2Q5AA

Human pin1 bound to l-peptide
Total Genus 46
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
46
sequence length
157
structure length
145
Chain Sequence
LPPGWEKAMSRSSGRVYYFNHITNASQWERPSEPARVRCSHLLVKHSQSRRPSSWRQEKITRTKEEALELINGYIQKIKSGEEDFESLASQFSDCSSAKARGDLGAFSRGQMQKPFEDASFALRTGEMSGPVFTDSGIHIILRTE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Peptidyl-prolyl cis-trans isomerase NIMA-interacting 1
publication title Structural basis for high-affinity peptide inhibition of human Pin1.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Isomerase/isomerase inhibitor
total genus 46
structure length 145
sequence length 157
ec nomenclature ec 5.2.1.8: Peptidylprolyl isomerase.
pdb deposition date 2007-05-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00397 WW WW domain
A PF00639 Rotamase PPIC-type PPIASE domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.20.70.10 Mainly Beta Single Sheet Ubiquitin Ligase Nedd4; Chain: W; Ubiquitin Ligase Nedd4; Chain: W; 2q5aA01
3.10.50.40 Alpha Beta Roll Chitinase A; domain 3 Chitinase A; domain 3 2q5aA02
3EY6A 4IQ2A 3KCEA 3CGMA 1QZ2A 3KAIA 5I98A 2MF9A 4O2TA 3O5FA 2MPHA 4ODOA 3IK8A 2OFNA 3LUOA 3B7XA 4TX0A 3O5EA 3GPKA 4JFJA 1WMVA 4J4OA 2DK7A 1YATA 3PRBA 3O5IA 2LPVA 3PRDA 3O5RA 4GIVA 5HW6A 1EG4A 2DMVA 3KAFA 1J4HA 4JFIA 1BL4A 3IKGA 2XP9A 4FAPA 4U86A 3I6CA 1EG3A 3KZ7A 5J6EA 1Y0OA 4J4NA 4TYOA 2XP6A 2YSIA 2ZQSA 2M3OW 4E5RA 1KT1A 3JXVA 1FKFA 2JXWA 4DRJA 2DWVA 4R0XA 1FKDA 2L4JA 2PV3A 3O5MA 2KR7A 2YSHA 3UQAA 1FKSA 4ODRA 3JYMA 3MDYB 1F40A 2RQSA 4DRKA 3O5QA 5HWCA 1KT0A 2IF4A 2AWGA 3UI6A 1A7XA 2MLXA 1ROTA 3IHZA 2DJYA 1FAPA 1FKLA 5HUAA 4IPXA 4JFKA 1F8AB 4DRIA 2M8JA 4IQCA 4LAXA 5BXJA 2RSEA 2XP7A 2RE3A 4DROA 3FAPA 5HTGA 3M7NA 2PPPA 1J4RA 4W9OA 1C9HA 2Y78A 2VCDA 4DRQA 2LAJA 5HT1A 2PPOA 3JYJA 2PV2A 3H9RB 3O5JA 2KO7A 2K8IA 4DRMA 4QIBA 2DK1A 3CGNA 4C02B 2JMFA 2FAPA 4ODLA 3UI5A 2VN1A 2DG4A 1JNSA 4TNSA 1WR7A 1QPLA 2RUQA 2E45A 2KE0A 5DIUA 2JX8A 4U84A 2LGOA 4DRHA 1QPFA 3O5GA 2F2DA 3OOBA 4QT2A 3NTPA 1D7HA 4LAYA 2RUCA 3KACA 2MNTA 4MGVA 4TW7A 2L2SA 3RGCA 1PINA 4JYSA 4QT3A 5AHTA 3O5LA 4ODPA 4BF8A 3NI6A 1L1PA 1JNTA 2M08A 2MLYA 5HW8A 5GPGA 1EQ3A 5B8IC 1B6CA 4G50A 3O5PA 2ZR5A 3KADA 4DH0A 2ZQTA 1FKJA 2F4EA 1J6YA 4ODQA 1Q6IA 1P5QA 1K9RA 4G2PA 2ZAJA 1R9HA 1NSGA 4TW6A 5DITA 1W26A 2N87A 5D75A 3TDBA 1Q6HA 5HWBA 4ODNA 1FKRA 1M5YA 3VAWA 5HW7A 2ZR4A 1ZCNA 1FKGA 1FKKA 1N1AA 4W9PA 4TW8A 2MDIA 3CNGA 1TCOC 1Q1CA 2PV1A 3O5KA 1U79A 2YSGA 2MLZA 1JVWA 1T11A 4ODMA 4ITZA 1FKBA 4NNRA 1NMVA 2KI3A 4N19A 1I5HW 4JFMA 2XP3A 4DZ3A 4GGQA 3O5OA 4DRNA 2UZ5A 2XPAA 2YSFA 1JMQA 1J4IA 2XPBA 2EZ5W 5HKGA 4LAWA 4DRPA 3TCZA 1D7IA 1NMWA 2DG3A 1YW5A 4FN2A 2F21A 1FKIA 2XP5A 3O5DA 2D9FA 1D6OA 2ITKA 4W9QA 1Q6UA 3LE4A 4U85A 2PPNA 3UF8A 2PBCA 2M1IA 2KGJA 4DIPA 2Q5AA 3RFWA 4DT4A 2ZQVA 2ZR6A 1D7JA 3UI4A 1EYMA 3NRKA 3WH0A 2XP8A 2M8IA 1PBKA 3KAGA 1K9QA 4JFLA 3TC5A 1TK7A 1ROUA 1O6WA 2RURA 2RUDA 1ZK6A 3KAHA 2XP4A 2YSBA 5DIVA 1HXVA 3KABA 4DZ2A 1FKTA 1FJDA 2DG9A 1BKFA 2KFWA 3L4HA 2JZVA 4MSPA 1FKHA 2FKEA 2LJ4A 2ZQUA 2KXQA 1FD9A 3ODKA 2JV4A 4REXA 4ODKA 3PA7A 5CQ2A 2LKNA 4LAVA 3UQBA 2BA1A 3M85A 2M2AA 3IKDA 3UQIA
chains in the Genus database with same CATH superfamily
3EY6A 4IQ2A 1LQ0A 4XAKA 3B9DA 3KCEA 3CGMA 1QZ2A 2A3AA 3KAIA 5I98A 2MF9A 4O2TA 3O5FA 2MPHA 3ARPA 3WQWA 4ODOA 1TR8A 3IK8A 1LG1A 2AOSA 3WIJA 1E15A 2OFNA 3LUOA 3AS1A 3B7XA 4TX0A 3O5EA 2B5UB 3ARUA 5DO2A 3B9AA 2DSUA 3OA5A 2F23A 3GPKA 4JFJA 1WMVA 1W1YA 2G41A 4J4OA 2DK7A 1YATA 3PRBA 3O5IA 3LKXA 2LPVA 3PRDA 3O5RA 4NSBA 4GIVA 3CHCA 4P8UA 5HW6A 1EG4A 1SYTA 2DMVA 3KAFA 2OLHA 4ZPVR 1J4HA 1LJYA 4NZCA 4AY1A 4JFIA 4S3JA 1BL4A 4WKHA 3CHFA 3IKGA 2XP9A 1WNOA 4FAPA 4U86A 1IX5A 3I6CA 1EG3A 3KZ7A 5J6EA 1Y0OA 3ARVA 3G6LA 1NWSA 4DWSD 3WD4A 4J4NA 3ARXA 4TYOA 2XP6A 2YSIA 1HKJA 2ZQSA 2M3OW 4E5RA 5E5WA 1KT1A 2DT0A 3JXVA 1FFQA 5U47A 3FXYA 1FKFA 2JXWA 4DRJA 2DWVA 4HARA 4MNJA 4R0XA 1FKDA 1HKIA 5DEZA 1H0GA 2L4JA 2PV3A 2PN0A 1W9PA 2KR7A 3O5MA 4Z2KA 2YSHA 3UQAA 1FKSA 4Q7NA 1W1TA 4Z2HA 3RM9A 4ODRA 2P4VA 2DT2A 3JYMA 3MDYB 5DF0A 1F40A 4L72B 2RQSA 3ALFA 4DRKA 3O5QA 4DWSB 1RD6A 4GLXA 5HWCA 1KT0A 2IF4A 2AWGA 3UI6A 1NWTA 1A7XA 2MLXA 1ROTA 3PQHA 3ARQA 2PI6A 1UR9A 2DT3A 4IT4A 1HKMA 3IHZA 1UR8A 2DJYA 1FAPA 1FKLA 1JCHB 4W5UA 5HUAA 1GPFA 5JH8A 4IPXA 3RMEA 1W1PA 4JFKA 3PRAA 1F8AB 1SR0A 1EHNA 1FLCA 4DRIA 1XRVA 1HJVA 2M8JA 4IQCA 3FY1A 4LAXA 1NWUA 5BXJA 3ARWA 3QOKA 2RSEA 2XP7A 2RE3A 1VF8A 4DROA 1D2KA 3GU0A 1W1VA 2ESCA 3FAPA 5HTGA 3M7NA 1NWRA 2PPPA 1J4RA 1O6IA 1C9HA 4W9OA 3WD1A 1LL6A 2Y78A 2VCDA 3FS8A 4DRQA 2LAJA 4HBEA 5HT1A 2PPOA 3JYJA 3WD2A 4WKFA 2PV2A 3G6MA 1RP5A 3H9RB 3O5JA 2WK2A 2KO7A 2K8IA 4DRMA 4QIBA 3GTYX 2DK1A 1LL7A 3CGNA 4C02B 2JMFA 1KFWA 2B31A 4WK9A 4Z2GA 2FAPA 4ODLA 3UI5A 4ZS6A 2VN1A 5HBFA 2DG4A 3MCBB 3ALGA 1JNSA 1W9UA 4TNSA 1ITXA 2YBUA 1WR7A 1QPLA 2RUQA 2E45A 2KE0A 5DIUA 5GQBA 1ZBCA 2EULA 3CZ8A 1ZBKA 2JX8A 4U84A 2LGOA 4DRHA 1QPFA 2F2DA 3O5GA 5E65A 4HBOA 1W9VA 3OOBA 1HJWA 2A3BA 1E9LA 1GRJA 2DSZA 4QT2A 3NTPA 3FSBA 1D7HA 2RUCA 4LAYA 4Q22A 1HJXA 4ZPWR 3W4RA 3KACA 2MNTA 4Z2JA 3FSCA 4MGVA 2QRVA 4TW7A 2L2SA 2DPEA 3RGCA 1PINA 4JYSA 4QT3A 5AHTA 3O5LA 1H0IA 4ODPA 4QZVB 4BF8A 3NI6A 1L1PA 1JNTA 2M08A 1LG2A 1GUVA 2DT1A 2MLYA 3AS2A 3CHDA 5HW8A 5GPGA 1JNEA 3CHEA 1EQ3A 5B8IC 2O92A 1B6CA 4G50A 1CTNA 3O5PA 1ZBVA 2ZR5A 3KADA 4DH0A 3AQUA 2ZQTA 1FKJA 4KR0B 2F4EA 1J6YA 4ODQA 1Q6IA 4WIWA 1P5QA 2IUZA 1K9RA 3WKZA 1OWQA 4G2PA 3WL0A 2ZAJA 1R9HA 1NSGA 3CH9A 4MAVA 4TW6A 5DITA 1NH6A 3MQGA 5E66A 4ZPTR 3BMBA 1W26A 4DWSA 2N87A 4R5EA 4L3NA 5D75A 1ZB5A 4LGXA 3TDBA 1Q6HA 2Y8NB 5HWBA 4ODNA 1FKRA 1M5YA 1ZBWA 3VAWA 5HW7A 2WAEA 4IT6A 2ZR4A 1ZCNA 1FKGA 1FKKA 1N1AA 3B9EA 4W9PA 1WAWA 3ARYA 1FFRA 1LL4A 4TW8A 2MDIA 1HKKA 5E64A 3CNGA 1TCOC 1Q1CA 2PV1A 3O5KA 1U79A 2YSGA 3AROA 2MLZA 4P8XA 1JVWA 5GPRA 2WLYA 1T11A 4ODMA 4ITZA 4DWSC 3LKXB 1FKBA 3AS3A 1E6PA 1WB0A 1NMVA 4KQZA 4NNRA 2KI3A 4P8WA 4N19A 1I5HW 4JFMA 2WLZA 2XP3A 4DZ3A 4GGQA 3ARRA 3O5OA 4DRNA 3ARSA 2UZ5A 1XHGA 2XPAA 2OWOA 2YSFA 1JMQA 2ETNA 1J4IA 3BXWA 3MQHA 1OGGA 2XPBA 2EZ5W 5E62A 3AS0A 5HKGA 2WADA 4S3KA 4LAWA 4MTVA 3TCZA 4DRPA 1D7IA 1NMWA 1E44A 2O9OA 2DG3A 1YW5A 4FN2A 4UDMA 2F21A 1FKIA 3RM4A 1OGBA 2XP5A 3O5DA 2YAJB 4MNMA 4MNLA 2D9FA 1D6OA 3RM8A 2ITKA 4W9QA 1Q6UA 3LE4A 4U85A 2PPNA 3MCBA 3UF8A 2FDMA 1X6LA 2PBCA 2M1IA 2KGJA 3WD3A 4DIPA 2Q5AA 3RFWA 3B8SA 4DT4A 2ZQVA 2ZR6A 1D7JA 3UI4A 1E6RA 1E6NA 2DSVA 4A0TA 1EYMA 3NRKA 3WH0A 2XP8A 2M8IA 1PBKA 1X6NA 3PR9A 3KAGA 4P8VA 1K9QA 4JFLA 1ZU8A 3TC5A 1TK7A 1TFVA 1ROUA 1O6WA 4Z2LA 3EIPA 1GOIA 4URIA 2DSWA 2RURA 2RUDA 4Z2IA 4A0UA 2G8ZA 1ZK6A 3KAHA 2XP4A 2A3EA 4MPKA 2YSBA 5DIVA 1HXVA 4WJXA 3KABA 1K9TA 4DZ2A 1FKTA 1FJDA 4WKAA 4PTMA 2DG9A 1EDQA 1BKFA 2KFWA 2WM0A 3L4HA 3WL1A 2JZVA 2A3CA 4MSPA 3WQVA 4MNKA 1EIBA 1FKHA 2QF8A 2FKEA 2LJ4A 2ZQUA 2KXQA 1FD9A 3ARZA 3ODKA 2JV4A 4REXA 1JNDA 4ODKA 3PA7A 5CQ2A 1ZL1A 2LKNA 4LAVA 3WD0A 3UQBA 4ML4A 2BA1A 3M85A 2YBTA 2M2AA 3IKDA 3ARTA 1E6ZA 3UQIA
chains in the Genus database with same CATH topology
3EY6A 4IQ2A 1LQ0A 4XAKA 3B9DA 3KCEA 3CGMA 1QZ2A 2A3AA 3KAIA 5I98A 2MF9A 4O2TA 3O5FA 2MPHA 3ARPA 3WQWA 4ODOA 1TR8A 3IK8A 1LG1A 2AOSA 3WIJA 1E15A 2OFNA 3LUOA 3AS1A 3B7XA 4TX0A 3O5EA 3ARUA 5DO2A 3B9AA 2DSUA 3OA5A 3GPKA 4JFJA 1WMVA 1W1YA 2G41A 4J4OA 2DK7A 1YATA 3PRBA 3O5IA 3LKXA 2LPVA 3PRDA 3O5RA 4NSBA 4GIVA 3CHCA 4P8UA 5HW6A 1EG4A 1SYTA 2DMVA 3KAFA 2OLHA 4ZPVR 1J4HA 1LJYA 4NZCA 4AY1A 4JFIA 4S3JA 1BL4A 4WKHA 3CHFA 3IKGA 2XP9A 1WNOA 4FAPA 4U86A 1IX5A 3I6CA 1EG3A 3KZ7A 5J6EA 1Y0OA 3ARVA 3G6LA 1NWSA 4DWSD 3WD4A 4J4NA 3ARXA 4TYOA 2XP6A 2YSIA 1HKJA 2ZQSA 2M3OW 4E5RA 5E5WA 1KT1A 2DT0A 3JXVA 1FFQA 5U47A 3FXYA 1FKFA 2JXWA 4DRJA 2DWVA 4HARA 4MNJA 4R0XA 1FKDA 1HKIA 5DEZA 1H0GA 2L4JA 2PV3A 1W9PA 2KR7A 3O5MA 4Z2KA 2YSHA 3UQAA 1FKSA 4Q7NA 1W1TA 4Z2HA 3RM9A 4ODRA 2DT2A 3JYMA 3MDYB 5DF0A 1F40A 4L72B 2RQSA 3ALFA 4DRKA 3O5QA 4DWSB 1RD6A 4GLXA 5HWCA 1KT0A 2IF4A 2AWGA 3UI6A 1NWTA 1A7XA 2MLXA 1ROTA 3PQHA 3ARQA 2PI6A 1UR9A 2DT3A 4IT4A 1HKMA 3IHZA 1UR8A 2DJYA 1FAPA 1FKLA 4W5UA 5HUAA 1GPFA 5JH8A 4IPXA 3RMEA 1W1PA 4JFKA 3PRAA 1F8AB 1SR0A 1EHNA 1FLCA 4DRIA 1XRVA 1HJVA 2M8JA 4IQCA 3FY1A 4LAXA 1NWUA 5BXJA 3ARWA 3QOKA 2RSEA 2XP7A 2RE3A 1VF8A 4DROA 1D2KA 1W1VA 2ESCA 3FAPA 5HTGA 3M7NA 1NWRA 2PPPA 1J4RA 1O6IA 1C9HA 4W9OA 3WD1A 1LL6A 2Y78A 2VCDA 3FS8A 4DRQA 2LAJA 4HBEA 5HT1A 2PPOA 3JYJA 3WD2A 4WKFA 2PV2A 3G6MA 1RP5A 3H9RB 3O5JA 2WK2A 2KO7A 2K8IA 4DRMA 4QIBA 2DK1A 1LL7A 3CGNA 4C02B 2JMFA 1KFWA 2B31A 4WK9A 4Z2GA 2FAPA 4ODLA 3UI5A 4ZS6A 2VN1A 5HBFA 2DG4A 3MCBB 3ALGA 1JNSA 1W9UA 4TNSA 1ITXA 2YBUA 1WR7A 1QPLA 2RUQA 2E45A 2KE0A 5DIUA 5GQBA 1ZBCA 3CZ8A 1ZBKA 2JX8A 4U84A 2LGOA 4DRHA 1QPFA 2F2DA 3O5GA 5E65A 4HBOA 1W9VA 3OOBA 1HJWA 2A3BA 1E9LA 2DSZA 4QT2A 3NTPA 3FSBA 1D7HA 2RUCA 4LAYA 4Q22A 1HJXA 4ZPWR 3W4RA 3KACA 2MNTA 4Z2JA 3FSCA 4MGVA 2QRVA 4TW7A 2L2SA 2DPEA 3RGCA 1PINA 4JYSA 4QT3A 5AHTA 3O5LA 1H0IA 4ODPA 4QZVB 4BF8A 3NI6A 1L1PA 1JNTA 2M08A 1LG2A 1GUVA 2DT1A 2MLYA 3AS2A 3CHDA 5HW8A 5GPGA 1JNEA 3CHEA 1EQ3A 5B8IC 2O92A 1B6CA 4G50A 1CTNA 3O5PA 1ZBVA 2ZR5A 3KADA 4DH0A 3AQUA 2ZQTA 1FKJA 4KR0B 2F4EA 1J6YA 4ODQA 1Q6IA 4WIWA 1P5QA 2IUZA 1K9RA 3WKZA 1OWQA 4G2PA 3WL0A 2ZAJA 1R9HA 1NSGA 3CH9A 4MAVA 4TW6A 5DITA 1NH6A 3MQGA 5E66A 4ZPTR 1W26A 4DWSA 2N87A 4R5EA 4L3NA 5D75A 1ZB5A 4LGXA 3TDBA 1Q6HA 2Y8NB 5HWBA 4ODNA 1FKRA 1M5YA 1ZBWA 3VAWA 5HW7A 2WAEA 4IT6A 2ZR4A 1ZCNA 1FKGA 1FKKA 1N1AA 3B9EA 4W9PA 1WAWA 3ARYA 1FFRA 1LL4A 4TW8A 2MDIA 1HKKA 5E64A 3CNGA 1TCOC 1Q1CA 2PV1A 3O5KA 1U79A 2YSGA 3AROA 2MLZA 4P8XA 1JVWA 5GPRA 2WLYA 1T11A 4ODMA 4ITZA 4DWSC 3LKXB 1FKBA 3AS3A 1E6PA 1WB0A 1NMVA 4KQZA 4NNRA 2KI3A 4P8WA 4N19A 1I5HW 4JFMA 2WLZA 2XP3A 4DZ3A 4GGQA 3ARRA 3O5OA 4DRNA 3ARSA 2UZ5A 1XHGA 2XPAA 2OWOA 2YSFA 1JMQA 1J4IA 3BXWA 3MQHA 1OGGA 2XPBA 2EZ5W 5E62A 3AS0A 5HKGA 2WADA 4S3KA 4LAWA 4MTVA 3TCZA 4DRPA 1D7IA 1NMWA 2O9OA 2DG3A 1YW5A 4FN2A 2F21A 1FKIA 3RM4A 1OGBA 2XP5A 3O5DA 2YAJB 4MNMA 4MNLA 2D9FA 1D6OA 3RM8A 2ITKA 4W9QA 1Q6UA 3LE4A 4U85A 2PPNA 3MCBA 3UF8A 2FDMA 1X6LA 2PBCA 2M1IA 2KGJA 3WD3A 4DIPA 2Q5AA 3RFWA 3B8SA 4DT4A 2ZQVA 2ZR6A 1D7JA 3UI4A 1E6RA 1E6NA 2DSVA 4A0TA 1EYMA 3NRKA 3WH0A 2XP8A 2M8IA 1PBKA 1X6NA 3PR9A 3KAGA 4P8VA 1K9QA 4JFLA 1ZU8A 3TC5A 1TK7A 1TFVA 1ROUA 1O6WA 4Z2LA 1GOIA 4URIA 2DSWA 2RURA 2RUDA 4Z2IA 4A0UA 2G8ZA 1ZK6A 3KAHA 2XP4A 2A3EA 4MPKA 2YSBA 5DIVA 1HXVA 4WJXA 3KABA 1K9TA 4DZ2A 1FKTA 1FJDA 4WKAA 4PTMA 2DG9A 1EDQA 1BKFA 2KFWA 2WM0A 3L4HA 3WL1A 2JZVA 2A3CA 4MSPA 3WQVA 4MNKA 1EIBA 1FKHA 2QF8A 2FKEA 2LJ4A 2ZQUA 2KXQA 1FD9A 3ARZA 3ODKA 2JV4A 4REXA 1JNDA 4ODKA 3PA7A 5CQ2A 1ZL1A 2LKNA 4LAVA 3WD0A 3UQBA 4ML4A 2BA1A 3M85A 2YBTA 2M2AA 3IKDA 3ARTA 1E6ZA 3UQIA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3EY6 A;  4IQ2 A;  3KCE A;  3CGM A;  1QZ2 A;  3KAI A;  5I98 A;  2MF9 A;  4O2T A;  3O5F A;  2MPH A;  4ODO A;  3IK8 A;  2OFN A;  3LUO A;  3B7X A;  4TX0 A;  3O5E A;  3GPK A;  4JFJ A;  1WMV A;  4J4O A;  2DK7 A;  1YAT A;  3PRB A;  3O5I A;  2LPV A;  3PRD A;  3O5R A;  4GIV A;  5HW6 A;  1EG4 A;  2DMV A;  3KAF A;  1J4H A;  4JFI A;  1BL4 A;  3IKG A;  2XP9 A;  4FAP A;  4U86 A;  3I6C A;  1EG3 A;  3KZ7 A;  5J6E A;  1Y0O A;  4J4N A;  4TYO A;  2XP6 A;  2YSI A;  2ZQS A;  2M3O W;  4E5R A;  1KT1 A;  3JXV A;  1FKF A;  2JXW A;  4DRJ A;  2DWV A;  4R0X A;  1FKD A;  2L4J A;  2PV3 A;  3O5M A;  2KR7 A;  2YSH A;  3UQA A;  1FKS A;  4ODR A;  3JYM A;  3MDY B;  1F40 A;  2RQS A;  4DRK A;  3O5Q A;  5HWC A;  1KT0 A;  2IF4 A;  2AWG A;  3UI6 A;  1A7X A;  2MLX A;  1ROT A;  3IHZ A;  2DJY A;  1FAP A;  1FKL A;  5HUA A;  4IPX A;  4JFK A;  1F8A B;  4DRI A;  2M8J A;  4IQC A;  4LAX A;  5BXJ A;  2RSE A;  2XP7 A;  2RE3 A;  4DRO A;  3FAP A;  5HTG A;  3M7N A;  2PPP A;  1J4R A;  4W9O A;  1C9H A;  2Y78 A;  2VCD A;  4DRQ A;  2LAJ A;  5HT1 A;  2PPO A;  3JYJ A;  2PV2 A;  3H9R B;  3O5J A;  2KO7 A;  2K8I A;  4DRM A;  4QIB A;  2DK1 A;  3CGN A;  4C02 B;  2JMF A;  2FAP A;  4ODL A;  3UI5 A;  2VN1 A;  2DG4 A;  1JNS A;  4TNS A;  1WR7 A;  1QPL A;  2RUQ A;  2E45 A;  2KE0 A;  5DIU A;  2JX8 A;  4U84 A;  2LGO A;  4DRH A;  1QPF A;  3O5G A;  2F2D A;  3OOB A;  4QT2 A;  3NTP A;  1D7H A;  4LAY A;  2RUC A;  3KAC A;  2MNT A;  4MGV A;  4TW7 A;  2L2S A;  3RGC A;  1PIN A;  4JYS A;  4QT3 A;  5AHT A;  3O5L A;  4ODP A;  4BF8 A;  3NI6 A;  1L1P A;  1JNT A;  2M08 A;  2MLY A;  5HW8 A;  5GPG A;  1EQ3 A;  5B8I C;  1B6C A;  4G50 A;  3O5P A;  2ZR5 A;  3KAD A;  4DH0 A;  2ZQT A;  1FKJ A;  2F4E A;  1J6Y A;  4ODQ A;  1Q6I A;  1P5Q A;  1K9R A;  4G2P A;  2ZAJ A;  1R9H A;  1NSG A;  4TW6 A;  5DIT A;  1W26 A;  2N87 A;  5D75 A;  3TDB A;  1Q6H A;  5HWB A;  4ODN A;  1FKR A;  1M5Y A;  3VAW A;  5HW7 A;  2ZR4 A;  1ZCN A;  1FKG A;  1FKK A;  1N1A A;  4W9P A;  4TW8 A;  2MDI A;  3CNG A;  1TCO C;  1Q1C A;  2PV1 A;  3O5K A;  1U79 A;  2YSG A;  2MLZ A;  1JVW A;  1T11 A;  4ODM A;  4ITZ A;  1FKB A;  4NNR A;  1NMV A;  2KI3 A;  4N19 A;  1I5H W;  4JFM A;  2XP3 A;  4DZ3 A;  4GGQ A;  3O5O A;  4DRN A;  2UZ5 A;  2XPA A;  2YSF A;  1JMQ A;  1J4I A;  2XPB A;  2EZ5 W;  5HKG A;  4LAW A;  4DRP A;  3TCZ A;  1D7I A;  1NMW A;  2DG3 A;  1YW5 A;  4FN2 A;  2F21 A;  1FKI A;  2XP5 A;  3O5D A;  2D9F A;  1D6O A;  2ITK A;  4W9Q A;  1Q6U A;  3LE4 A;  4U85 A;  2PPN A;  3UF8 A;  2PBC A;  2M1I A;  2KGJ A;  4DIP A;  2Q5A A;  3RFW A;  4DT4 A;  2ZQV A;  2ZR6 A;  1D7J A;  3UI4 A;  1EYM A;  3NRK A;  3WH0 A;  2XP8 A;  2M8I A;  1PBK A;  3KAG A;  1K9Q A;  4JFL A;  3TC5 A;  1TK7 A;  1ROU A;  1O6W A;  2RUR A;  2RUD A;  1ZK6 A;  3KAH A;  2XP4 A;  2YSB A;  5DIV A;  1HXV A;  3KAB A;  4DZ2 A;  1FKT A;  1FJD A;  2DG9 A;  1BKF A;  2KFW A;  3L4H A;  2JZV A;  4MSP A;  1FKH A;  2FKE A;  2LJ4 A;  2ZQU A;  2KXQ A;  1FD9 A;  3ODK A;  2JV4 A;  4REX A;  4ODK A;  3PA7 A;  5CQ2 A;  2LKN A;  4LAV A;  3UQB A;  2BA1 A;  3M85 A;  2M2A A;  3IKD A;  3UQI A; 
#chains in the Genus database with same CATH topology
 3EY6 A;  4IQ2 A;  1LQ0 A;  4XAK A;  3B9D A;  3KCE A;  3CGM A;  1QZ2 A;  2A3A A;  3KAI A;  5I98 A;  2MF9 A;  4O2T A;  3O5F A;  2MPH A;  3ARP A;  3WQW A;  4ODO A;  1TR8 A;  3IK8 A;  1LG1 A;  2AOS A;  3WIJ A;  1E15 A;  2OFN A;  3LUO A;  3AS1 A;  3B7X A;  4TX0 A;  3O5E A;  2B5U B;  3ARU A;  5DO2 A;  3B9A A;  2DSU A;  3OA5 A;  2F23 A;  3GPK A;  4JFJ A;  1WMV A;  1W1Y A;  2G41 A;  4J4O A;  2DK7 A;  1YAT A;  3PRB A;  3O5I A;  3LKX A;  2LPV A;  3PRD A;  3O5R A;  4NSB A;  4GIV A;  3CHC A;  4P8U A;  5HW6 A;  1EG4 A;  1SYT A;  2DMV A;  3KAF A;  2OLH A;  4ZPV R;  1J4H A;  1LJY A;  4NZC A;  4AY1 A;  4JFI A;  4S3J A;  1BL4 A;  4WKH A;  3CHF A;  3IKG A;  2XP9 A;  1WNO A;  4FAP A;  4U86 A;  1IX5 A;  3I6C A;  1EG3 A;  3KZ7 A;  5J6E A;  1Y0O A;  3ARV A;  3G6L A;  1NWS A;  4DWS D;  3WD4 A;  4J4N A;  3ARX A;  4TYO A;  2XP6 A;  2YSI A;  1HKJ A;  2ZQS A;  2M3O W;  4E5R A;  5E5W A;  1KT1 A;  2DT0 A;  3JXV A;  1FFQ A;  5U47 A;  3FXY A;  1FKF A;  2JXW A;  4DRJ A;  2DWV A;  4HAR A;  4MNJ A;  4R0X A;  1FKD A;  1HKI A;  5DEZ A;  1H0G A;  2L4J A;  2PV3 A;  2PN0 A;  1W9P A;  2KR7 A;  3O5M A;  4Z2K A;  2YSH A;  3UQA A;  1FKS A;  4Q7N A;  1W1T A;  4Z2H A;  3RM9 A;  4ODR A;  2P4V A;  2DT2 A;  3JYM A;  3MDY B;  5DF0 A;  1F40 A;  4L72 B;  2RQS A;  3ALF A;  4DRK A;  3O5Q A;  4DWS B;  1RD6 A;  4GLX A;  5HWC A;  1KT0 A;  2IF4 A;  2AWG A;  3UI6 A;  1NWT A;  1A7X A;  2MLX A;  1ROT A;  3PQH A;  3ARQ A;  2PI6 A;  1UR9 A;  2DT3 A;  4IT4 A;  1HKM A;  3IHZ A;  1UR8 A;  2DJY A;  1FAP A;  1FKL A;  1JCH B;  4W5U A;  5HUA A;  1GPF A;  5JH8 A;  4IPX A;  3RME A;  1W1P A;  4JFK A;  3PRA A;  1F8A B;  1SR0 A;  1EHN A;  1FLC A;  4DRI A;  1XRV A;  1HJV A;  2M8J A;  4IQC A;  3FY1 A;  4LAX A;  1NWU A;  5BXJ A;  3ARW A;  3QOK A;  2RSE A;  2XP7 A;  2RE3 A;  1VF8 A;  4DRO A;  1D2K A;  3GU0 A;  1W1V A;  2ESC A;  3FAP A;  5HTG A;  3M7N A;  1NWR A;  2PPP A;  1J4R A;  1O6I A;  1C9H A;  4W9O A;  3WD1 A;  1LL6 A;  2Y78 A;  2VCD A;  3FS8 A;  4DRQ A;  2LAJ A;  4HBE A;  5HT1 A;  2PPO A;  3JYJ A;  3WD2 A;  4WKF A;  2PV2 A;  3G6M A;  1RP5 A;  3H9R B;  3O5J A;  2WK2 A;  2KO7 A;  2K8I A;  4DRM A;  4QIB A;  3GTY X;  2DK1 A;  1LL7 A;  3CGN A;  4C02 B;  2JMF A;  1KFW A;  2B31 A;  4WK9 A;  4Z2G A;  2FAP A;  4ODL A;  3UI5 A;  4ZS6 A;  2VN1 A;  5HBF A;  2DG4 A;  3MCB B;  3ALG A;  1JNS A;  1W9U A;  4TNS A;  1ITX A;  2YBU A;  1WR7 A;  1QPL A;  2RUQ A;  2E45 A;  2KE0 A;  5DIU A;  5GQB A;  1ZBC A;  2EUL A;  3CZ8 A;  1ZBK A;  2JX8 A;  4U84 A;  2LGO A;  4DRH A;  1QPF A;  2F2D A;  3O5G A;  5E65 A;  4HBO A;  1W9V A;  3OOB A;  1HJW A;  2A3B A;  1E9L A;  1GRJ A;  2DSZ A;  4QT2 A;  3NTP A;  3FSB A;  1D7H A;  2RUC A;  4LAY A;  4Q22 A;  1HJX A;  4ZPW R;  3W4R A;  3KAC A;  2MNT A;  4Z2J A;  3FSC A;  4MGV A;  2QRV A;  4TW7 A;  2L2S A;  2DPE A;  3RGC A;  1PIN A;  4JYS A;  4QT3 A;  5AHT A;  3O5L A;  1H0I A;  4ODP A;  4QZV B;  4BF8 A;  3NI6 A;  1L1P A;  1JNT A;  2M08 A;  1LG2 A;  1GUV A;  2DT1 A;  2MLY A;  3AS2 A;  3CHD A;  5HW8 A;  5GPG A;  1JNE A;  3CHE A;  1EQ3 A;  5B8I C;  2O92 A;  1B6C A;  4G50 A;  1CTN A;  3O5P A;  1ZBV A;  2ZR5 A;  3KAD A;  4DH0 A;  3AQU A;  2ZQT A;  1FKJ A;  4KR0 B;  2F4E A;  1J6Y A;  4ODQ A;  1Q6I A;  4WIW A;  1P5Q A;  2IUZ A;  1K9R A;  3WKZ A;  1OWQ A;  4G2P A;  3WL0 A;  2ZAJ A;  1R9H A;  1NSG A;  3CH9 A;  4MAV A;  4TW6 A;  5DIT A;  1NH6 A;  3MQG A;  5E66 A;  4ZPT R;  3BMB A;  1W26 A;  4DWS A;  2N87 A;  4R5E A;  4L3N A;  5D75 A;  1ZB5 A;  4LGX A;  3TDB A;  1Q6H A;  2Y8N B;  5HWB A;  4ODN A;  1FKR A;  1M5Y A;  1ZBW A;  3VAW A;  5HW7 A;  2WAE A;  4IT6 A;  2ZR4 A;  1ZCN A;  1FKG A;  1FKK A;  1N1A A;  3B9E A;  4W9P A;  1WAW A;  3ARY A;  1FFR A;  1LL4 A;  4TW8 A;  2MDI A;  1HKK A;  5E64 A;  3CNG A;  1TCO C;  1Q1C A;  2PV1 A;  3O5K A;  1U79 A;  2YSG A;  3ARO A;  2MLZ A;  4P8X A;  1JVW A;  5GPR A;  2WLY A;  1T11 A;  4ODM A;  4ITZ A;  4DWS C;  3LKX B;  1FKB A;  3AS3 A;  1E6P A;  1WB0 A;  1NMV A;  4KQZ A;  4NNR A;  2KI3 A;  4P8W A;  4N19 A;  1I5H W;  4JFM A;  2WLZ A;  2XP3 A;  4DZ3 A;  4GGQ A;  3ARR A;  3O5O A;  4DRN A;  3ARS A;  2UZ5 A;  1XHG A;  2XPA A;  2OWO A;  2YSF A;  1JMQ A;  2ETN A;  1J4I A;  3BXW A;  3MQH A;  1OGG A;  2XPB A;  2EZ5 W;  5E62 A;  3AS0 A;  5HKG A;  2WAD A;  4S3K A;  4LAW A;  4MTV A;  3TCZ A;  4DRP A;  1D7I A;  1NMW A;  1E44 A;  2O9O A;  2DG3 A;  1YW5 A;  4FN2 A;  4UDM A;  2F21 A;  1FKI A;  3RM4 A;  1OGB A;  2XP5 A;  3O5D A;  2YAJ B;  4MNM A;  4MNL A;  2D9F A;  1D6O A;  3RM8 A;  2ITK A;  4W9Q A;  1Q6U A;  3LE4 A;  4U85 A;  2PPN A;  3MCB A;  3UF8 A;  2FDM A;  1X6L A;  2PBC A;  2M1I A;  2KGJ A;  3WD3 A;  4DIP A;  2Q5A A;  3RFW A;  3B8S A;  4DT4 A;  2ZQV A;  2ZR6 A;  1D7J A;  3UI4 A;  1E6R A;  1E6N A;  2DSV A;  4A0T A;  1EYM A;  3NRK A;  3WH0 A;  2XP8 A;  2M8I A;  1PBK A;  1X6N A;  3PR9 A;  3KAG A;  4P8V A;  1K9Q A;  4JFL A;  1ZU8 A;  3TC5 A;  1TK7 A;  1TFV A;  1ROU A;  1O6W A;  4Z2L A;  3EIP A;  1GOI A;  4URI A;  2DSW A;  2RUR A;  2RUD A;  4Z2I A;  4A0U A;  2G8Z A;  1ZK6 A;  3KAH A;  2XP4 A;  2A3E A;  4MPK A;  2YSB A;  5DIV A;  1HXV A;  4WJX A;  3KAB A;  1K9T A;  4DZ2 A;  1FKT A;  1FJD A;  4WKA A;  4PTM A;  2DG9 A;  1EDQ A;  1BKF A;  2KFW A;  2WM0 A;  3L4H A;  3WL1 A;  2JZV A;  2A3C A;  4MSP A;  3WQV A;  4MNK A;  1EIB A;  1FKH A;  2QF8 A;  2FKE A;  2LJ4 A;  2ZQU A;  2KXQ A;  1FD9 A;  3ARZ A;  3ODK A;  2JV4 A;  4REX A;  1JND A;  4ODK A;  3PA7 A;  5CQ2 A;  1ZL1 A;  2LKN A;  4LAV A;  3WD0 A;  3UQB A;  4ML4 A;  2BA1 A;  3M85 A;  2YBT A;  2M2A A;  3IKD A;  3ART A;  1E6Z A;  3UQI A; 
#chains in the Genus database with same CATH homology
 3EY6 A;  4IQ2 A;  1LQ0 A;  4XAK A;  3B9D A;  3KCE A;  3CGM A;  1QZ2 A;  2A3A A;  3KAI A;  5I98 A;  2MF9 A;  4O2T A;  3O5F A;  2MPH A;  3ARP A;  3WQW A;  4ODO A;  1TR8 A;  3IK8 A;  1LG1 A;  2AOS A;  3WIJ A;  1E15 A;  2OFN A;  3LUO A;  3AS1 A;  3B7X A;  4TX0 A;  3O5E A;  3ARU A;  5DO2 A;  3B9A A;  2DSU A;  3OA5 A;  3GPK A;  4JFJ A;  1WMV A;  1W1Y A;  2G41 A;  4J4O A;  2DK7 A;  1YAT A;  3PRB A;  3O5I A;  3LKX A;  2LPV A;  3PRD A;  3O5R A;  4NSB A;  4GIV A;  3CHC A;  4P8U A;  5HW6 A;  1EG4 A;  1SYT A;  2DMV A;  3KAF A;  2OLH A;  4ZPV R;  1J4H A;  1LJY A;  4NZC A;  4AY1 A;  4JFI A;  4S3J A;  1BL4 A;  4WKH A;  3CHF A;  3IKG A;  2XP9 A;  1WNO A;  4FAP A;  4U86 A;  1IX5 A;  3I6C A;  1EG3 A;  3KZ7 A;  5J6E A;  1Y0O A;  3ARV A;  3G6L A;  1NWS A;  4DWS D;  3WD4 A;  4J4N A;  3ARX A;  4TYO A;  2XP6 A;  2YSI A;  1HKJ A;  2ZQS A;  2M3O W;  4E5R A;  5E5W A;  1KT1 A;  2DT0 A;  3JXV A;  1FFQ A;  5U47 A;  3FXY A;  1FKF A;  2JXW A;  4DRJ A;  2DWV A;  4HAR A;  4MNJ A;  4R0X A;  1FKD A;  1HKI A;  5DEZ A;  1H0G A;  2L4J A;  2PV3 A;  1W9P A;  2KR7 A;  3O5M A;  4Z2K A;  2YSH A;  3UQA A;  1FKS A;  4Q7N A;  1W1T A;  4Z2H A;  3RM9 A;  4ODR A;  2DT2 A;  3JYM A;  3MDY B;  5DF0 A;  1F40 A;  4L72 B;  2RQS A;  3ALF A;  4DRK A;  3O5Q A;  4DWS B;  1RD6 A;  4GLX A;  5HWC A;  1KT0 A;  2IF4 A;  2AWG A;  3UI6 A;  1NWT A;  1A7X A;  2MLX A;  1ROT A;  3PQH A;  3ARQ A;  2PI6 A;  1UR9 A;  2DT3 A;  4IT4 A;  1HKM A;  3IHZ A;  1UR8 A;  2DJY A;  1FAP A;  1FKL A;  4W5U A;  5HUA A;  1GPF A;  5JH8 A;  4IPX A;  3RME A;  1W1P A;  4JFK A;  3PRA A;  1F8A B;  1SR0 A;  1EHN A;  1FLC A;  4DRI A;  1XRV A;  1HJV A;  2M8J A;  4IQC A;  3FY1 A;  4LAX A;  1NWU A;  5BXJ A;  3ARW A;  3QOK A;  2RSE A;  2XP7 A;  2RE3 A;  1VF8 A;  4DRO A;  1D2K A;  1W1V A;  2ESC A;  3FAP A;  5HTG A;  3M7N A;  1NWR A;  2PPP A;  1J4R A;  1O6I A;  1C9H A;  4W9O A;  3WD1 A;  1LL6 A;  2Y78 A;  2VCD A;  3FS8 A;  4DRQ A;  2LAJ A;  4HBE A;  5HT1 A;  2PPO A;  3JYJ A;  3WD2 A;  4WKF A;  2PV2 A;  3G6M A;  1RP5 A;  3H9R B;  3O5J A;  2WK2 A;  2KO7 A;  2K8I A;  4DRM A;  4QIB A;  2DK1 A;  1LL7 A;  3CGN A;  4C02 B;  2JMF A;  1KFW A;  2B31 A;  4WK9 A;  4Z2G A;  2FAP A;  4ODL A;  3UI5 A;  4ZS6 A;  2VN1 A;  5HBF A;  2DG4 A;  3MCB B;  3ALG A;  1JNS A;  1W9U A;  4TNS A;  1ITX A;  2YBU A;  1WR7 A;  1QPL A;  2RUQ A;  2E45 A;  2KE0 A;  5DIU A;  5GQB A;  1ZBC A;  3CZ8 A;  1ZBK A;  2JX8 A;  4U84 A;  2LGO A;  4DRH A;  1QPF A;  2F2D A;  3O5G A;  5E65 A;  4HBO A;  1W9V A;  3OOB A;  1HJW A;  2A3B A;  1E9L A;  2DSZ A;  4QT2 A;  3NTP A;  3FSB A;  1D7H A;  2RUC A;  4LAY A;  4Q22 A;  1HJX A;  4ZPW R;  3W4R A;  3KAC A;  2MNT A;  4Z2J A;  3FSC A;  4MGV A;  2QRV A;  4TW7 A;  2L2S A;  2DPE A;  3RGC A;  1PIN A;  4JYS A;  4QT3 A;  5AHT A;  3O5L A;  1H0I A;  4ODP A;  4QZV B;  4BF8 A;  3NI6 A;  1L1P A;  1JNT A;  2M08 A;  1LG2 A;  1GUV A;  2DT1 A;  2MLY A;  3AS2 A;  3CHD A;  5HW8 A;  5GPG A;  1JNE A;  3CHE A;  1EQ3 A;  5B8I C;  2O92 A;  1B6C A;  4G50 A;  1CTN A;  3O5P A;  1ZBV A;  2ZR5 A;  3KAD A;  4DH0 A;  3AQU A;  2ZQT A;  1FKJ A;  4KR0 B;  2F4E A;  1J6Y A;  4ODQ A;  1Q6I A;  4WIW A;  1P5Q A;  2IUZ A;  1K9R A;  3WKZ A;  1OWQ A;  4G2P A;  3WL0 A;  2ZAJ A;  1R9H A;  1NSG A;  3CH9 A;  4MAV A;  4TW6 A;  5DIT A;  1NH6 A;  3MQG A;  5E66 A;  4ZPT R;  1W26 A;  4DWS A;  2N87 A;  4R5E A;  4L3N A;  5D75 A;  1ZB5 A;  4LGX A;  3TDB A;  1Q6H A;  2Y8N B;  5HWB A;  4ODN A;  1FKR A;  1M5Y A;  1ZBW A;  3VAW A;  5HW7 A;  2WAE A;  4IT6 A;  2ZR4 A;  1ZCN A;  1FKG A;  1FKK A;  1N1A A;  3B9E A;  4W9P A;  1WAW A;  3ARY A;  1FFR A;  1LL4 A;  4TW8 A;  2MDI A;  1HKK A;  5E64 A;  3CNG A;  1TCO C;  1Q1C A;  2PV1 A;  3O5K A;  1U79 A;  2YSG A;  3ARO A;  2MLZ A;  4P8X A;  1JVW A;  5GPR A;  2WLY A;  1T11 A;  4ODM A;  4ITZ A;  4DWS C;  3LKX B;  1FKB A;  3AS3 A;  1E6P A;  1WB0 A;  1NMV A;  4KQZ A;  4NNR A;  2KI3 A;  4P8W A;  4N19 A;  1I5H W;  4JFM A;  2WLZ A;  2XP3 A;  4DZ3 A;  4GGQ A;  3ARR A;  3O5O A;  4DRN A;  3ARS A;  2UZ5 A;  1XHG A;  2XPA A;  2OWO A;  2YSF A;  1JMQ A;  1J4I A;  3BXW A;  3MQH A;  1OGG A;  2XPB A;  2EZ5 W;  5E62 A;  3AS0 A;  5HKG A;  2WAD A;  4S3K A;  4LAW A;  4MTV A;  3TCZ A;  4DRP A;  1D7I A;  1NMW A;  2O9O A;  2DG3 A;  1YW5 A;  4FN2 A;  2F21 A;  1FKI A;  3RM4 A;  1OGB A;  2XP5 A;  3O5D A;  2YAJ B;  4MNM A;  4MNL A;  2D9F A;  1D6O A;  3RM8 A;  2ITK A;  4W9Q A;  1Q6U A;  3LE4 A;  4U85 A;  2PPN A;  3MCB A;  3UF8 A;  2FDM A;  1X6L A;  2PBC A;  2M1I A;  2KGJ A;  3WD3 A;  4DIP A;  2Q5A A;  3RFW A;  3B8S A;  4DT4 A;  2ZQV A;  2ZR6 A;  1D7J A;  3UI4 A;  1E6R A;  1E6N A;  2DSV A;  4A0T A;  1EYM A;  3NRK A;  3WH0 A;  2XP8 A;  2M8I A;  1PBK A;  1X6N A;  3PR9 A;  3KAG A;  4P8V A;  1K9Q A;  4JFL A;  1ZU8 A;  3TC5 A;  1TK7 A;  1TFV A;  1ROU A;  1O6W A;  4Z2L A;  1GOI A;  4URI A;  2DSW A;  2RUR A;  2RUD A;  4Z2I A;  4A0U A;  2G8Z A;  1ZK6 A;  3KAH A;  2XP4 A;  2A3E A;  4MPK A;  2YSB A;  5DIV A;  1HXV A;  4WJX A;  3KAB A;  1K9T A;  4DZ2 A;  1FKT A;  1FJD A;  4WKA A;  4PTM A;  2DG9 A;  1EDQ A;  1BKF A;  2KFW A;  2WM0 A;  3L4H A;  3WL1 A;  2JZV A;  2A3C A;  4MSP A;  3WQV A;  4MNK A;  1EIB A;  1FKH A;  2QF8 A;  2FKE A;  2LJ4 A;  2ZQU A;  2KXQ A;  1FD9 A;  3ARZ A;  3ODK A;  2JV4 A;  4REX A;  1JND A;  4ODK A;  3PA7 A;  5CQ2 A;  1ZL1 A;  2LKN A;  4LAV A;  3WD0 A;  3UQB A;  4ML4 A;  2BA1 A;  3M85 A;  2YBT A;  2M2A A;  3IKD A;  3ART A;  1E6Z A;  3UQI A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...