2Q5AA

Human pin1 bound to l-peptide
Total Genus 46
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
46
sequence length
157
structure length
145
Chain Sequence
b'LPPGWEKAMSRSSGRVYYFNHITNASQWERPSEPARVRCSHLLVKHSQSRRPSSWRQEKITRTKEEALELINGYIQKIKSGEEDFESLASQFSDCSSAKARGDLGAFSRGQMQKPFEDASFALRTGEMSGPVFTDSGIHIILRTE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Peptidyl-prolyl cis-trans isomerase NIMA-interacting 1
publication title Structural basis for high-affinity peptide inhibition of human Pin1.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Isomerase/isomerase inhibitor
total genus 46
structure length 145
sequence length 157
ec nomenclature ec 5.2.1.8: Peptidylprolyl isomerase.
pdb deposition date 2007-05-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00397 WW WW domain
A PF00639 Rotamase PPIC-type PPIASE domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.20.70.10 Mainly Beta Single Sheet Ubiquitin Ligase Nedd4; Chain: W; Ubiquitin Ligase Nedd4; Chain: W; 2q5aA01
3.10.50.40 Alpha Beta Roll Chitinase A; domain 3 Chitinase A; domain 3 2q5aA02
3FAPA 2DJYA 4JYSA 2VN1A 1TK7A 1ZK6A 4NNRA 1QZ2A 2LPVA 4JFKA 1FAPA 2MF9A 1ROUA 3IK8A 4MGVA 2DG4A 2YSGA 1Q6IA 3KAHA 2ZAJA 4J4NA 4G50A 2F21A 1O6WA 2MLZA 4DZ2A 3LUOA 1JMQA 2DWVA 3KAGA 2M3OW 3O5IA 3KABA 4DRKA 2M2AA 5DITA 2XP6A 1QPLA 4FN2A 3UQBA 2JX8A 2M08A 1WMVA 2M1IA 3O5OA 3MDYB 1Q6UA 1WR7A 2K8IA 3VAWA 3WH0A 1D7HA 2IF4A 3KACA 2DMVA 1HXVA 2KFWA 2PPNA 2ZR5A 2RQSA 3O5EA 4BF8A 1YW5A 4DRPA 2ZQVA 2XP9A 2DG9A 2XP5A 1FKSA 1J4HA 4DIPA 3KCEA 2LJ4A 1YATA 1Q6HA 2RE3A 3IHZA 3KZ7A 2MPHA 2E45A 4DRIA 2MDIA 2ZR4A 3LE4A 4TNSA 1A7XA 4N19A 3O5MA 4TX0A 4DRHA 1EYMA 2JXWA 4JFMA 2OFNA 3CGNA 2Y78A 1FKFA 2Q5AA 2XPBA 3PRBA 2YSBA 4LAYA 1ROTA 1D7IA 2N87A 5DIVA 3RGCA 5HWCA 4TW8A 1Y0OA 4ODMA 2JZVA 2YSHA 4C02B 1FKGA 3UI5A 1I5HW 3UI6A 4W9OA 2L2SA 1FD9A 4ITZA 4LAXA 3JXVA 4REXA 2XP3A 2RURA 1PBKA 2F2DA 2KO7A 2PPOA 1J4IA 3GPKA 1P5QA 4DRNA 4DZ3A 4O2TA 1FKTA 2FKEA 2KI3A 4ODQA 1JNTA 2ZQTA 2XP8A 4QT2A 4ODPA 4TW6A 1FKLA 2PV2A 4MSPA 4G2PA 3O5GA 3UQIA 4DRQA 3CGMA 2RUCA 1FKBA 5HW6A 3TDBA 2KR7A 4GGQA 1U79A 5GPGA 2L4JA 4ODOA 5AHTA 4TW7A 4QIBA 2XP7A 5BXJA 3KAFA 3JYMA 5HW7A 4DRJA 2LAJA 2MLYA 2KE0A 1L1PA 3O5LA 1EG4A 3UQAA 2F4EA 2YSIA 2JV4A 2MNTA 2PBCA 4IPXA 3M7NA 1T11A 2XPAA 2XP4A 4JFLA 5HUAA 1TCOC 1D7JA 1FKDA 3NI6A 1F8AB 1NMVA 1FKRA 5CQ2A 3TC5A 4IQCA 1M5YA 2FAPA 3H9RB 1FKHA 1FJDA 4W9QA 4LAVA 5HTGA 3I6CA 2ZR6A 2D9FA 1BKFA 1KT1A 3IKDA 3O5FA 2PPPA 2VCDA 1Q1CA 3O5PA 3O5RA 2AWGA 5HW8A 3O5QA 2RUDA 4U84A 1NSGA 3CNGA 1QPFA 2DK7A 3PRDA 1W26A 4ODKA 3O5JA 3KAIA 4TYOA 2RUQA 3ODKA 4R0XA 4ODNA 2MLXA 1FKJA 2ZQSA 5HT1A 4E5RA 4JFIA 3RFWA 1F40A 5J6EA 1BL4A 1C9HA 5B8IC 2EZ5W 5HWBA 2KXQA 1NMWA 3UF8A 1KT0A 3KADA 3NTPA 4LAWA 3TCZA 1J6YA 1J4RA 1EQ3A 3B7XA 2RSEA 1R9HA 3UI4A 4QT3A 4JFJA 2PV3A 4U86A 2UZ5A 2DG3A 4J4OA 4W9PA 5DIUA 2JMFA 2LGOA 3L4HA 1N1AA 4GIVA 5HKGA 1K9RA 4DH0A 3EY6A 2YSFA 5I98A 3JYJA 4U85A 2M8IA 1FKIA 2PV1A 2ITKA 4DROA 2ZQUA 1ZCNA 4DRMA 3O5DA 1JNSA 4FAPA 3OOBA 2BA1A 1D6OA 1B6CA 1EG3A 3M85A 2KGJA 3PA7A 2DK1A 1K9QA 1JVWA 3IKGA 2M8JA 3NRKA 4ODRA 4ODLA 3O5KA 1FKKA 4IQ2A 4DT4A 5D75A 1PINA 2LKNA
chains in the Genus database with same CATH superfamily
3FAPA 3QOKA 2OLHA 4WKAA 2DJYA 4JYSA 2VN1A 1TK7A 1ZK6A 1ZBKA 1JNEA 4NNRA 1QZ2A 1UR9A 2LPVA 4JFKA 4NSBA 1LL4A 1FAPA 1W1PA 1W9PA 2MF9A 1LL6A 1ROUA 3IK8A 4MGVA 2DG4A 2YSGA 1Q6IA 1UR8A 3WQWA 5DO2A 4GLXA 4Z2HA 3WQVA 3ARTA 3PRAA 1GRJA 2ESCA 1HKJA 5DF0A 3KAHA 4WIWA 1OWQA 2ZAJA 4J4NA 3CZ8A 4G50A 1LG1A 2F21A 1O6WA 2MLZA 4DZ2A 3LUOA 1JMQA 2DWVA 3B9AA 3KAGA 3CHEA 3LKXB 1NWRA 2M3OW 2DT3A 3O5IA 3KABA 4HBEA 2AOSA 2DT0A 4DWSD 4DRKA 3FY1A 2M2AA 5DITA 3CHFA 2XP6A 1ZU8A 1QPLA 2QRVA 4FN2A 3UQBA 2JX8A 3OA5A 2M08A 3MCBA 1WMVA 1LJYA 2M1IA 3O5OA 3MDYB 1Q6UA 4A0TA 1WR7A 5HBFA 1W1YA 2K8IA 3VAWA 3WH0A 1D7HA 5E5WA 1RP5A 2A3BA 2IF4A 3KACA 2P4VA 4P8UA 2DMVA 3WD3A 2KFWA 1HXVA 2PPNA 1GUVA 2ZR5A 2RQSA 3ARSA 3O5EA 4BF8A 1H0IA 4S3KA 1YW5A 1WB0A 4DRPA 2ZQVA 1JCHB 2XP9A 2DG9A 2XP5A 1E15A 1FKSA 1J4HA 1E6NA 4DIPA 3KCEA 4P8WA 3G6LA 2LJ4A 1HKMA 1YATA 1Q6HA 2RE3A 3FSCA 3IHZA 3KZ7A 3ARRA 1W9UA 2WLZA 4MAVA 2MPHA 4DWSA 3W4RA 1ZL1A 3WL1A 3BXWA 2E45A 4DRIA 2MDIA 2ZR4A 2EULA 5E64A 3LE4A 3B9EA 1TFVA 4IT4A 2B31A 4TNSA 2A3CA 3AROA 3WD1A 1A7XA 4N19A 4ZPWR 3O5MA 4TX0A 4DRHA 1EYMA 2JXWA 4JFMA 2OFNA 3CGNA 2Y78A 2DSWA 2F23A 1FKFA 2Q5AA 2XPBA 3PRBA 4WJXA 4Z2IA 4NZCA 2YSBA 4LAYA 1ROTA 1D7IA 2N87A 5DIVA 1IX5A 3RGCA 1VF8A 1X6NA 5HWCA 4TW8A 1Y0OA 1E44A 1SYTA 4ODMA 2O9OA 4MNMA 2JZVA 2YSHA 4R5EA 4C02B 1FKGA 1HKKA 3AS2A 3UI5A 1I5HW 3ARXA 3UI6A 2DSUA 3GTYX 4W9OA 1W1TA 2L2SA 1ZBWA 1FD9A 4Z2GA 4KQZA 1E6RA 2FDMA 4Q22A 4ITZA 4LAXA 2DT2A 4A0UA 3JXVA 4REXA 2XP3A 2RURA 1PBKA 2PN0A 5E62A 1LL7A 2B5UB 2F2DA 3LKXA 4HARA 3MQGA 2KO7A 2PPOA 1J4IA 3GPKA 1P5QA 3CH9A 3AS3A 4DRNA 1EHNA 4MNKA 4DZ3A 3RMEA 1GPFA 4O2TA 1FKTA 2FKEA 2KI3A 4P8XA 4WKFA 4ODQA 5GQBA 4Z2LA 2DT1A 1JNTA 2ZQTA 1NH6A 3AQUA 4P8VA 3ARWA 2XP8A 4QT2A 3AS1A 4ODPA 2WLYA 4TW6A 3RM9A 1FKLA 2PV2A 4MSPA 1ZBVA 2O92A 4W5UA 4G2PA 3O5GA 3UQIA 1D2KA 2G41A 2DSVA 4DRQA 1NWTA 3CGMA 3RM8A 2RUCA 4URIA 1NWSA 1FKBA 4QZVB 5HW6A 3TDBA 3PQHA 2KR7A 3G6MA 4GGQA 1U79A 5E65A 5GPGA 2L4JA 4ML4A 1FFQA 5AHTA 4ODOA 4TW7A 4QIBA 2XP7A 1RD6A 5BXJA 3KAFA 3JYMA 5HW7A 4DRJA 4AY1A 2LAJA 4MNLA 2MLYA 2KE0A 1L1PA 3O5LA 1EG4A 3WD4A 1LQ0A 3UQAA 2F4EA 1TR8A 2YSIA 2JV4A 2MNTA 2PBCA 4IPXA 3GU0A 2YBUA 3M7NA 3AS0A 1T11A 2XPAA 2XP4A 4JFLA 5HUAA 4ZPVR 1TCOC 3PR9A 1HKIA 3WIJA 1D7JA 1FKDA 2YBTA 3ARZA 3ALFA 3NI6A 2YAJB 1F8AB 1OGBA 1ZBCA 4L3NA 1NMVA 1FKRA 4Z2JA 5CQ2A 3TC5A 1X6LA 1HJWA 5E66A 4IQCA 4MPKA 3CHCA 1M5YA 2FAPA 1ZB5A 1CTNA 3ALGA 3H9RB 1FKHA 5JH8A 2WM0A 1FJDA 4W9QA 1HJXA 4LAVA 2QF8A 5HTGA 3RM4A 4KR0B 3I6CA 1E6PA 2ZR6A 5DEZA 1WNOA 1BKFA 2D9FA 3B9DA 2A3AA 1KT1A 3IKDA 2DSZA 3O5FA 1GOIA 2PPPA 2VCDA 1K9TA 1Q1CA 3O5PA 3O5RA 2AWGA 5HW8A 1FFRA 3O5QA 2RUDA 4U84A 2A3EA 1NSGA 3CNGA 1QPFA 2DK7A 1XHGA 1W26A 3ARPA 3ARQA 3BMBA 3O5JA 3PRDA 4ODKA 3KAIA 4TYOA 2RUQA 3ODKA 2WK2A 4R0XA 2WADA 4ODNA 2MLXA 1SR0A 4ZS6A 2OWOA 1FKJA 3CHDA 1HJVA 4MTVA 2ZQSA 3MQHA 5HT1A 3FSBA 2WAEA 4E5RA 4LGXA 1O6IA 4JFIA 3RFWA 1F40A 5J6EA 1BL4A 1EDQA 1C9HA 5B8IC 2EZ5W 5HWBA 4PTMA 4DWSC 2KXQA 3WKZA 3B8SA 2ETNA 1E6ZA 1NMWA 3UF8A 3EIPA 3WD2A 1KT0A 5GPRA 3KADA 3NTPA 1OGGA 4LAWA 3TCZA 1J6YA 1J4RA 1EQ3A 3B7XA 1WAWA 2RSEA 1R9HA 3ARYA 4WK9A 4S3JA 3ARUA 3UI4A 4QT3A 3MCBB 1KFWA 5U47A 4JFJA 3WL0A 2PV3A 1EIBA 4U86A 4HBOA 2UZ5A 2DG3A 1ITXA 4J4OA 4W9PA 5DIUA 4UDMA 2JMFA 2LGOA 3L4HA 1N1AA 4GIVA 1H0GA 1W1VA 4WKHA 5HKGA 4IT6A 2G8ZA 1K9RA 1JNDA 2IUZA 2YSFA 3EY6A 4DH0A 3WD0A 5I98A 3JYJA 4U85A 2M8IA 1FKIA 2PV1A 2ITKA 4Q7NA 2PI6A 4DROA 3FXYA 2ZQUA 4ZPTR 1ZCNA 2Y8NB 4Z2KA 4DRMA 1LG2A 3O5DA 1JNSA 1XRVA 4DWSB 4FAPA 3OOBA 4XAKA 3FS8A 4MNJA 2BA1A 2DPEA 1D6OA 1B6CA 1EG3A 2KGJA 3M85A 2DK1A 1K9QA 3IKGA 1JVWA 3NRKA 2M8JA 3PA7A 4L72B 4ODRA 4ODLA 1W9VA 1FKKA 3O5KA 4IQ2A 4DT4A 1NWUA 5D75A 1E9LA 3ARVA 1FLCA 1PINA 2LKNA
chains in the Genus database with same CATH topology
3FAPA 3QOKA 2OLHA 4WKAA 2DJYA 4JYSA 2VN1A 1TK7A 1ZK6A 1ZBKA 1JNEA 4NNRA 1QZ2A 1UR9A 2LPVA 4JFKA 4NSBA 1LL4A 1FAPA 1W1PA 1W9PA 2MF9A 1LL6A 1ROUA 3IK8A 4MGVA 2DG4A 2YSGA 1Q6IA 1UR8A 3WQWA 5DO2A 4GLXA 4Z2HA 3WQVA 3ARTA 3PRAA 2ESCA 1HKJA 5DF0A 3KAHA 4WIWA 1OWQA 2ZAJA 4J4NA 3CZ8A 4G50A 1LG1A 2F21A 1O6WA 2MLZA 4DZ2A 3LUOA 1JMQA 2DWVA 3B9AA 3KAGA 3CHEA 3LKXB 1NWRA 2M3OW 2DT3A 3O5IA 3KABA 4HBEA 2AOSA 2DT0A 4DWSD 4DRKA 3FY1A 2M2AA 5DITA 3CHFA 2XP6A 1ZU8A 1QPLA 2QRVA 4FN2A 3UQBA 2JX8A 3OA5A 2M08A 3MCBA 1WMVA 1LJYA 2M1IA 3O5OA 3MDYB 1Q6UA 4A0TA 1WR7A 5HBFA 1W1YA 2K8IA 3VAWA 3WH0A 1D7HA 5E5WA 1RP5A 2A3BA 2IF4A 3KACA 4P8UA 2DMVA 3WD3A 2KFWA 1HXVA 2PPNA 1GUVA 2ZR5A 2RQSA 3ARSA 3O5EA 4BF8A 1H0IA 4S3KA 1YW5A 1WB0A 4DRPA 2ZQVA 2XP9A 2DG9A 2XP5A 1E15A 1FKSA 1J4HA 1E6NA 4DIPA 3KCEA 4P8WA 3G6LA 2LJ4A 1HKMA 1YATA 1Q6HA 2RE3A 3FSCA 3IHZA 3KZ7A 3ARRA 1W9UA 2WLZA 4MAVA 2MPHA 4DWSA 3W4RA 1ZL1A 3WL1A 3BXWA 2E45A 4DRIA 2MDIA 2ZR4A 5E64A 3LE4A 3B9EA 1TFVA 4IT4A 2B31A 4TNSA 2A3CA 3AROA 3WD1A 1A7XA 4N19A 4ZPWR 3O5MA 4TX0A 4DRHA 1EYMA 2JXWA 4JFMA 2OFNA 3CGNA 2Y78A 2DSWA 1FKFA 2Q5AA 2XPBA 3PRBA 4WJXA 4Z2IA 4NZCA 2YSBA 4LAYA 1ROTA 1D7IA 2N87A 5DIVA 1IX5A 3RGCA 1VF8A 1X6NA 5HWCA 4TW8A 1Y0OA 1SYTA 4ODMA 2O9OA 4MNMA 2JZVA 2YSHA 4R5EA 4C02B 1FKGA 1HKKA 3AS2A 3UI5A 1I5HW 3ARXA 3UI6A 2DSUA 4W9OA 1W1TA 2L2SA 1ZBWA 1FD9A 4Z2GA 4KQZA 1E6RA 2FDMA 4Q22A 4ITZA 4LAXA 2DT2A 4A0UA 3JXVA 4REXA 2XP3A 2RURA 1PBKA 5E62A 1LL7A 2F2DA 3LKXA 4HARA 3MQGA 2KO7A 2PPOA 1J4IA 3GPKA 1P5QA 3CH9A 3AS3A 4DRNA 1EHNA 4MNKA 4DZ3A 3RMEA 1GPFA 4O2TA 1FKTA 2FKEA 2KI3A 4P8XA 4WKFA 4ODQA 5GQBA 4Z2LA 2DT1A 1JNTA 2ZQTA 1NH6A 3AQUA 4P8VA 3ARWA 2XP8A 4QT2A 3AS1A 4ODPA 2WLYA 4TW6A 3RM9A 1FKLA 2PV2A 4MSPA 1ZBVA 2O92A 4W5UA 4G2PA 3O5GA 3UQIA 1D2KA 2G41A 2DSVA 4DRQA 1NWTA 3CGMA 3RM8A 2RUCA 4URIA 1NWSA 1FKBA 4QZVB 5HW6A 3TDBA 3PQHA 2KR7A 3G6MA 4GGQA 1U79A 5E65A 5GPGA 2L4JA 4ML4A 1FFQA 5AHTA 4ODOA 4TW7A 4QIBA 2XP7A 1RD6A 5BXJA 3KAFA 3JYMA 5HW7A 4DRJA 4AY1A 2LAJA 4MNLA 2MLYA 2KE0A 1L1PA 3O5LA 1EG4A 3WD4A 1LQ0A 3UQAA 2F4EA 1TR8A 2YSIA 2JV4A 2MNTA 2PBCA 4IPXA 2YBUA 3M7NA 3AS0A 1T11A 2XPAA 2XP4A 4JFLA 5HUAA 4ZPVR 1TCOC 3PR9A 1HKIA 3WIJA 1D7JA 1FKDA 2YBTA 3ARZA 3ALFA 3NI6A 2YAJB 1F8AB 1OGBA 1ZBCA 4L3NA 1NMVA 1FKRA 4Z2JA 5CQ2A 3TC5A 1X6LA 1HJWA 5E66A 4IQCA 4MPKA 3CHCA 1M5YA 2FAPA 1ZB5A 1CTNA 3ALGA 3H9RB 1FKHA 5JH8A 2WM0A 1FJDA 4W9QA 1HJXA 4LAVA 2QF8A 5HTGA 3RM4A 4KR0B 3I6CA 1E6PA 2ZR6A 5DEZA 1WNOA 1BKFA 2D9FA 3B9DA 2A3AA 1KT1A 3IKDA 2DSZA 3O5FA 1GOIA 2PPPA 2VCDA 1K9TA 1Q1CA 3O5PA 3O5RA 2AWGA 5HW8A 1FFRA 3O5QA 2RUDA 4U84A 2A3EA 1NSGA 3CNGA 1QPFA 2DK7A 1XHGA 1W26A 3ARPA 3ARQA 3O5JA 3PRDA 4ODKA 3KAIA 4TYOA 2RUQA 3ODKA 2WK2A 4R0XA 2WADA 4ODNA 2MLXA 1SR0A 4ZS6A 2OWOA 1FKJA 3CHDA 1HJVA 4MTVA 2ZQSA 3MQHA 5HT1A 3FSBA 2WAEA 4E5RA 4LGXA 1O6IA 4JFIA 3RFWA 1F40A 5J6EA 1BL4A 1EDQA 1C9HA 5B8IC 2EZ5W 5HWBA 4PTMA 4DWSC 2KXQA 3WKZA 3B8SA 1E6ZA 1NMWA 3UF8A 3WD2A 1KT0A 5GPRA 3KADA 3NTPA 1OGGA 4LAWA 3TCZA 1J6YA 1J4RA 1EQ3A 3B7XA 1WAWA 2RSEA 1R9HA 3ARYA 4WK9A 4S3JA 3ARUA 3UI4A 4QT3A 3MCBB 1KFWA 5U47A 4JFJA 3WL0A 2PV3A 1EIBA 4U86A 4HBOA 2UZ5A 2DG3A 1ITXA 4J4OA 4W9PA 5DIUA 2JMFA 2LGOA 3L4HA 1N1AA 4GIVA 1H0GA 1W1VA 4WKHA 5HKGA 4IT6A 2G8ZA 1K9RA 1JNDA 2IUZA 2YSFA 3EY6A 4DH0A 3WD0A 5I98A 3JYJA 4U85A 2M8IA 2PV1A 1FKIA 2ITKA 4Q7NA 2PI6A 4DROA 3FXYA 2ZQUA 4ZPTR 1ZCNA 2Y8NB 4Z2KA 4DRMA 1LG2A 3O5DA 1JNSA 1XRVA 4DWSB 4FAPA 3OOBA 4XAKA 3FS8A 4MNJA 2BA1A 2DPEA 1D6OA 1B6CA 1EG3A 2KGJA 3M85A 2DK1A 1K9QA 3IKGA 1JVWA 3NRKA 2M8JA 3PA7A 4L72B 4ODRA 4ODLA 1W9VA 1FKKA 3O5KA 4IQ2A 4DT4A 1NWUA 5D75A 1E9LA 3ARVA 1FLCA 1PINA 2LKNA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3FAP A;  2DJY A;  4JYS A;  2VN1 A;  1TK7 A;  1ZK6 A;  4NNR A;  1QZ2 A;  2LPV A;  4JFK A;  1FAP A;  2MF9 A;  1ROU A;  3IK8 A;  4MGV A;  2DG4 A;  2YSG A;  1Q6I A;  3KAH A;  2ZAJ A;  4J4N A;  4G50 A;  2F21 A;  1O6W A;  2MLZ A;  4DZ2 A;  3LUO A;  1JMQ A;  2DWV A;  3KAG A;  2M3O W;  3O5I A;  3KAB A;  4DRK A;  2M2A A;  5DIT A;  2XP6 A;  1QPL A;  4FN2 A;  3UQB A;  2JX8 A;  2M08 A;  1WMV A;  2M1I A;  3O5O A;  3MDY B;  1Q6U A;  1WR7 A;  2K8I A;  3VAW A;  3WH0 A;  1D7H A;  2IF4 A;  3KAC A;  2DMV A;  1HXV A;  2KFW A;  2PPN A;  2ZR5 A;  2RQS A;  3O5E A;  4BF8 A;  1YW5 A;  4DRP A;  2ZQV A;  2XP9 A;  2DG9 A;  2XP5 A;  1FKS A;  1J4H A;  4DIP A;  3KCE A;  2LJ4 A;  1YAT A;  1Q6H A;  2RE3 A;  3IHZ A;  3KZ7 A;  2MPH A;  2E45 A;  4DRI A;  2MDI A;  2ZR4 A;  3LE4 A;  4TNS A;  1A7X A;  4N19 A;  3O5M A;  4TX0 A;  4DRH A;  1EYM A;  2JXW A;  4JFM A;  2OFN A;  3CGN A;  2Y78 A;  1FKF A;  2Q5A A;  2XPB A;  3PRB A;  2YSB A;  4LAY A;  1ROT A;  1D7I A;  2N87 A;  5DIV A;  3RGC A;  5HWC A;  4TW8 A;  1Y0O A;  4ODM A;  2JZV A;  2YSH A;  4C02 B;  1FKG A;  3UI5 A;  1I5H W;  3UI6 A;  4W9O A;  2L2S A;  1FD9 A;  4ITZ A;  4LAX A;  3JXV A;  4REX A;  2XP3 A;  2RUR A;  1PBK A;  2F2D A;  2KO7 A;  2PPO A;  1J4I A;  3GPK A;  1P5Q A;  4DRN A;  4DZ3 A;  4O2T A;  1FKT A;  2FKE A;  2KI3 A;  4ODQ A;  1JNT A;  2ZQT A;  2XP8 A;  4QT2 A;  4ODP A;  4TW6 A;  1FKL A;  2PV2 A;  4MSP A;  4G2P A;  3O5G A;  3UQI A;  4DRQ A;  3CGM A;  2RUC A;  1FKB A;  5HW6 A;  3TDB A;  2KR7 A;  4GGQ A;  1U79 A;  5GPG A;  2L4J A;  4ODO A;  5AHT A;  4TW7 A;  4QIB A;  2XP7 A;  5BXJ A;  3KAF A;  3JYM A;  5HW7 A;  4DRJ A;  2LAJ A;  2MLY A;  2KE0 A;  1L1P A;  3O5L A;  1EG4 A;  3UQA A;  2F4E A;  2YSI A;  2JV4 A;  2MNT A;  2PBC A;  4IPX A;  3M7N A;  1T11 A;  2XPA A;  2XP4 A;  4JFL A;  5HUA A;  1TCO C;  1D7J A;  1FKD A;  3NI6 A;  1F8A B;  1NMV A;  1FKR A;  5CQ2 A;  3TC5 A;  4IQC A;  1M5Y A;  2FAP A;  3H9R B;  1FKH A;  1FJD A;  4W9Q A;  4LAV A;  5HTG A;  3I6C A;  2ZR6 A;  2D9F A;  1BKF A;  1KT1 A;  3IKD A;  3O5F A;  2PPP A;  2VCD A;  1Q1C A;  3O5P A;  3O5R A;  2AWG A;  5HW8 A;  3O5Q A;  2RUD A;  4U84 A;  1NSG A;  3CNG A;  1QPF A;  2DK7 A;  3PRD A;  1W26 A;  4ODK A;  3O5J A;  3KAI A;  4TYO A;  2RUQ A;  3ODK A;  4R0X A;  4ODN A;  2MLX A;  1FKJ A;  2ZQS A;  5HT1 A;  4E5R A;  4JFI A;  3RFW A;  1F40 A;  5J6E A;  1BL4 A;  1C9H A;  5B8I C;  2EZ5 W;  5HWB A;  2KXQ A;  1NMW A;  3UF8 A;  1KT0 A;  3KAD A;  3NTP A;  4LAW A;  3TCZ A;  1J6Y A;  1J4R A;  1EQ3 A;  3B7X A;  2RSE A;  1R9H A;  3UI4 A;  4QT3 A;  4JFJ A;  2PV3 A;  4U86 A;  2UZ5 A;  2DG3 A;  4J4O A;  4W9P A;  5DIU A;  2JMF A;  2LGO A;  3L4H A;  1N1A A;  4GIV A;  5HKG A;  1K9R A;  4DH0 A;  3EY6 A;  2YSF A;  5I98 A;  3JYJ A;  4U85 A;  2M8I A;  1FKI A;  2PV1 A;  2ITK A;  4DRO A;  2ZQU A;  1ZCN A;  4DRM A;  3O5D A;  1JNS A;  4FAP A;  3OOB A;  2BA1 A;  1D6O A;  1B6C A;  1EG3 A;  3M85 A;  2KGJ A;  3PA7 A;  2DK1 A;  1K9Q A;  1JVW A;  3IKG A;  2M8J A;  3NRK A;  4ODR A;  4ODL A;  3O5K A;  1FKK A;  4IQ2 A;  4DT4 A;  5D75 A;  1PIN A;  2LKN A; 
#chains in the Genus database with same CATH topology
 3FAP A;  3QOK A;  2OLH A;  4WKA A;  2DJY A;  4JYS A;  2VN1 A;  1TK7 A;  1ZK6 A;  1ZBK A;  1JNE A;  4NNR A;  1QZ2 A;  1UR9 A;  2LPV A;  4JFK A;  4NSB A;  1LL4 A;  1FAP A;  1W1P A;  1W9P A;  2MF9 A;  1LL6 A;  1ROU A;  3IK8 A;  4MGV A;  2DG4 A;  2YSG A;  1Q6I A;  1UR8 A;  3WQW A;  5DO2 A;  4GLX A;  4Z2H A;  3WQV A;  3ART A;  3PRA A;  1GRJ A;  2ESC A;  1HKJ A;  5DF0 A;  3KAH A;  4WIW A;  1OWQ A;  2ZAJ A;  4J4N A;  3CZ8 A;  4G50 A;  1LG1 A;  2F21 A;  1O6W A;  2MLZ A;  4DZ2 A;  3LUO A;  1JMQ A;  2DWV A;  3B9A A;  3KAG A;  3CHE A;  3LKX B;  1NWR A;  2M3O W;  2DT3 A;  3O5I A;  3KAB A;  4HBE A;  2AOS A;  2DT0 A;  4DWS D;  4DRK A;  3FY1 A;  2M2A A;  5DIT A;  3CHF A;  2XP6 A;  1ZU8 A;  1QPL A;  2QRV A;  4FN2 A;  3UQB A;  2JX8 A;  3OA5 A;  2M08 A;  3MCB A;  1WMV A;  1LJY A;  2M1I A;  3O5O A;  3MDY B;  1Q6U A;  4A0T A;  1WR7 A;  5HBF A;  1W1Y A;  2K8I A;  3VAW A;  3WH0 A;  1D7H A;  5E5W A;  1RP5 A;  2A3B A;  2IF4 A;  3KAC A;  2P4V A;  4P8U A;  2DMV A;  3WD3 A;  2KFW A;  1HXV A;  2PPN A;  1GUV A;  2ZR5 A;  2RQS A;  3ARS A;  3O5E A;  4BF8 A;  1H0I A;  4S3K A;  1YW5 A;  1WB0 A;  4DRP A;  2ZQV A;  1JCH B;  2XP9 A;  2DG9 A;  2XP5 A;  1E15 A;  1FKS A;  1J4H A;  1E6N A;  4DIP A;  3KCE A;  4P8W A;  3G6L A;  2LJ4 A;  1HKM A;  1YAT A;  1Q6H A;  2RE3 A;  3FSC A;  3IHZ A;  3KZ7 A;  3ARR A;  1W9U A;  2WLZ A;  4MAV A;  2MPH A;  4DWS A;  3W4R A;  1ZL1 A;  3WL1 A;  3BXW A;  2E45 A;  4DRI A;  2MDI A;  2ZR4 A;  2EUL A;  5E64 A;  3LE4 A;  3B9E A;  1TFV A;  4IT4 A;  2B31 A;  4TNS A;  2A3C A;  3ARO A;  3WD1 A;  1A7X A;  4N19 A;  4ZPW R;  3O5M A;  4TX0 A;  4DRH A;  1EYM A;  2JXW A;  4JFM A;  2OFN A;  3CGN A;  2Y78 A;  2DSW A;  2F23 A;  1FKF A;  2Q5A A;  2XPB A;  3PRB A;  4WJX A;  4Z2I A;  4NZC A;  2YSB A;  4LAY A;  1ROT A;  1D7I A;  2N87 A;  5DIV A;  1IX5 A;  3RGC A;  1VF8 A;  1X6N A;  5HWC A;  4TW8 A;  1Y0O A;  1E44 A;  1SYT A;  4ODM A;  2O9O A;  4MNM A;  2JZV A;  2YSH A;  4R5E A;  4C02 B;  1FKG A;  1HKK A;  3AS2 A;  3UI5 A;  1I5H W;  3ARX A;  3UI6 A;  2DSU A;  3GTY X;  4W9O A;  1W1T A;  2L2S A;  1ZBW A;  1FD9 A;  4Z2G A;  4KQZ A;  1E6R A;  2FDM A;  4Q22 A;  4ITZ A;  4LAX A;  2DT2 A;  4A0U A;  3JXV A;  4REX A;  2XP3 A;  2RUR A;  1PBK A;  2PN0 A;  5E62 A;  1LL7 A;  2B5U B;  2F2D A;  3LKX A;  4HAR A;  3MQG A;  2KO7 A;  2PPO A;  1J4I A;  3GPK A;  1P5Q A;  3CH9 A;  3AS3 A;  4DRN A;  1EHN A;  4MNK A;  4DZ3 A;  3RME A;  1GPF A;  4O2T A;  1FKT A;  2FKE A;  2KI3 A;  4P8X A;  4WKF A;  4ODQ A;  5GQB A;  4Z2L A;  2DT1 A;  1JNT A;  2ZQT A;  1NH6 A;  3AQU A;  4P8V A;  3ARW A;  2XP8 A;  4QT2 A;  3AS1 A;  4ODP A;  2WLY A;  4TW6 A;  3RM9 A;  1FKL A;  2PV2 A;  4MSP A;  1ZBV A;  2O92 A;  4W5U A;  4G2P A;  3O5G A;  3UQI A;  1D2K A;  2G41 A;  2DSV A;  4DRQ A;  1NWT A;  3CGM A;  3RM8 A;  2RUC A;  4URI A;  1NWS A;  1FKB A;  4QZV B;  5HW6 A;  3TDB A;  3PQH A;  2KR7 A;  3G6M A;  4GGQ A;  1U79 A;  5E65 A;  5GPG A;  2L4J A;  4ML4 A;  1FFQ A;  5AHT A;  4ODO A;  4TW7 A;  4QIB A;  2XP7 A;  1RD6 A;  5BXJ A;  3KAF A;  3JYM A;  5HW7 A;  4DRJ A;  4AY1 A;  2LAJ A;  4MNL A;  2MLY A;  2KE0 A;  1L1P A;  3O5L A;  1EG4 A;  3WD4 A;  1LQ0 A;  3UQA A;  2F4E A;  1TR8 A;  2YSI A;  2JV4 A;  2MNT A;  2PBC A;  4IPX A;  3GU0 A;  2YBU A;  3M7N A;  3AS0 A;  1T11 A;  2XPA A;  2XP4 A;  4JFL A;  5HUA A;  4ZPV R;  1TCO C;  3PR9 A;  1HKI A;  3WIJ A;  1D7J A;  1FKD A;  2YBT A;  3ARZ A;  3ALF A;  3NI6 A;  2YAJ B;  1F8A B;  1OGB A;  1ZBC A;  4L3N A;  1NMV A;  1FKR A;  4Z2J A;  5CQ2 A;  3TC5 A;  1X6L A;  1HJW A;  5E66 A;  4IQC A;  4MPK A;  3CHC A;  1M5Y A;  2FAP A;  1ZB5 A;  1CTN A;  3ALG A;  3H9R B;  1FKH A;  5JH8 A;  2WM0 A;  1FJD A;  4W9Q A;  1HJX A;  4LAV A;  2QF8 A;  5HTG A;  3RM4 A;  4KR0 B;  3I6C A;  1E6P A;  2ZR6 A;  5DEZ A;  1WNO A;  1BKF A;  2D9F A;  3B9D A;  2A3A A;  1KT1 A;  3IKD A;  2DSZ A;  3O5F A;  1GOI A;  2PPP A;  2VCD A;  1K9T A;  1Q1C A;  3O5P A;  3O5R A;  2AWG A;  5HW8 A;  1FFR A;  3O5Q A;  2RUD A;  4U84 A;  2A3E A;  1NSG A;  3CNG A;  1QPF A;  2DK7 A;  1XHG A;  1W26 A;  3ARP A;  3ARQ A;  3BMB A;  3O5J A;  3PRD A;  4ODK A;  3KAI A;  4TYO A;  2RUQ A;  3ODK A;  2WK2 A;  4R0X A;  2WAD A;  4ODN A;  2MLX A;  1SR0 A;  4ZS6 A;  2OWO A;  1FKJ A;  3CHD A;  1HJV A;  4MTV A;  2ZQS A;  3MQH A;  5HT1 A;  3FSB A;  2WAE A;  4E5R A;  4LGX A;  1O6I A;  4JFI A;  3RFW A;  1F40 A;  5J6E A;  1BL4 A;  1EDQ A;  1C9H A;  5B8I C;  2EZ5 W;  5HWB A;  4PTM A;  4DWS C;  2KXQ A;  3WKZ A;  3B8S A;  2ETN A;  1E6Z A;  1NMW A;  3UF8 A;  3EIP A;  3WD2 A;  1KT0 A;  5GPR A;  3KAD A;  3NTP A;  1OGG A;  4LAW A;  3TCZ A;  1J6Y A;  1J4R A;  1EQ3 A;  3B7X A;  1WAW A;  2RSE A;  1R9H A;  3ARY A;  4WK9 A;  4S3J A;  3ARU A;  3UI4 A;  4QT3 A;  3MCB B;  1KFW A;  5U47 A;  4JFJ A;  3WL0 A;  2PV3 A;  1EIB A;  4U86 A;  4HBO A;  2UZ5 A;  2DG3 A;  1ITX A;  4J4O A;  4W9P A;  5DIU A;  4UDM A;  2JMF A;  2LGO A;  3L4H A;  1N1A A;  4GIV A;  1H0G A;  1W1V A;  4WKH A;  5HKG A;  4IT6 A;  2G8Z A;  1K9R A;  1JND A;  2IUZ A;  2YSF A;  3EY6 A;  4DH0 A;  3WD0 A;  5I98 A;  3JYJ A;  4U85 A;  2M8I A;  1FKI A;  2PV1 A;  2ITK A;  4Q7N A;  2PI6 A;  4DRO A;  3FXY A;  2ZQU A;  4ZPT R;  1ZCN A;  2Y8N B;  4Z2K A;  4DRM A;  1LG2 A;  3O5D A;  1JNS A;  1XRV A;  4DWS B;  4FAP A;  3OOB A;  4XAK A;  3FS8 A;  4MNJ A;  2BA1 A;  2DPE A;  1D6O A;  1B6C A;  1EG3 A;  2KGJ A;  3M85 A;  2DK1 A;  1K9Q A;  3IKG A;  1JVW A;  3NRK A;  2M8J A;  3PA7 A;  4L72 B;  4ODR A;  4ODL A;  1W9V A;  1FKK A;  3O5K A;  4IQ2 A;  4DT4 A;  1NWU A;  5D75 A;  1E9L A;  3ARV A;  1FLC A;  1PIN A;  2LKN A; 
#chains in the Genus database with same CATH homology
 3FAP A;  3QOK A;  2OLH A;  4WKA A;  2DJY A;  4JYS A;  2VN1 A;  1TK7 A;  1ZK6 A;  1ZBK A;  1JNE A;  4NNR A;  1QZ2 A;  1UR9 A;  2LPV A;  4JFK A;  4NSB A;  1LL4 A;  1FAP A;  1W1P A;  1W9P A;  2MF9 A;  1LL6 A;  1ROU A;  3IK8 A;  4MGV A;  2DG4 A;  2YSG A;  1Q6I A;  1UR8 A;  3WQW A;  5DO2 A;  4GLX A;  4Z2H A;  3WQV A;  3ART A;  3PRA A;  2ESC A;  1HKJ A;  5DF0 A;  3KAH A;  4WIW A;  1OWQ A;  2ZAJ A;  4J4N A;  3CZ8 A;  4G50 A;  1LG1 A;  2F21 A;  1O6W A;  2MLZ A;  4DZ2 A;  3LUO A;  1JMQ A;  2DWV A;  3B9A A;  3KAG A;  3CHE A;  3LKX B;  1NWR A;  2M3O W;  2DT3 A;  3O5I A;  3KAB A;  4HBE A;  2AOS A;  2DT0 A;  4DWS D;  4DRK A;  3FY1 A;  2M2A A;  5DIT A;  3CHF A;  2XP6 A;  1ZU8 A;  1QPL A;  2QRV A;  4FN2 A;  3UQB A;  2JX8 A;  3OA5 A;  2M08 A;  3MCB A;  1WMV A;  1LJY A;  2M1I A;  3O5O A;  3MDY B;  1Q6U A;  4A0T A;  1WR7 A;  5HBF A;  1W1Y A;  2K8I A;  3VAW A;  3WH0 A;  1D7H A;  5E5W A;  1RP5 A;  2A3B A;  2IF4 A;  3KAC A;  4P8U A;  2DMV A;  3WD3 A;  2KFW A;  1HXV A;  2PPN A;  1GUV A;  2ZR5 A;  2RQS A;  3ARS A;  3O5E A;  4BF8 A;  1H0I A;  4S3K A;  1YW5 A;  1WB0 A;  4DRP A;  2ZQV A;  2XP9 A;  2DG9 A;  2XP5 A;  1E15 A;  1FKS A;  1J4H A;  1E6N A;  4DIP A;  3KCE A;  4P8W A;  3G6L A;  2LJ4 A;  1HKM A;  1YAT A;  1Q6H A;  2RE3 A;  3FSC A;  3IHZ A;  3KZ7 A;  3ARR A;  1W9U A;  2WLZ A;  4MAV A;  2MPH A;  4DWS A;  3W4R A;  1ZL1 A;  3WL1 A;  3BXW A;  2E45 A;  4DRI A;  2MDI A;  2ZR4 A;  5E64 A;  3LE4 A;  3B9E A;  1TFV A;  4IT4 A;  2B31 A;  4TNS A;  2A3C A;  3ARO A;  3WD1 A;  1A7X A;  4N19 A;  4ZPW R;  3O5M A;  4TX0 A;  4DRH A;  1EYM A;  2JXW A;  4JFM A;  2OFN A;  3CGN A;  2Y78 A;  2DSW A;  1FKF A;  2Q5A A;  2XPB A;  3PRB A;  4WJX A;  4Z2I A;  4NZC A;  2YSB A;  4LAY A;  1ROT A;  1D7I A;  2N87 A;  5DIV A;  1IX5 A;  3RGC A;  1VF8 A;  1X6N A;  5HWC A;  4TW8 A;  1Y0O A;  1SYT A;  4ODM A;  2O9O A;  4MNM A;  2JZV A;  2YSH A;  4R5E A;  4C02 B;  1FKG A;  1HKK A;  3AS2 A;  3UI5 A;  1I5H W;  3ARX A;  3UI6 A;  2DSU A;  4W9O A;  1W1T A;  2L2S A;  1ZBW A;  1FD9 A;  4Z2G A;  4KQZ A;  1E6R A;  2FDM A;  4Q22 A;  4ITZ A;  4LAX A;  2DT2 A;  4A0U A;  3JXV A;  4REX A;  2XP3 A;  2RUR A;  1PBK A;  5E62 A;  1LL7 A;  2F2D A;  3LKX A;  4HAR A;  3MQG A;  2KO7 A;  2PPO A;  1J4I A;  3GPK A;  1P5Q A;  3CH9 A;  3AS3 A;  4DRN A;  1EHN A;  4MNK A;  4DZ3 A;  3RME A;  1GPF A;  4O2T A;  1FKT A;  2FKE A;  2KI3 A;  4P8X A;  4WKF A;  4ODQ A;  5GQB A;  4Z2L A;  2DT1 A;  1JNT A;  2ZQT A;  1NH6 A;  3AQU A;  4P8V A;  3ARW A;  2XP8 A;  4QT2 A;  3AS1 A;  4ODP A;  2WLY A;  4TW6 A;  3RM9 A;  1FKL A;  2PV2 A;  4MSP A;  1ZBV A;  2O92 A;  4W5U A;  4G2P A;  3O5G A;  3UQI A;  1D2K A;  2G41 A;  2DSV A;  4DRQ A;  1NWT A;  3CGM A;  3RM8 A;  2RUC A;  4URI A;  1NWS A;  1FKB A;  4QZV B;  5HW6 A;  3TDB A;  3PQH A;  2KR7 A;  3G6M A;  4GGQ A;  1U79 A;  5E65 A;  5GPG A;  2L4J A;  4ML4 A;  1FFQ A;  5AHT A;  4ODO A;  4TW7 A;  4QIB A;  2XP7 A;  1RD6 A;  5BXJ A;  3KAF A;  3JYM A;  5HW7 A;  4DRJ A;  4AY1 A;  2LAJ A;  4MNL A;  2MLY A;  2KE0 A;  1L1P A;  3O5L A;  1EG4 A;  3WD4 A;  1LQ0 A;  3UQA A;  2F4E A;  1TR8 A;  2YSI A;  2JV4 A;  2MNT A;  2PBC A;  4IPX A;  2YBU A;  3M7N A;  3AS0 A;  1T11 A;  2XPA A;  2XP4 A;  4JFL A;  5HUA A;  4ZPV R;  1TCO C;  3PR9 A;  1HKI A;  3WIJ A;  1D7J A;  1FKD A;  2YBT A;  3ARZ A;  3ALF A;  3NI6 A;  2YAJ B;  1F8A B;  1OGB A;  1ZBC A;  4L3N A;  1NMV A;  1FKR A;  4Z2J A;  5CQ2 A;  3TC5 A;  1X6L A;  1HJW A;  5E66 A;  4IQC A;  4MPK A;  3CHC A;  1M5Y A;  2FAP A;  1ZB5 A;  1CTN A;  3ALG A;  3H9R B;  1FKH A;  5JH8 A;  2WM0 A;  1FJD A;  4W9Q A;  1HJX A;  4LAV A;  2QF8 A;  5HTG A;  3RM4 A;  4KR0 B;  3I6C A;  1E6P A;  2ZR6 A;  5DEZ A;  1WNO A;  1BKF A;  2D9F A;  3B9D A;  2A3A A;  1KT1 A;  3IKD A;  2DSZ A;  3O5F A;  1GOI A;  2PPP A;  2VCD A;  1K9T A;  1Q1C A;  3O5P A;  3O5R A;  2AWG A;  5HW8 A;  1FFR A;  3O5Q A;  2RUD A;  4U84 A;  2A3E A;  1NSG A;  3CNG A;  1QPF A;  2DK7 A;  1XHG A;  1W26 A;  3ARP A;  3ARQ A;  3O5J A;  3PRD A;  4ODK A;  3KAI A;  4TYO A;  2RUQ A;  3ODK A;  2WK2 A;  4R0X A;  2WAD A;  4ODN A;  2MLX A;  1SR0 A;  4ZS6 A;  2OWO A;  1FKJ A;  3CHD A;  1HJV A;  4MTV A;  2ZQS A;  3MQH A;  5HT1 A;  3FSB A;  2WAE A;  4E5R A;  4LGX A;  1O6I A;  4JFI A;  3RFW A;  1F40 A;  5J6E A;  1BL4 A;  1EDQ A;  1C9H A;  5B8I C;  2EZ5 W;  5HWB A;  4PTM A;  4DWS C;  2KXQ A;  3WKZ A;  3B8S A;  1E6Z A;  1NMW A;  3UF8 A;  3WD2 A;  1KT0 A;  5GPR A;  3KAD A;  3NTP A;  1OGG A;  4LAW A;  3TCZ A;  1J6Y A;  1J4R A;  1EQ3 A;  3B7X A;  1WAW A;  2RSE A;  1R9H A;  3ARY A;  4WK9 A;  4S3J A;  3ARU A;  3UI4 A;  4QT3 A;  3MCB B;  1KFW A;  5U47 A;  4JFJ A;  3WL0 A;  2PV3 A;  1EIB A;  4U86 A;  4HBO A;  2UZ5 A;  2DG3 A;  1ITX A;  4J4O A;  4W9P A;  5DIU A;  2JMF A;  2LGO A;  3L4H A;  1N1A A;  4GIV A;  1H0G A;  1W1V A;  4WKH A;  5HKG A;  4IT6 A;  2G8Z A;  1K9R A;  1JND A;  2IUZ A;  2YSF A;  3EY6 A;  4DH0 A;  3WD0 A;  5I98 A;  3JYJ A;  4U85 A;  2M8I A;  2PV1 A;  1FKI A;  2ITK A;  4Q7N A;  2PI6 A;  4DRO A;  3FXY A;  2ZQU A;  4ZPT R;  1ZCN A;  2Y8N B;  4Z2K A;  4DRM A;  1LG2 A;  3O5D A;  1JNS A;  1XRV A;  4DWS B;  4FAP A;  3OOB A;  4XAK A;  3FS8 A;  4MNJ A;  2BA1 A;  2DPE A;  1D6O A;  1B6C A;  1EG3 A;  2KGJ A;  3M85 A;  2DK1 A;  1K9Q A;  3IKG A;  1JVW A;  3NRK A;  2M8J A;  3PA7 A;  4L72 B;  4ODR A;  4ODL A;  1W9V A;  1FKK A;  3O5K A;  4IQ2 A;  4DT4 A;  1NWU A;  5D75 A;  1E9L A;  3ARV A;  1FLC A;  1PIN A;  2LKN A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...