1IBKL 3PUXA 4DV4Q 5ELNA 4UPAA 2A6ED 4KI0A 2UUCL 4YHHQ 2XP6A 1XMOL 4B3MQ 5M3MG 3J7ZC 2E5LL 3ER0A 1E1TA 3F2BA 4LFCL 2MNAA 2Q2UA 1BVSA 1HR0L 2ZAJA 5GQOA
chains in the Genus database with same CATH superfamily
4FXKC 3M85A 4XDXA 5J39A 1YIJA 1IYJB 2OQ0A 3R93A 4KY5A 1HZBA 2D0PA 4A3EH 2MPMA 2E74C 1ET9A 2DN8A 3BVZA 4L8JA 5CV6A 3GTKB 3NPPA 5G3LF 3CC7A 1I3QB 1I5FA 2YU9B 3MQHA 3HZXA 3SEBA 2E2DC 2NN6G 1VF5C 4H02A 1PTOD 5JEAG 5M5WH 3M4OB 4RGNA 1CI3M 1PYWD 4BBSH 1Q3LA 4QJFA 2DJYA 5AHTA 1K9QA 1MJCA 5IT9L 2PQEA 4HEDA 1EOVA 2PMZE 4ZKCB 3J81c 3W3AA 2KXQA 3J81j 1DOMA 3K7UC 1WCMB 1L1OC 4TSSA 1RKNA 4TRDA 4N9TA 3I4NH 1F2LA 2F0IA 1PFMA 2KOLA 4Y52H 2UXDL 2AQ2B 3Q6SA 3DWPA 1A2TA 1TWAB 4IN3A 4QCLA 1B70B 3GTQH 1XXGA 2XGTA 3V96A 3HGBA 4FF3A 1R4QB 4WFN3 3K81C 4BBSG 1R4PB 1STAA 4A75A 5FO7B 4ODGA 1WOCA 1VDZA 2ZQVA 1VF7A 2F0UA 3KLRA 4FF4A 1QZGA 3GTGB 4AYBG 3MXUA 2BOSA 3MTSA 1PRTC 4DUZL 2RHSB 5C5LA 1KNEA 3QB3A 2ZJRA 3CD6A 5IYDH 3AB9A 5LL6X 5J22A 4LFCQ 1K8OA 3HKZE 3OYYA 3HOWB 4A3CH 1VMPA 2MGSA 3GTJH 1JJCB 1AH9A 1ZEQX 3KBGA 5C0XJ 3SK8A 1A15A 4JC0A 2PPBC 4A0UA 2HDLA 3D6WA 5GAGC 4C3IB 4LW1A 3HOXB 4A3LH 1C8CA 3UDGA 3A5ZB 1AFPA 2K05A 4OO1H 2UUBQ 3A8IE 2IHFA 1PRTF 3HOZG 1Z6HA 3HOXG 3VR2A 2MDIA 1B1ZA 1PH9A 3K5NA 3OTOQ 2XP8A 3Q0AA 1W2BA 3WOEA 2JA6H 1Q1EA 3HG9A 3A0JA 2A68C 1G2SA 3S15B 2GA4B 4BWGB 1YNNC 2LY7A 4BY7G 1PTOH 1CKMA 1Y1WG 5C3EG 1CK1A 1X32A 3ULPA 2NN6I 4C3HG 5D14A 4A3DB 4BS9A 1ZCNA 4DK1A 4ZLTF 4AIMA 3M4QA 2K5HA 4A3BH 2A6HC 1EYAA 5C4XH 1TKWB 2RVLA 4PMBA 4F7XA 2L5TA 1KQSA 5IT9c 5EKIA 4NPSA 4PMCA 1PH3A 4QUFA 3A5UA 1LO5D 4DUYQ 1EZ8A 1EU3A 4L5QA 2Z9HA 4GNXA 1N32L 2UU9Q 3A74A 2OTLA 4DR2L 1IYUA 4GN3B 3DMUA 1HNXQ 3H3VC 1RHPA 2MHVA 3BVMA 4A3EG 2K33A 2L9HA 3NTPA 1SMYD 4DN4M 3D31A 4DUZQ 2I07B 4LF5Q 4XQNA 2EYLA 5CV7A 2B2VC 2VQEQ 1N34Q 3PF5A 2B2TA 4LF6L 3K57A 1JWSD 4NKLA 4DAMA 4A93G 4IJLA 4QIWB 4OONA 3MCBA 2A74C 2A73B 2G9DA 3OPOA 2HIXA 4ZQ3A 2BE5D 5DM63 2NVTB 1GUGA 2ZTDA 5E64A 3BDCA 1XX8A 3CC2A 3CC4A 2K04A 2ICEC 1BUVT 4HMIA 4IPHA 1Y14B 4FXGC 1I3QH 1JJ2A 1MKHA 1B8AA 4DPGA 1RJTA 2VS1A 3T1HQ 1NUCA 4JYAQ 1E7ZA 1I50H 4IQZA 3HOVH 3KF6A 4KKSA 2RF4A 1JJGA 4KHPL 3K0XA 3KOJA 5LMNQ 3DM1A 4OIKA 2KHSA 1SJED 2PO4A 4X3KA 1BCPF 2GVAA 3H94A 5M5XB 3W1GA 2EVBA 4K8IA 4DR6Q 5HGQA 3TSSA 1CZWA 2EXDA 2MJ8A 3MA2B 2L11A 1H9SB 2K32A 3EN2A 1J6QA 1PRTB 1SR3A 1VQCA 3A8KE 2ZT9C 3FVQA 4DR7L 2Y0SE 5DAUA 3QIAA 3ULLA 3PIO3 5FO9B 1FL0A 1HTPA 3DM3A 4CJ2C 1YHQA 2CW0D 5IE8A 4X65Q 1E1OA 2DUDA 5E62A 5I6YA 5JJIA 2DJGC 1BO0A 4AQYQ 1HNWQ 2UXCL 2FMCA 5M3FB 3PUZA 4DA2A 2CCZA 4TKOB 3GTMH 3OOBA 5CMDA 1AE3A 4QQBX 2WIIB 2YSBA 1VCIA 2JA5B 5LMNL 3RLFA 4IOCA 1N33L 4LFBQ 1RTOA 1QUQB 5M3FG 2EPBA 3T4AC 2I5HA 4JI5Q 3A7AB 1KLGD 2WB1B 4KKUA 3OSOA 2JA5G 3Q24A 5C4JB 2TMPA 3VA5A 2PMZB 4FNFA 3QO2A 1VQ4A 2XP4A 3GTKH 4QIBA 1E0BA 4YWLA 1XMQQ 2F0PA 3I7FA 2R7DA 1XPRA 3T1HL 4JYAL 2F0HA 5IYBG 2F03A 5CYUA 1PTOB 5EKLA 1A2UA 3V05A 4BA1I 5A35A 2PZUA 2NVYH 4OX9L 3Q8DA 1KHIA 2VQFL 4UAIA 3AYHB 4XTCS 3HOYH 1QUQA 3PQIA 2QKIC 1UEBA 3DUZA 4IUNA 2R3ZA 4DV5L 1XYIA 2UXBL 4A3BB 1K28A 2N8NA 1YEZA 2WKCA 4QGUA 1IYVA 1V1PA 1CA5A 2F4VL 1F77A 4YCUA 1QNKA 3SK5A 3NBIA 1STHA 4A3BG 4KMUC 1X3FA 1YNJD 3FHWA 1OXSC 3RZOH 1EYCA 1KNAA 4X3SA 4DR4L 2KECA 1Y8OB 2F0NA 1RP5A 3OWFA 4BY7H 4GZYC 3GTQB 3JAML 5ELBA 1CQFA 1LTSD 2K5WA 5K36G 2UUCQ 3UI2A 1A63A 1J8IA 3LKXB 4F87A 1QG7A 3KLSA 1IKMA 3NP8A 1UNSA 4ALPA 4K5XA 2BDNA 4DAYA 4IPCA 2B63G 2NZOA 4B9WA 1K3RA 3A8JE 3PUYA 4Z9CB 4RCNA 3FKIG 3I90A 3IFDA 5F2DA 5HURA 2WV6D 4IO9A 1FGBD 1X6OA 3BZCA 3Q23A 4RGMA 4OHJA 1MSGA 2Q8RE 3CHBD 3E0JA 2L4NA 3STBD 1EWHA 3PO2G 5BR8L 4GN4B 2NVTH 1M8AA 1H95A 4F8MA 5LMUL 5IGCA 3GTJB 4FYDA 1B7YB 4JBMA 1V1QA 5FJ8G 4LJZC 5GAEC 1CSPA 4U85A 4YY3L 3MAQA 4GNXB 1X54A 3GV6A 1S40A 1ENFA 3I2ZA 2N78A 1HFNA 2B2UA 1YW5A 1HPCA 4LUVA 5NUCA 1JB3A 2G9HD 1AW7A 4DV2L 4JI7L 3NSWA 2RHQB 3MVVA 1HFGA 5CV8A 4BXXG 1SEBD 4KN4C 1LACA 5L37A 3K7AH 4IURA 5M3FH 3BG3A 1WD1A 2QGQA 4A3JH 3FSCA 3GTMB 1YVCA 1SJHD 3HP3A 5FK9C 5FLXE 2PZTA 1M4VA 2LS01 1N34L 2H1EA 1YHBA 1H9JA 1I5HW 1J9OA 4A76A 3P1HA 3RN2A 1W6JA 2DJFC 2O4XA 3GP7A 2BH8A 2ES2A 4U84A 4A3IB 3W5OA 1VQJA 2ZQSA 3PF4A 1EYGA 2IW3A 4XT3B 1OXXK 4FF1A 3HEJA 4DNTB 2JXWA 4DKAC 1RTNA 2OTJA 1XJVA 2JA5H 4B3SL 3BZKA 2QF7A 2B2YA 1KAAA 1K73C 1QOHA 2E75C 2K7VA 2ZM6Q 3I4NG 2R92G 5EAYA 3PSIA 1PYBA 4JI8L 2SNSA 4C1NK 1AEXA 3ONAB 2HCCA 2F4VQ 3VR4A 5C5MA 2L0CA 1S5ED 3EA6A 1FNVA 4PMWA 2M3OW 1TS2A 4DV5Q 2UXDQ 2E2HH 1B9MA 2EYHA 4H13C 3J80c 1CHQD 1YNJC 3NHHA 3ZJYC 3NE5B 1SYGA 3RUZA 1JQYD 3FPUB 3B6YA 1B53A 4IOAA 4C3JG 4B3RL 1VQIA 4X66Q 4AYBE 2KJXA 4H7BA 4V190 1JC7A 4JI0Q 3OMCA 1MD2D 3H3VI 2XTIA 2L15A 1K9RA 5I4DA 1ONLA 3L3OC 1I4QA 1KIXA 3H15A 5C44B 4Q5VA 4DR2Q 4WJ3M 1L2FA 4NDXA 4P75A 4LFBL 4JI5L 2Y8NB 4APVA 1FJGQ 2E2JB 1P16A 3VYSA 1NE3A 3J80L 3CKIB 3DWAA 1WTXA 2FJ2A 2XPAA 3KFUA 4B3TQ 1LTTD 4DR5L 4C1NI 3F2DA 1JOOA 1GJXA 1N9WA 4DUYL 4XT1B 1H9RA 3PIPA 1YZ6A 1XWEA 4JBJA 3DEPA 1HA6A 1KD1C 2R61A 4R8IA 3FRPB 4HJ9A 4DK6C 1BCPD 3T1YL 3JAME 3TP8A 4UP7A 1BNZA 5JJLA 3DHQA 2K1BA 2PW5A 1M1KC 2L55A 1YHAA 1CT1D 2WINB 1IZ6A 3HOZB 1QCBD 3EROA 4NXNQ 2KEDA 1KABA 1BDOA 4I65A 2EZVA 1G8ZD 3CCSA 2JK8A 1D5XC 5JPNC 5I9PA 1YI2A 2EY1A 1AZQA 1UE1A 2R93H 4RMFA 2NTSA 3DEOA 3U50C 3GTLH 3CPWA 2ZTEA 1TWHH 2YTYA 5J1ZA 3T16A 3K80C 4DV1L 4R4OA 1CKNA 1NY4A 5CV5A 2RA4A 2UUBL 4HCSA 1LT3D 3HKSA 3J81E 2ID0A 2K4KA 5KNCA 1WD0A 5C4JH 5E5WA 2JA9A 2R6GA 4JBWA 4DV6Q 1B3AA 1GHJA 2EY5A 3K58A 4JV5Q 1DOKA 4NMZA 4POGA 2XP9A 1QVFA 2R92H 1EFID 4A3GB 3CQZB 3F2CA 4HJAA 1A8VA 5EGTA 1N33Q 2F0DA 1MBYA 4JI4Q 1E2WA 1O7YA 1XTDA 2AHOB 5GAHC 2ZM6L 2DWVA 3KAGA 4RWSC 2RDFA 4DV3Q 2VXWA 2K5DA 3FDTA 1CFMA 5JEAJ 2K5VA 1K9MC 2CQOA 4HJ7A 3SR1A 4LF9L 4LF9Q 1E2VA 3EJIA 1X3EA 4A3EB 1QVCA 3BZDB 1KC8C 2VQEL 4UP9A 3MCBB 2AUJD 4DR7Q 4X3UA 1U4RA 1R9TB 3HOYG 1UEAB 3S17H 3PGZA 4B3TL 3MQGA 2GN5A 4BXXH 4NXMQ 4BBRH 4KK7A 4HCEA 3TREA 2HCIA 1SMYC 4FXDA 2K75A 1HQRD 4A93B 4Y7NH 1N32Q 3G48A 4FF2A 1GUTA 4G7HC 1JB7A 3S14H 2ZR5A 2EYFA 4JK1C 2N3SA 4PV1C 4CDEC 1A3TA 2EJGC 2F0WA 3SXHA 5KEEA 1U9RA 2F0QA 4S3SA 2I46A 3OIPA 1G291 2ZJPA 5IOCA 3T56B 3MWYW 2I0QA 2Z8LA 3DWQA 5LMUQ 2KUMA 4OWWB 1T5EA 3S1MB 3CCLA 2A6HD 5CORA 3PO2H 2FMMA 2J4XA 4IALA 1MHWC 3OTOL 1I4HA 2YYZA 2P5ZX 2YSGA 1TS4A 2F0VA 1JOKA 2UUAQ 4P72A 1ASZA 4QMGA 2HQEA 5E3FA 4JI8Q 2XPBA 4G4KA 1A3UA 4DK0A 2Y0SG 2F0OA 2F3IA 2HUGA 5BN4A 4R4IA 1I94Q 3TC5A 3S14B 1F9QA 1GUNA 1VQNA 1SYFA 4CJ1B 1YBYA 1TWCH 2KVMA 2ZXOA 2Y0SB 1VQ6A 1VMCA 1SXTA 5ELDA 1VQLA 5C4XB 3D6CA 1CUKA 3SK4A 3I72A 4ZRZA 5FO8B 2LAJA 1EY6A 2XN9C 3HOUG 1F2ZA 4K8JA 2RE3A 3S1RB 3C3LA 5C4XG 1ESRA 1TVXA 3WWVA 3ICEA 3NTIA 4LUOA 5C4ZA 3STBC 4LF7L 2PNHA 1F2YA 5CGKA 4HIOA 3MXNA 1PRTD 2PQAB 2AUKA 4H0LC 3NQTA 1XNQL 2VQFQ 2JA6G 4RG1A 1D7QA 2EZ5W 2XVSA 5I2YA 5IYBH 5JAVA 4L63B 3QOLA 4X62Q 4DAVA 1Y1VH 4IZ8A 3R8BA 1T5XD 3E3XA 3EQLC 5IWAL 2ZQTA 4RGOS 2VB2X 2JMFA 5ELCA 4A3LG 1X56A 4JI6Q 1O7ZA 1ENAA 2K01A 3L2PA 5E65A 3CCVA 2IJ0A 1D1KA 1JR0D 2WAEA 3GV3A 1CTMA 3QJYA 4MHEA 3T53B 1WTRA 5BN3A 4WRDA 3CF5A 5FLMG 1J5EQ 5CV9A 5EPJA 4LF8Q 2F0LA 3BVGA 3T51B 5DNFA 3UE0A 2JE6I 1EY4A 4RHSA 3G6JB 4QB4A 2DNCA 4LF4L 1JCKB 3C1FA 3GD7A 2NVQB 2HDMA 2UXBQ 2NTTA 2JA8H 1U4MA 1GM5A 3H91A 5DM73 5BN5A 1GUSA 3SK6A 2SOBA 3G71A 2AMCB 3FKIB 1Q46A 1V1PB 5IYCH 1W6KA 1CQVA 3PIOA 4GKKQ 5C6AA 1TWFB 4JI3Q 4HSPA 1PH2A 5M3MH 1SROA 4DR4Q 1ASYA 2L12A 2F0GA 4JW0A 1Q8KA 3PO2B 1S72A 1YJ9A 1BCPC 4RFBA 4LF8L 5FLMH 3KAIA 3VR5A 4DV6L 3BYTB 4A3FH 4KHPQ 3T13A 1R9TH 5IT9E 2PCFB 2QA4A 1KRSA 1XTCD 4UDUC 1S5CD 4XQJA 1VQ9A 2OWOA 4EQPA 4K2KA 1RF2D 5I2XA 3HFZB 1ILQA 1VQDA 2KHIA 2JA7H 2Z4IA 2XNAC 5KYLA 1HNZQ 4XIGS 4A93H 2BCOA 2KCMA 3S1MH 2J0TD 2CW0C 3KCEA 1I4XA 4JBKA 1YJNA 1EIGA 4O2DA 1Z47A 1U4LA 2SNMA 4JPBW 1E22A 2NZHA 3VYTA 5GROA 4NXML 1B44D 1L1OA 1D1IA 4HTHA 2YV5A 2RQXA 4OEMB 3S1RH 1H9KA 3RZDB 4GOPA 2F4IA 3L0OA 2E8GA 4YCVA 5IP7G 2WADA 4B9XA 2VB3X 4RKLA 3PO3H 2IX3A 2YAJB 3CRKC 3V2TA 2AWNA 1VQKA 3CAMA 4DV3L 2A1AA 2M8JA 1HR0Q 1G6ZA 1ICFB 3NWTA 4QY7A 3K5LA 1HUNA 2KCNA 1I94L 1DZ1A 2BA1A 1RIPA 4JI6L 3I4NB 1SFOB 3GO5A 2ZR6A 3J7YW 3A7LA 3BJUA 4K6DA 1WTPA 1X65A 3TMEA 1EEID 5C0XH 4KD3A 3H3VH 1LTRD 3URYA 1PV4A 2VZAA 2DY8A 2JP1A 1K0RA 4IUVA 3R2IA 2JV4A 2JQOA 1PTOF 1N36L 1Z9FA 4RGTA 1JT8A 1VS0A 3RN5A 3S1QB 1JWUD 5FJ8H 1CZGA 2WB1E 3PO3G 3OIQA 4BBRB 4DGZA 4R9WA 4HIKA 1K8AC 3KK7A 3PUWA 2M8IA 1EYDA 2JA8G 4BBSB 3QG1A 3KJOA 1CHPD 3CCUA 1PZID 1S4ZA 3F8TA 5FLXL 3OWEB 3PO3B 5HY6A 5I6WA 1I4GA 1TQOA 1TS5A 4K0KQ 4AYBB 2MQHA 2JA8B 4YCWA 1B4OA 4HSVA 4KHZA 1YJWA 2R93G 1P8LA 1Q1BA 5C44G 2X6GA 4YY3Q 2DY7A 2KBNA 2QILA 4K2LA 1JWMD 3Q22A 1DONA 1SE2A 1KXLA 4PZ8A 1EQRA 2VY3A 3ERQA 1TWAH 1Z7TA 2B2WA 2BDOA 2IL8A 4O1NA 5JVG3 4B3SQ 4E5RA 4LWCA 1EOTA 3U9SA 1LT5D 3I56A 1WR7A 4RHRA 1HNWL 1GD7A 2KCTA 3NWSA 1EEFD 1YNND 1PH4A 2R7ZH 1TXYA 4HN7A 2A68D 5M5YH 2UU9L 2PI2E 4LF4Q 2RDHA 1VQPA 3BS1A 2ITKA 4K5VA 3IL8A 5IGBA 1I6VC 2RDGA 4P71A 4J1MA 1IBMQ 3G6EA 2K6AA 3SGIA 5M3MB 4A3FG 3AEVA 2CHBD 1Q90A 4KY6A 4Q0FA 1GOZA 2CVRA 4C56C 4BY7B 3CCMA 1C7YA 1QVGA 3W1BA 2EIFA 3OW2A 3X3NA 2HHHL 1AE2A 3ULJA 3MEFA 3HOWH 5LHY1 4A4IA 4JG2A 4C3HB 2HQLA 2YSIA 5IIFA 1K8MA 4KJNA 3NENA 3HOUH 1F9SA 4RH6A 5ELFA 4JI7Q 4LFAL 1QILA 1HTLD 4R1JA 3TDBA 2IX1A 3RLOA 1F8AB 3TCZA 1LV9A 1BKBA 4IUTA 1E3PA 4DU9A 3S2HH 5ELOA 1HZ9A 3K8AA 5ISRA 4IUQA 1D8LA 3BYYB 1HH2P 2H4OA 2X69A 4R4TA 4A3GG 1KAWA 1PHJA 2Q5AA 3K7AB 1WTOA 1NCVA 3WDNA 5U47A 2NWGA 1SYBA 1CKNB 3VA7A 1VQBA 5AJ3Q 1TK7A 4DNIA 1IW7D 1BXTA 2OQKA 3SVMA 2F0KA 3M4OH 2ICIA 2KEEA 1MIUA 4JOIC 4P2CB 4DAPA 2K5NA 3NK9A 4EX5A 2ASBA 1C9OA 4EGVA 4CDDC 3KAFA 3BDOA 3KYHC 4MTNA 5CBAE 3I4OA 2V1CC 5C4HA 5C0XG 5JJKA 2K03A 5CBEE 3S1QH 4GS3A 5IYCG 3LNNA 3J80i 1EY0A 3IRBA 3UDFA 1WTHA 1WYDA 1LT4D 1X55A 3K6OA 1H9MA 3AFQA 2XWBB 3CCEA 4KD4A 1DXMA 5E4WC 3MFGA 3TS0A 1DCZA 3U4VA 4IPDA 5DLQE 4ZAIA 2EYOA 5C3EH 3GTOB 5IP7H 2NVXB 4JCVE 1SNDA 2F52A 4REXA 4DV4L 2NUCA 3E5SA 4GNXC 4OO1I 4I7ZC 1J5EL 1YITA 2JYOA 1STGA 4OX9Q 3DLLA 1XPUA 3CMEA 1STEA 2O5IC 3WH0A 4YIJA 3HOVG 1TY0A 1LT6D 1NNXA 3S16H 1K83B 1O7IA 4X66L 1LYLA 3K5OA 4OGQC 2PYKA 1XPOA 1HNZL 2X6LA 4UP8A 4QL5A 3P7JA 2PI2A 3D0FA 2CQAA 2IWHA 5K5PA 1BBXC 3BU2A 3TP6A 1N8RC 4A3MB 4BY1G 4C3IH 3IFTA 3HKZB 5C44H 1I50B 1RDPD 3CCJA 4X62L 1RODA 5G3LD 1II3A 4L5SA 1S3OA 2A5HA 1ZKOA 2WAQG 1I4RA 4BY1B 1LABA 4Y7NB 3MXGA 4MNOA 1NMVA 4PZ7A 1VQFA 2CKZB 3M9BA 3ZYYX 1XMOQ 3OOCA 2WB1G 4M1UB 5C3EB 4C3JH 1TR5A 4GKKL 5E66A 2KCCA 4ID6A 2R7ZB 4A3DG 4YWMA 3HOUB 4GLVB 5IGEA 1JMQA 1SNOA 2KQ3A 1NR4A 4TQUS 1VQOA 5KNBA 2M00A 2R7ZG 1SNPA 1BBWA 4K5WA 5AJ3L 1V1OA 3CMAA 1LTBD 3RLNA 4C3HH 3EIVA 1PH6A 1LTAD 3KBXA 1TY2A 2F3VA 1KTKA 2B2VA 2Z0SA 1LTID 1PFSA 4J6HA 5C0XI 3TP5A 4B3ML 2YSFA 1IHZA 3O13A 3LWEA 4MIUA 2Z6KA 1KRTA 2UUAL 3OMGA 5FOBB 2G5DA 2EJMA 2HD3A 1PH8A 1MJEA 1Q8IA 2FINB 2PQAA 3CNGA 1CSQA 4CKEA 3TS2A 5KIXA 1X3GA 4OL7A 2CFMA 1SAPA 5JEAH 2F0TA 3MHBA 3A54A 4RCOA 2JXMB 3I73A 2YU9H 1PVOA 3ERSX 1EZ6A 1FYCA 3SDZA 2RSOA 2J7ZA 5M5WB 3G4SA 1IBML 2ZJQA 2BH2A 4U86A 3HOZH 5TSSA 1ESFA 5KNDA 2K52A 1EWIA 3MFYA 1D5MC 2EXZA 3VR6A 1M90C 1PA6A 1DD2A 2D5DA 1LM0A 3A55A 3C1EA 1PFNA 1NMGA 3KDFA 1A6XA 1OXVA 1FVIA 3ND9A 2Z4HA 1PH7A 2F1MA 3M4PA 5E4XA 3K59A 2A19A 3FP9A 4MZ9A 3VDYA 1PFBA 1X3PA 3S1NB 1EY8A 1EQQA 3AQQA 1TU2B 2B29A 2WKDA 3TP7A 3H09A 2ATWA 1JOQA 2Q8TA 3M3YH 1HUMA 5KYIA 1EG4A 1QNUA 1O80A 4XXEA 2D9UA 1B9NA 2L1BA 2E2IB 3I8ZA 4HIMA 1SNQA 4PZ6A 5COYA 2OT2A 1Q82C 4A0TA 1WTWA 2RSNA 2CH4A 1O6WA 4BA2I 1JORA 3NXWA 3H0GG 2VNUD 4B3RQ 5A2QE 2IT1A 4DV7Q 4DV7L 1HR0W 3TQYA 4ILWA 5EPLA 5C3XA 1K8GA 1VQMA 4L5TA 4ZCKA 1ZYRC 5C3WA 4A3MH 4KKTA 2QDBA 1K3BC 1G2TA 1HQMC 1HHVA 3TDQA 3MXPA 1PINA 4ME5A 1RD9D 4DR1Q 4A3IG 1LUZA 2GVBA 1STNA 5JPMC 4H44C 3R3OA 2A8VA 3TRZA 3E6ZX 2NB0A 3P20A 4FDBA 3NQIA 3J7AF 1SE3A 1A3VA 1GKHA 1EY5A 1OTCA 1EIHA 4ABNA 1S5FD 4O42A 3S2HB 2AKWB 5BR8Q 2JJQA 2ALYB 2HT1A 2VUMB 4HJ5A 2NN6H 4JI3L 2AQ1B 1G51A 2TSSA 4JVZA 2JA6B 2N49A 1CKOA 1GO3E 4X65L 3M4YA 1A62A 4L6TB 2VUMG 2A69D 4V0BA 4YHHL 4FVMA 4MN3A 3VYUA 1Y8NB 5LL6S 1I6HB 4I7AA 4ME3A 3UDIA 1SSOA 4JI4L 1G91A 4RA8A 2NVQH 3A56A 5JVH3 1VQEA 1WI5A 4C3JB 1GUOA 1HJPA 1EIFA 3S15H 2A69C 3NTHA 3I4MG 1EFWA 4HR7B 3CU7A 5H1SE 2RKSA 2WACA 3EBEA 4UY8C 2JA7G 1TWFH 1XMQL 2Q8IB 4K0KL 5CC4A 2Q2HA 1FGUA 2B8FA 3D4WA 3RZDH 2LSSA 5M9OA 1KDCA 4WJWA 3I4LA 2K14A 3D3RA 1V43A 4LFAQ 5IWAQ 2ZTCA 4HIDA 4KTAA 5E1FA 1O7LA 3HOWG 4OIJA 1SE4A 4DV1Q 4EQNA 1SRUA 3HRZC 4GN5A 2B3GA 3FSBA 2C35B 3E0EA 2FHTA 2A6EC 1PXUA 2H5XA 1TWGH 4WORA 4B08A 1NBWA 4GOPC 1Q7YC 1ILPA 1B2TA 2UXCQ 3JAMc 1TIID 4OWXB 1L0YB 1ZYRD 4F88A 5I9OA 4WJ4A 4LF5L 2CH4W 3LX0A 4C2MB 1FR3A 1IL2A 1QWYA 4HJ8A 2PZWA 4LAAA 1KDBA 3TZUA 2FXQA 2QW7A 4DNRB 1GHKA 1NAPA 1D5ZC 1UE5A 3KLSX 3LGJA 3CRLC 1VQ5A 2K50A 2B2WC 1TR8A 3FS8A 2JEBI 2Z6KC 3GTLB 2XSCA 1SFOH 1SE8A 3PCOB 1Y1WB 1SMXA 4XQQA 3NEMA 2F0SA 4KN7C 4G7ZC 5JJZA 4GLXA 4X3TA 4GKJL 1C48A 4JI2Q 1AP0A 4P73A 1E2ZA 3TN2A 4DV2Q 2EY6A 5CQ2A 1JE5A 1Y8PB 4A3IH 4GLAC 4CBVA 1D6EC 2FFKB 4KHVA 2EJFC 2JEAI 4JV5L 1UUPA 2BE5C 4DR3Q 2E2HB 1DGSA 5IP9G 1HZAA 2IX0A 2B63H 2KA7A 1VQGA 1VQHA 4RAUC 3U4ZA 4DR1L 3J80E 3S24A 3GDEA 2MFIA 1I4PA 2XRSD 3S1NH 1OXUA 2M2LA 4DR6L 4CJ0B 2Q2IA 1C0AA 3S9WA 1GVPA 4A3KH 3WOFA 1KLUD 2I5LX 3MZ5A 4A3DH 4ZUIA 3ODKA 4EVOA 4XYOA 4G7OC 1SNMA 4KY7A 4AH6A 2HHHQ 1SYDA 2R92B 2E2IH 2EDGA 4OELB 2Z1CA 1WCMG 2EY2A 2LKVA 5T1GA 1WTQA 1QJOA 4UHVA 4X64Q 4QF4A 4LUZA 4RKBA 1EY7A 3KF8B 1IKLA 3J81i 4X6AH 5JOBA 1NJIC 2DMVA 2IPKD 3R2TA 5DEHA 1HA5A 3EVQA 2VUMH 1XNRL 1DM0B 4DK3C 1EIYB 1XNRQ 3D4RA 4ZYSA 3IKJA 3FEWX 5M5XH 5D3DA 1FNWA 2DK7A 2KHJA 3S17B 1SNCA 4POFA 1S5BD 1EL0A 2C9OA 1A0IA 2ZQUA 2Z6BA 3RR5A 4PG3A 1DYQA 4O0AA 4DFAA 2SEBD 4BBRG 1MSHA 1EG3A 3M7GA 5FLXc 4IPGA 4KV6A 4IFDH 2EQSA 1I6HH 2O2LD 2VW9A 1EY9A 3CCQA 2DGYA 2I5MX 3JAMi 1FD7D 3SE0A 4CGYB 1CM9A 1UWVA 4K14A 1EQVA 2R93B 3KADA 4EQOA 2E76C 4C3IG 1ET6A 3H0GH 3J81L 1AZPA 2ZR4A 5EJWA 1TWGB 3HOVB 2E2JH 1B3QA 3AMUA 2OXPA 3GTGH 1F2MA 1S5DD 4EQ5A 4IUPA 3L4HA 1WJJA 2JSOA 1BCPB 1SYEA 3K0YA 2IY5B 1Q81C 2MO0A 4LNQA 2KENA 5IGFA 1YNXA 1X9NA 3M3YB 3DXJC 2HIVA 3S2DH 2PW7A 3ND8A 1WTVA 5A2QL 2LMCB 3I91A 4JI2L 1DOLA 2YTVA 4HMJA 3NELA 5FKAC 1SN8A 3NBHA 3H6MA 2CWPA 4PNYA 4GOPB 4L5RC 2C5CA 4JI1L 1EUJA 1XNQQ 3KUPA 1U0LA 5D65A 4DAYB 2QEJC 3RZOB 4DXGA 4R8NA 4FO2A 1N36Q 2AWOA 2M9VA 5KRUA 4NXNL 1PDQA 5EQ0A 1IBLQ 1TWCB 1KL9A 4P74A 3TBIB 1WFQA 2MO1A 3MC0B 2F0MA 2L4JA 2K28A 1E24A 4AQYL 3GTPB 3JC66 2R7FA 3AU7A 3F1ZA 3N6RA 3K5MA 2F0EA 1Q86C 1TWHB 3D8GA 2JX8A 3PV0A 2XP3A 4NW2A 2QDLA 2F3WA 4IJHA 3QWNA 1BBUA 2E45A 1PYSB 2N55A 1HCZA 4ZUJA 3KAHA 4ULLA 1JICA 1BR9A 5CV4A 2LXKA 5K36H 3J7AV 1UE6A 4CKCA 2E5LQ 4JOIA 1NTGA 5CR3A 4U673 3CQZH 1PZJD 3I3CA 1SLJA 4DXFA 1X3QA 2EOTA 4KJOA 3KJPA 1WVLA 5M5YB 2WFWA 4TVAB 3ITPA 2F21A 1PTOC 4ZKBB 1SDFA 3VR3A 5IP9H 4A3JG 1BOSA 1JMCA 3HOYB 1ML0D 1B50A 1SBBB 4YWKA 2EE1A 4IUUA 3NTKA 4CHTB 3OHXC 3TEHB 2N88A 4PQXA 1UAPA 4MTKA 1G6PA 2NVXH 4A3JB 4K6LA 1H9SA 1RCVD 1CA6A 4NB3A 2MUYA 4R4QA 3D4DA 4QUCA 2B63B 1IW7C 2D2CC 5GADC 1HZCA 2EYPA 3PQHA 1ICWA 5HGTA 3F2UA 1Y69U 1MGSA 3W2DA 1VQ8A 4HAEA 2QCPX 1O78A 1T9HA 1V8QA 1GXDC 4LF7Q 3J7A5 1HNXL 1GUWA 3T1YQ 2BA0A 5J3BA 1STYA 1TS3A 1KDAA 4XYQA 3I55A 1OO9B 3BDLA 1FLCA 3QR8A 5IY0A 3CXCA 2F0FA 1MI2A 1ZXTA 5AFWA 2EYJA 4E6IA 4DV0L 2NVYB 1LTLA 1STBA 5T1IA 3RMHA 3PMFA 3I70A 2WP8J 3EFXD 2YTXA 4BY1H 1FJGL 2DK1A 2PNRC 4CDCC 4C2MH 5EBDA 1W3SA 4NP5A 1PH1A 1OXTA 2QRVA 1PMRA 2B2YC 3VYRA 3NBHB 1IBKQ 3OW7A 4IFDG 3MXNB 4A3MG 3E9HA 4X64L 4R4CA 1LLRD 3HKZG 4OWTB 3H0GB 3KF8A 2K5QA 5LMNW 5IGDA 2F0JA 4LMQD 4JI1Q 5IODA 3PUVA 5E7NA 2EYMA 2WAQB 3QOJA 1IXRA 2XIWA 3LWUA 2QEXA 1SYCA 1L0WA 3CP0A 1UE7A 1BF4A 2RCNA 4LK1C 3S2DB 2XRQD 2RBMA 2SDFA 1WCMH 1QZHA 3GTPH 3RNUA 2NBFA 1U5KA 3I4MH 2OEOA 3RD4A 2Q2TA 3LE4A 1HXYD 1V9PA 2XP5A 4LF6Q 2RCFA 5KGUA 4GKJQ 4ZK9B 3M7NA 1EU4A 2AQ3B 2B2UC 4A3KB 1K83H 3CCRA 1PH5A 3UE1A 3G7LA 2JN4A 1DJRD 2ZXPA 4IFDI 1F9RA 3KABA 3GTOH 1U4PA 1L1OB 2V4DA 1L0XB 2XWJB 4A3KG 4J15A 4CDFC 3L9AX 4OO1G 5IYDG 2ENBA 4N9PA 3MEHA 1BQQT 3HOXH 1Y1VB 1RL2A 1IBLL 2OCEA 3IAYA 1VQAA 2DNEA 3KLWA 5D3IB 2MP1A 3UDXA 4N8FA 4G57A 3S16B 4DR3L 5EPKA 1WMVA 4DR5Q 2B8GA 2VL6A 1VQ7A 4A3CG 4FP5D 1Y1VG 2OF1A 5IGGA 4KLKA 4DV0Q 2B39A 1EQTA 3AFPA 4A3GH 3LKXA 2LFNA 3I4MB 3X3MA 1HRJA 1F9PA 4QIWE 1AN8A 1TT2A 1NMFA 1NSNS 3C46A 2JA7B 1K0SA 4U68A 3KDFB 3U58A 3FMCA 4CKBA 2CWAA 3FPPA 3N52A 1IL8A 4JI0L 1Q12A 3CPFA 1FNUA 3E9IA 3TZDA 4OXPA 2WAQE 2D0OA 5EBCA 3C2PA 1NR2A 1EWCA 2XP7A 3HS0C 4IFDJ 3KF6B 3L7ZC 1PLFA 3FKIH 3CW2C 1Y1WH 2O5JC 2LXJA 2D62A 2YSHA 2IHEA 5ELEA 4DF7A 3GQBA 3PIP3 1IBKL 1C4QA 1QE6A 4M8AA 1JE4A 4N8X1 1D2BA 3PUXA 4DV4Q 5ELNA 4UPAA 4J8QA 3U9OA 2A6ED 5EKKA 2B2TC 4KI0A 2UUCL 4YHHQ 2XP6A 1XMOL 1ENCA 3SHLA 4B3MQ 1PZKD 1QB5D 3P75A 5M3MG 4A3FB 2NZ1D 2ZXRA 3J7ZC 2E5LL 3ER0A 1E1TA 3F2BA 4LFCL 2MNAA 3NUCA 2NYZD 2Q2UA 1BVSA 1LTGD 1HR0L 2ZAJA 5GQOA
chains in the Genus database with same CATH topology
4FXKC 3M85A 4XDXA 5J39A 1YIJA 3R93A 1IYJB 2OQ0A 4KY5A 1HZBA 2D0PA 4A3EH 2MPMA 2E74C 1ET9A 2DN8A 3BVZA 4L8JA 5CV6A 3GTKB 3NPPA 5G3LF 3CC7A 1I3QB 2YU9B 1I5FA 3MQHA 3HZXA 3SEBA 2E2DC 2NN6G 1VF5C 4H02A 1PTOD 5JEAG 5M5WH 3M4OB 4RGNA 1CI3M 1PYWD 4BBSH 1Q3LA 4QJFA 2DJYA 5AHTA 1K9QA 1MJCA 5IT9L 2PQEA 4HEDA 1EOVA 4ZKCB 2PMZE 3J81c 3W3AA 2KXQA 3J81j 1DOMA 3K7UC 1WCMB 1L1OC 4TSSA 1RKNA 4TRDA 4N9TA 3I4NH 1F2LA 2F0IA 1PFMA 2KOLA 4Y52H 2UXDL 2AQ2B 3Q6SA 3DWPA 1A2TA 1TWAB 4IN3A 4QCLA 1B70B 3GTQH 1XXGA 3V96A 2XGTA 3HGBA 4FF3A 1R4QB 4WFN3 3K81C 4BBSG 1R4PB 1STAA 4A75A 5FO7B 4ODGA 1WOCA 1VDZA 2ZQVA 1VF7A 2F0UA 3KLRA 4FF4A 1QZGA 3GTGB 4AYBG 3MXUA 2BOSA 3MTSA 1PRTC 4DUZL 5C5LA 2RHSB 1KNEA 3QB3A 2ZJRA 3CD6A 5IYDH 3AB9A 5LL6X 5J22A 4LFCQ 1K8OA 3HKZE 3OYYA 3HOWB 4A3CH 1VMPA 2MGSA 3GTJH 1JJCB 1AH9A 1ZEQX 3KBGA 5C0XJ 3SK8A 1A15A 4JC0A 2PPBC 4A0UA 2HDLA 3D6WA 5GAGC 4C3IB 4LW1A 3HOXB 4A3LH 1C8CA 3UDGA 3A5ZB 1AFPA 2K05A 4OO1H 2UUBQ 3A8IE 2IHFA 1PRTF 3HOZG 1Z6HA 3HOXG 3VR2A 2MDIA 1B1ZA 1PH9A 3K5NA 3OTOQ 2XP8A 3Q0AA 1W2BA 3WOEA 2JA6H 1Q1EA 3HG9A 3A0JA 2A68C 1G2SA 3S15B 2GA4B 4BWGB 1YNNC 2LY7A 4BY7G 1PTOH 1CKMA 1Y1WG 5C3EG 1CK1A 1X32A 3ULPA 2NN6I 4C3HG 5D14A 4A3DB 4BS9A 1ZCNA 4DK1A 4ZLTF 4AIMA 3M4QA 2K5HA 4A3BH 2A6HC 1EYAA 5C4XH 1TKWB 2RVLA 4PMBA 4F7XA 2L5TA 1KQSA 5IT9c 5EKIA 4NPSA 4PMCA 1PH3A 4QUFA 3A5UA 1LO5D 4DUYQ 1EZ8A 1EU3A 4L5QA 4GNXA 1N32L 2UU9Q 3A74A 2OTLA 4DR2L 1IYUA 4GN3B 3DMUA 3H3VC 1HNXQ 1RHPA 2MHVA 3BVMA 4A3EG 2K33A 2L9HA 3NTPA 1SMYD 4DN4M 3D31A 4DUZQ 2I07B 4LF5Q 4XQNA 2EYLA 5CV7A 2B2VC 2VQEQ 1N34Q 3PF5A 2B2TA 4LF6L 3K57A 1JWSD 4NKLA 4DAMA 4A93G 4IJLA 4QIWB 4OONA 3MCBA 2A74C 2A73B 2G9DA 3OPOA 4ZQ3A 2HIXA 2BE5D 5DM63 2NVTB 1GUGA 2ZTDA 5E64A 3BDCA 1XX8A 3CC2A 3CC4A 2K04A 2ICEC 1BUVT 4HMIA 4IPHA 1Y14B 4FXGC 1I3QH 1JJ2A 1MKHA 1B8AA 4DPGA 1RJTA 2VS1A 3T1HQ 1NUCA 4JYAQ 1E7ZA 1I50H 4IQZA 3HOVH 3KF6A 4KKSA 2RF4A 1JJGA 4KHPL 3K0XA 3KOJA 5LMNQ 3DM1A 4OIKA 2KHSA 1SJED 2PO4A 4X3KA 1BCPF 2GVAA 3H94A 5M5XB 3W1GA 2EVBA 4K8IA 4DR6Q 5HGQA 3TSSA 1CZWA 2EXDA 2MJ8A 3MA2B 2L11A 1H9SB 2K32A 3EN2A 1J6QA 1PRTB 1SR3A 1VQCA 3A8KE 2ZT9C 3FVQA 4DR7L 2Y0SE 5DAUA 3QIAA 3PIO3 3ULLA 5FO9B 1FL0A 1HTPA 4CJ2C 3DM3A 1YHQA 2CW0D 5IE8A 4X65Q 1E1OA 2DUDA 5E62A 5I6YA 5JJIA 1BO0A 4AQYQ 1HNWQ 2UXCL 2FMCA 5M3FB 3PUZA 4DA2A 2CCZA 4TKOB 3GTMH 5CMDA 3OOBA 1AE3A 4QQBX 2WIIB 2YSBA 1VCIA 2JA5B 5LMNL 3RLFA 4IOCA 1N33L 4LFBQ 1RTOA 1QUQB 5M3FG 3T4AC 2EPBA 2I5HA 4JI5Q 3A7AB 1KLGD 2WB1B 4KKUA 3OSOA 2JA5G 3Q24A 5C4JB 2TMPA 3VA5A 2PMZB 4FNFA 3QO2A 1VQ4A 2XP4A 3GTKH 4QIBA 1E0BA 4YWLA 1XMQQ 2F0PA 3I7FA 2R7DA 1XPRA 3T1HL 4JYAL 2F0HA 2F03A 5IYBG 5CYUA 1PTOB 5EKLA 1A2UA 3V05A 5A35A 4BA1I 2PZUA 2NVYH 4OX9L 3Q8DA 1KHIA 2VQFL 4UAIA 4XTCS 3AYHB 3HOYH 1QUQA 2QKIC 1UEBA 3DUZA 4IUNA 2R3ZA 4DV5L 1XYIA 2UXBL 4A3BB 2N8NA 1YEZA 2WKCA 1IYVA 4QGUA 1V1PA 1CA5A 2F4VL 1F77A 4YCUA 1QNKA 3SK5A 3NBIA 1STHA 4A3BG 4KMUC 1X3FA 1YNJD 3FHWA 1OXSC 3RZOH 1EYCA 1KNAA 4X3SA 4DR4L 2KECA 1Y8OB 2F0NA 1RP5A 3OWFA 4BY7H 4GZYC 3GTQB 3JAML 5ELBA 1CQFA 1LTSD 2K5WA 5K36G 2UUCQ 3UI2A 1A63A 1J8IA 3LKXB 4F87A 1QG7A 3KLSA 1IKMA 3NP8A 1UNSA 4ALPA 4K5XA 2BDNA 4DAYA 4IPCA 2B63G 4B9WA 2NZOA 3A8JE 3PUYA 4Z9CB 1K3RA 4RCNA 3FKIG 3I90A 3IFDA 5F2DA 5HURA 2WV6D 4IO9A 1FGBD 1X6OA 3BZCA 3Q23A 4RGMA 4OHJA 1MSGA 2Q8RE 3CHBD 3E0JA 2L4NA 3STBD 1EWHA 3PO2G 5BR8L 4GN4B 2NVTH 1M8AA 1H95A 4F8MA 5LMUL 5IGCA 3GTJB 4FYDA 1B7YB 4JBMA 1V1QA 5FJ8G 4LJZC 5GAEC 1CSPA 4U85A 4YY3L 3MAQA 4GNXB 1X54A 3GV6A 1S40A 1ENFA 3I2ZA 2N78A 1HFNA 2B2UA 1YW5A 1HPCA 5NUCA 4LUVA 1JB3A 2G9HD 1AW7A 4DV2L 4JI7L 3NSWA 2RHQB 3MVVA 1HFGA 5CV8A 4BXXG 1SEBD 4KN4C 1LACA 3K7AH 4IURA 5M3FH 3BG3A 1WD1A 2QGQA 4A3JH 3FSCA 3GTMB 1YVCA 1SJHD 3HP3A 5FK9C 5FLXE 2PZTA 1M4VA 2LS01 1N34L 2H1EA 1YHBA 1H9JA 1I5HW 1J9OA 4A76A 3P1HA 3RN2A 1W6JA 2O4XA 3GP7A 2BH8A 2ES2A 4U84A 4A3IB 3W5OA 1VQJA 2ZQSA 3PF4A 1EYGA 2IW3A 4XT3B 1OXXK 4FF1A 3HEJA 4DNTB 2JXWA 4DKAC 1RTNA 2OTJA 1XJVA 2JA5H 4B3SL 3BZKA 2QF7A 2B2YA 1KAAA 1K73C 1QOHA 2E75C 2K7VA 2ZM6Q 3I4NG 2R92G 5EAYA 1PYBA 3PSIA 4JI8L 2SNSA 4C1NK 1AEXA 3ONAB 2HCCA 2F4VQ 3VR4A 5C5MA 2L0CA 1S5ED 3EA6A 1FNVA 4PMWA 2M3OW 1TS2A 4DV5Q 2UXDQ 2E2HH 1B9MA 2EYHA 4H13C 3J80c 1CHQD 1YNJC 3NHHA 3ZJYC 3NE5B 1SYGA 3RUZA 1JQYD 3FPUB 3B6YA 1B53A 4IOAA 4C3JG 4B3RL 1VQIA 4X66Q 4AYBE 2KJXA 4H7BA 4V190 1JC7A 4JI0Q 3OMCA 1MD2D 3H3VI 2XTIA 2L15A 1K9RA 5I4DA 1ONLA 3L3OC 1I4QA 1KIXA 3H15A 5C44B 4Q5VA 4DR2Q 4WJ3M 1L2FA 4NDXA 4P75A 4LFBL 4JI5L 2Y8NB 4APVA 1FJGQ 2E2JB 1P16A 3VYSA 1NE3A 3J80L 3CKIB 3DWAA 1WTXA 2FJ2A 2XPAA 3KFUA 4B3TQ 1LTTD 4DR5L 4C1NI 3F2DA 1JOOA 1GJXA 1N9WA 4DUYL 4XT1B 1H9RA 3PIPA 1YZ6A 1XWEA 4JBJA 3DEPA 1HA6A 1KD1C 2R61A 4R8IA 3FRPB 4HJ9A 4DK6C 1BCPD 3T1YL 3JAME 3TP8A 4UP7A 1BNZA 5JJLA 3DHQA 2K1BA 2PW5A 1M1KC 2L55A 1YHAA 1CT1D 2WINB 3HOZB 1IZ6A 1QCBD 3EROA 4NXNQ 2KEDA 1KABA 1BDOA 4I65A 2EZVA 1G8ZD 3CCSA 2JK8A 1D5XC 5JPNC 5I9PA 1YI2A 2EY1A 1AZQA 1UE1A 2R93H 4RMFA 2NTSA 3DEOA 3U50C 3GTLH 3CPWA 2ZTEA 5J1ZA 3T16A 1TWHH 2YTYA 3K80C 4DV1L 4R4OA 1CKNA 1NY4A 5CV5A 2RA4A 2UUBL 4HCSA 1LT3D 3HKSA 3J81E 2ID0A 2K4KA 5KNCA 1WD0A 5C4JH 5E5WA 4JBWA 2R6GA 2JA9A 4DV6Q 1B3AA 1GHJA 2EY5A 3K58A 4JV5Q 1DOKA 4NMZA 4POGA 2XP9A 1QVFA 2R92H 1EFID 4A3GB 3CQZB 3F2CA 4HJAA 1A8VA 5EGTA 1N33Q 2F0DA 1MBYA 4JI4Q 1E2WA 1O7YA 1XTDA 2AHOB 5GAHC 2ZM6L 2DWVA 3KAGA 4RWSC 2RDFA 4DV3Q 2VXWA 2K5DA 3FDTA 1CFMA 5JEAJ 2K5VA 1K9MC 2CQOA 4HJ7A 3SR1A 4LF9L 4LF9Q 1E2VA 3EJIA 4A3EB 1X3EA 1QVCA 3BZDB 1KC8C 2VQEL 4UP9A 3MCBB 2AUJD 4DR7Q 4X3UA 1U4RA 1R9TB 3HOYG 1UEAB 3S17H 3PGZA 4B3TL 3MQGA 2GN5A 4BXXH 4NXMQ 4BBRH 4KK7A 4HCEA 3TREA 2HCIA 1SMYC 4FXDA 2K75A 1HQRD 4A93B 4Y7NH 1N32Q 3G48A 4FF2A 1GUTA 4G7HC 1JB7A 3S14H 2ZR5A 2EYFA 4JK1C 2N3SA 4PV1C 1A3TA 2EJGC 2F0WA 3SXHA 5KEEA 1U9RA 2F0QA 4S3SA 2I46A 3OIPA 1G291 2ZJPA 5IOCA 3T56B 3MWYW 2I0QA 2Z8LA 3DWQA 5LMUQ 2KUMA 4OWWB 1T5EA 3S1MB 3CCLA 2A6HD 5CORA 3PO2H 2FMMA 2J4XA 4IALA 3OTOL 1I4HA 2YYZA 2YSGA 1TS4A 2F0VA 1JOKA 2UUAQ 4P72A 1ASZA 4QMGA 2HQEA 5E3FA 4JI8Q 2XPBA 4G4KA 1A3UA 4DK0A 2Y0SG 2F0OA 2F3IA 2HUGA 5BN4A 4R4IA 1I94Q 3TC5A 3S14B 1F9QA 1GUNA 1VQNA 1SYFA 4CJ1B 1YBYA 2KVMA 2ZXOA 1TWCH 2Y0SB 1VQ6A 1VMCA 1SXTA 5ELDA 5C4XB 1VQLA 3D6CA 1CUKA 3SK4A 3I72A 4ZRZA 5FO8B 2LAJA 1EY6A 2XN9C 3HOUG 1F2ZA 4K8JA 2RE3A 3S1RB 3C3LA 5C4XG 1ESRA 1TVXA 3WWVA 3ICEA 3NTIA 4LUOA 5C4ZA 3STBC 4LF7L 2PNHA 1F2YA 5CGKA 4HIOA 3MXNA 1PRTD 2PQAB 2AUKA 4H0LC 3NQTA 1XNQL 2VQFQ 2JA6G 4RG1A 1D7QA 2EZ5W 2XVSA 5I2YA 5IYBH 5JAVA 4L63B 3QOLA 4X62Q 4DAVA 1Y1VH 4IZ8A 3R8BA 1T5XD 5IWAL 3EQLC 2ZQTA 4RGOS 2VB2X 2JMFA 5ELCA 4A3LG 1X56A 4JI6Q 1O7ZA 1ENAA 2K01A 3L2PA 5E65A 3CCVA 2IJ0A 1D1KA 1JR0D 2WAEA 3GV3A 1CTMA 3QJYA 4MHEA 3T53B 1WTRA 5BN3A 4WRDA 3CF5A 5FLMG 1J5EQ 5CV9A 5EPJA 4LF8Q 2F0LA 3BVGA 3T51B 5DNFA 3UE0A 2JE6I 1EY4A 4RHSA 3G6JB 4QB4A 2DNCA 4LF4L 1JCKB 3C1FA 3GD7A 2NVQB 2HDMA 2UXBQ 2NTTA 2JA8H 1U4MA 1GM5A 3H91A 5DM73 5BN5A 1GUSA 3SK6A 2SOBA 3G71A 2AMCB 3FKIB 1Q46A 1V1PB 5IYCH 1W6KA 1CQVA 3PIOA 4GKKQ 5C6AA 1TWFB 4JI3Q 4HSPA 1PH2A 5M3MH 1SROA 4DR4Q 1ASYA 2L12A 2F0GA 3PO2B 1Q8KA 1S72A 1YJ9A 1BCPC 4RFBA 4LF8L 5FLMH 3KAIA 3VR5A 4DV6L 3BYTB 4A3FH 4KHPQ 3T13A 1R9TH 5IT9E 2PCFB 2QA4A 1KRSA 1XTCD 4UDUC 1S5CD 4XQJA 1VQ9A 2OWOA 4EQPA 5I2XA 1RF2D 4K2KA 3HFZB 1ILQA 1VQDA 2KHIA 2JA7H 2Z4IA 2XNAC 5KYLA 1HNZQ 4XIGS 4A93H 2BCOA 2KCMA 3S1MH 2J0TD 2CW0C 3KCEA 1I4XA 4JBKA 1YJNA 1EIGA 4O2DA 1Z47A 1U4LA 2SNMA 1E22A 2NZHA 3VYTA 5GROA 4NXML 1B44D 1L1OA 1D1IA 4HTHA 2YV5A 2RQXA 3S1RH 1H9KA 3RZDB 4GOPA 2F4IA 3L0OA 2E8GA 4YCVA 5IP7G 2WADA 4B9XA 2VB3X 4RKLA 3PO3H 2IX3A 2YAJB 3CRKC 3V2TA 2AWNA 1VQKA 3CAMA 4DV3L 1G6ZA 2M8JA 2A1AA 1HR0Q 3NWTA 4QY7A 3K5LA 1HUNA 2KCNA 1I94L 1DZ1A 2BA1A 1RIPA 4JI6L 3I4NB 1SFOB 2ZR6A 3GO5A 3J7YW 3A7LA 3BJUA 4K6DA 1WTPA 1X65A 3TMEA 1EEID 5C0XH 4KD3A 3H3VH 1LTRD 3URYA 1PV4A 2VZAA 2DY8A 2JP1A 1K0RA 4IUVA 3R2IA 2JV4A 2JQOA 1PTOF 1N36L 1Z9FA 4RGTA 1JT8A 1VS0A 3S1QB 3RN5A 1JWUD 5FJ8H 1CZGA 2WB1E 3PO3G 3OIQA 4BBRB 4DGZA 4R9WA 4HIKA 1K8AC 3KK7A 3PUWA 2M8IA 1EYDA 4BBSB 2JA8G 3QG1A 3KJOA 1CHPD 3CCUA 1PZID 1S4ZA 3F8TA 5FLXL 3OWEB 3PO3B 5I6WA 5HY6A 1I4GA 1TQOA 1TS5A 4K0KQ 4AYBB 2MQHA 2JA8B 4YCWA 1B4OA 4HSVA 4KHZA 1YJWA 2R93G 1P8LA 1Q1BA 5C44G 2X6GA 4YY3Q 2DY7A 2QILA 2KBNA 4K2LA 1JWMD 3Q22A 1DONA 1SE2A 1KXLA 4PZ8A 1EQRA 2VY3A 3ERQA 2BDOA 1Z7TA 2B2WA 4O1NA 2IL8A 1TWAH 5JVG3 4B3SQ 4E5RA 4LWCA 1EOTA 3U9SA 1LT5D 3I56A 1WR7A 4RHRA 1HNWL 1GD7A 2KCTA 3NWSA 1EEFD 1YNND 1PH4A 2R7ZH 4HN7A 1TXYA 2A68D 5M5YH 2UU9L 2PI2E 4LF4Q 2RDHA 1VQPA 3BS1A 2ITKA 4K5VA 3IL8A 5IGBA 1I6VC 2RDGA 4P71A 4J1MA 1IBMQ 3G6EA 2K6AA 3SGIA 5M3MB 4A3FG 3AEVA 2CHBD 1Q90A 4KY6A 4Q0FA 1GOZA 2CVRA 4C56C 4BY7B 3CCMA 1C7YA 1QVGA 3W1BA 2EIFA 3OW2A 3X3NA 2HHHL 1AE2A 3ULJA 3MEFA 3HOWH 5LHY1 4A4IA 4JG2A 4C3HB 2HQLA 2YSIA 5IIFA 1K8MA 4KJNA 3NENA 3HOUH 1F9SA 4RH6A 5ELFA 4JI7Q 4LFAL 1QILA 1HTLD 4R1JA 3TDBA 2IX1A 3RLOA 1F8AB 3TCZA 1LV9A 1BKBA 4IUTA 1E3PA 4DU9A 3S2HH 5ELOA 1HZ9A 5ISRA 3K8AA 4IUQA 1D8LA 3BYYB 2H4OA 1HH2P 2X69A 4R4TA 4A3GG 1KAWA 1PHJA 2Q5AA 3K7AB 1WTOA 1NCVA 3WDNA 5U47A 2NWGA 1SYBA 1CKNB 3VA7A 1VQBA 5AJ3Q 1TK7A 4DNIA 1IW7D 1BXTA 3SVMA 2OQKA 2F0KA 3M4OH 2ICIA 2KEEA 1MIUA 4JOIC 4P2CB 4DAPA 2K5NA 3NK9A 4EX5A 2ASBA 1C9OA 4EGVA 3KAFA 3BDOA 3KYHC 4MTNA 5CBAE 3I4OA 2V1CC 5C4HA 5C0XG 5JJKA 2K03A 5CBEE 3S1QH 4GS3A 5IYCG 3LNNA 3J80i 1EY0A 3IRBA 3UDFA 1WYDA 1LT4D 1X55A 3K6OA 1H9MA 3AFQA 2XWBB 3CCEA 4KD4A 1DXMA 5E4WC 3MFGA 3TS0A 1DCZA 3U4VA 4IPDA 5DLQE 4ZAIA 2EYOA 5C3EH 3GTOB 5IP7H 2NVXB 4JCVE 1SNDA 2F52A 4REXA 4DV4L 2NUCA 3E5SA 4GNXC 4OO1I 4I7ZC 1J5EL 1YITA 2JYOA 1STGA 4OX9Q 3DLLA 1XPUA 3CMEA 1STEA 2O5IC 3WH0A 4YIJA 3HOVG 1TY0A 1LT6D 3S16H 1K83B 1O7IA 4X66L 1LYLA 3K5OA 4OGQC 2PYKA 1XPOA 1HNZL 2X6LA 4UP8A 4QL5A 3P7JA 2PI2A 3D0FA 2CQAA 2IWHA 5K5PA 1BBXC 3BU2A 3TP6A 1N8RC 4A3MB 4BY1G 4C3IH 3IFTA 3HKZB 5C44H 1I50B 1RDPD 3CCJA 4X62L 1RODA 5G3LD 1II3A 4L5SA 1S3OA 2A5HA 1ZKOA 2WAQG 1I4RA 4BY1B 1LABA 4Y7NB 3MXGA 4MNOA 1NMVA 4PZ7A 1VQFA 2CKZB 3M9BA 3ZYYX 1XMOQ 3OOCA 2WB1G 4M1UB 5C3EB 4C3JH 1TR5A 4GKKL 5E66A 2KCCA 4ID6A 2R7ZB 4A3DG 3HOUB 4YWMA 5IGEA 4GLVB 1JMQA 1SNOA 2KQ3A 1NR4A 4TQUS 1VQOA 5KNBA 2M00A 2R7ZG 1SNPA 1BBWA 4K5WA 5AJ3L 1V1OA 3CMAA 1LTBD 3RLNA 4C3HH 3EIVA 1PH6A 1LTAD 3KBXA 1TY2A 2F3VA 1KTKA 2B2VA 2Z0SA 1LTID 4J6HA 5C0XI 1PFSA 3TP5A 4B3ML 2YSFA 1IHZA 3O13A 3LWEA 4MIUA 2Z6KA 1KRTA 2UUAL 3OMGA 5FOBB 2EJMA 1PH8A 1MJEA 1Q8IA 2FINB 2PQAA 3CNGA 1CSQA 4CKEA 3TS2A 5KIXA 1X3GA 4OL7A 2CFMA 1SAPA 5JEAH 2F0TA 3MHBA 3A54A 4RCOA 2JXMB 3I73A 2YU9H 1PVOA 3ERSX 1EZ6A 1FYCA 3SDZA 2RSOA 2J7ZA 5M5WB 3G4SA 1IBML 2ZJQA 2BH2A 4U86A 3HOZH 5TSSA 1ESFA 5KNDA 2K52A 3MFYA 1EWIA 1D5MC 2EXZA 3VR6A 1M90C 1PA6A 1DD2A 2D5DA 1LM0A 3A55A 3C1EA 1PFNA 1NMGA 3KDFA 1A6XA 1OXVA 1FVIA 3ND9A 2Z4HA 1PH7A 2F1MA 3M4PA 5E4XA 3K59A 2A19A 3FP9A 4MZ9A 3VDYA 1PFBA 1X3PA 3S1NB 1EY8A 1EQQA 3AQQA 1TU2B 2WKDA 2B29A 3TP7A 3H09A 2ATWA 1JOQA 2Q8TA 3M3YH 1HUMA 5KYIA 1EG4A 1QNUA 1O80A 4XXEA 2D9UA 1B9NA 2L1BA 2E2IB 3I8ZA 4HIMA 1SNQA 4PZ6A 5COYA 2OT2A 1Q82C 4A0TA 1WTWA 2RSNA 4BA2I 1O6WA 1JORA 3NXWA 3H0GG 2VNUD 4B3RQ 5A2QE 2IT1A 4DV7Q 4DV7L 1HR0W 3TQYA 4ILWA 5EPLA 5C3XA 1K8GA 1VQMA 4L5TA 1ZYRC 5C3WA 4A3MH 4KKTA 2QDBA 1G2TA 1HQMC 1HHVA 3TDQA 3MXPA 1PINA 4ME5A 1RD9D 4DR1Q 4A3IG 1LUZA 2GVBA 1STNA 5JPMC 4H44C 3R3OA 2A8VA 3TRZA 3E6ZX 2NB0A 3P20A 4FDBA 3NQIA 3J7AF 1SE3A 1A3VA 1GKHA 1EY5A 1OTCA 1EIHA 4ABNA 1S5FD 4O42A 3S2HB 2AKWB 5BR8Q 2VUMB 2ALYB 2JJQA 2HT1A 4HJ5A 2NN6H 4JI3L 2AQ1B 1G51A 2TSSA 2JA6B 2N49A 1CKOA 1GO3E 4X65L 3M4YA 1A62A 4L6TB 2VUMG 2A69D 4V0BA 4YHHL 4FVMA 4MN3A 3VYUA 1Y8NB 5LL6S 1I6HB 4ME3A 3UDIA 1SSOA 4JI4L 1G91A 4RA8A 2NVQH 3A56A 5JVH3 1VQEA 1WI5A 4C3JB 1GUOA 1HJPA 1EIFA 3S15H 2A69C 3NTHA 3I4MG 1EFWA 3CU7A 4HR7B 5H1SE 2RKSA 2WACA 3EBEA 4UY8C 2JA7G 1TWFH 1XMQL 2Q8IB 4K0KL 5CC4A 2Q2HA 1FGUA 2B8FA 3D4WA 3RZDH 5M9OA 2LSSA 1KDCA 4WJWA 3I4LA 3D3RA 2K14A 1V43A 4LFAQ 5IWAQ 2ZTCA 4HIDA 4KTAA 5E1FA 1O7LA 3HOWG 4OIJA 1SE4A 4DV1Q 4EQNA 1SRUA 3HRZC 4GN5A 2B3GA 3FSBA 2C35B 3E0EA 2FHTA 2A6EC 1PXUA 2H5XA 1TWGH 4WORA 4B08A 1NBWA 1ILPA 4GOPC 1B2TA 1Q7YC 2UXCQ 3JAMc 1TIID 4OWXB 1L0YB 1ZYRD 4F88A 5I9OA 4WJ4A 4LF5L 3LX0A 4C2MB 1FR3A 1IL2A 1QWYA 4HJ8A 2PZWA 4LAAA 1KDBA 3TZUA 2FXQA 4DNRB 1GHKA 1NAPA 1D5ZC 3KLSX 1UE5A 3LGJA 3CRLC 1VQ5A 2K50A 2B2WC 1TR8A 3FS8A 2JEBI 2Z6KC 3GTLB 2XSCA 1SFOH 1SE8A 3PCOB 1Y1WB 1SMXA 4XQQA 4G7ZC 2F0SA 4KN7C 3NEMA 5JJZA 4GLXA 4X3TA 4GKJL 1C48A 4JI2Q 1AP0A 4P73A 1E2ZA 3TN2A 4DV2Q 2EY6A 5CQ2A 1JE5A 1Y8PB 4A3IH 4GLAC 4CBVA 1D6EC 2FFKB 4KHVA 2EJFC 2JEAI 4JV5L 1UUPA 2BE5C 2E2HB 4DR3Q 1DGSA 5IP9G 1HZAA 2IX0A 2B63H 2KA7A 1VQGA 4RAUC 1VQHA 3U4ZA 4DR1L 3J80E 3S24A 3GDEA 2MFIA 1I4PA 2XRSD 3S1NH 1OXUA 2M2LA 4DR6L 4CJ0B 2Q2IA 1C0AA 3S9WA 1GVPA 4A3KH 3WOFA 1KLUD 3MZ5A 2I5LX 4A3DH 4ZUIA 3ODKA 4EVOA 4XYOA 4G7OC 1SNMA 4KY7A 4AH6A 2HHHQ 1SYDA 2R92B 2E2IH 2EDGA 2Z1CA 1WCMG 2EY2A 2LKVA 5T1GA 1WTQA 1QJOA 4X64Q 4QF4A 4LUZA 4RKBA 1EY7A 3KF8B 1IKLA 3J81i 4X6AH 5JOBA 1NJIC 2DMVA 2IPKD 3R2TA 5DEHA 1HA5A 3EVQA 2VUMH 1XNRL 1DM0B 4DK3C 1EIYB 1XNRQ 3D4RA 4ZYSA 3IKJA 3FEWX 5M5XH 5D3DA 1FNWA 2DK7A 3S17B 2KHJA 1SNCA 4POFA 1S5BD 1EL0A 2C9OA 1A0IA 2ZQUA 3RR5A 4PG3A 1DYQA 4O0AA 4DFAA 2SEBD 4BBRG 1MSHA 1EG3A 3M7GA 5FLXc 4IPGA 4KV6A 4IFDH 2EQSA 1I6HH 2O2LD 2VW9A 1EY9A 3CCQA 2DGYA 2I5MX 3JAMi 1FD7D 3SE0A 4CGYB 1CM9A 1UWVA 4K14A 1EQVA 2R93B 3KADA 4EQOA 2E76C 4C3IG 1ET6A 3H0GH 3J81L 1AZPA 2ZR4A 5EJWA 1TWGB 3HOVB 2E2JH 3AMUA 2OXPA 3GTGH 1F2MA 1S5DD 4EQ5A 4IUPA 3L4HA 1WJJA 2JSOA 1BCPB 1SYEA 3K0YA 2IY5B 1Q81C 2MO0A 4LNQA 2KENA 5IGFA 1YNXA 3M3YB 1X9NA 3DXJC 2HIVA 3S2DH 2PW7A 3ND8A 1WTVA 5A2QL 2LMCB 3I91A 4JI2L 1DOLA 2YTVA 4HMJA 3NELA 5FKAC 1SN8A 3NBHA 3H6MA 2CWPA 4PNYA 4GOPB 4L5RC 2C5CA 4JI1L 1EUJA 1XNQQ 3KUPA 3RZOB 5D65A 1U0LA 2QEJC 4DAYB 4DXGA 4R8NA 4FO2A 1N36Q 2AWOA 2M9VA 5KRUA 4NXNL 1PDQA 5EQ0A 1IBLQ 1TWCB 1KL9A 3TBIB 4P74A 1WFQA 3MC0B 2MO1A 2F0MA 2L4JA 2K28A 1E24A 4AQYL 3GTPB 3JC66 2R7FA 3AU7A 3F1ZA 3N6RA 3K5MA 2F0EA 1Q86C 1TWHB 3D8GA 2JX8A 3PV0A 2XP3A 4NW2A 2F3WA 4IJHA 3QWNA 1BBUA 2E45A 1PYSB 2N55A 1HCZA 4ZUJA 3KAHA 4ULLA 1JICA 1BR9A 5CV4A 5K36H 2LXKA 3J7AV 1UE6A 4CKCA 2E5LQ 5CR3A 1NTGA 4JOIA 4U673 3CQZH 1PZJD 3I3CA 1SLJA 4DXFA 1X3QA 2EOTA 4KJOA 1WVLA 3KJPA 5M5YB 2WFWA 4TVAB 3ITPA 2F21A 1PTOC 4ZKBB 1SDFA 3VR3A 5IP9H 4A3JG 1BOSA 1JMCA 3HOYB 1ML0D 1B50A 1SBBB 4YWKA 2EE1A 4IUUA 3NTKA 4CHTB 3OHXC 3TEHB 2N88A 4PQXA 1UAPA 1G6PA 2NVXH 4A3JB 4K6LA 1H9SA 1RCVD 1CA6A 4NB3A 2MUYA 4R4QA 3D4DA 4QUCA 2B63B 1IW7C 2D2CC 5GADC 1HZCA 2EYPA 3PQHA 1ICWA 5HGTA 3F2UA 1Y69U 1MGSA 3W2DA 1VQ8A 4HAEA 2QCPX 1O78A 1V8QA 1T9HA 1GXDC 4LF7Q 3J7A5 1HNXL 1GUWA 3T1YQ 2BA0A 5J3BA 1STYA 1TS3A 1KDAA 4XYQA 3I55A 1OO9B 3BDLA 1FLCA 5IY0A 3CXCA 2F0FA 1MI2A 1ZXTA 5AFWA 2EYJA 4E6IA 4DV0L 2NVYB 1STBA 5T1IA<