2Q5AA

Human pin1 bound to l-peptide
Total Genus 46
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
46
sequence length
157
structure length
145
Chain Sequence
LPPGWEKAMSRSSGRVYYFNHITNASQWERPSEPARVRCSHLLVKHSQSRRPSSWRQEKITRTKEEALELINGYIQKIKSGEEDFESLASQFSDCSSAKARGDLGAFSRGQMQKPFEDASFALRTGEMSGPVFTDSGIHIILRTE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural basis for high-affinity peptide inhibition of human Pin1.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Isomerase/isomerase inhibitor
molecule keywords Peptidyl-prolyl cis-trans isomerase NIMA-interacting 1
total genus 46
structure length 145
sequence length 157
ec nomenclature ec 5.2.1.8: Peptidylprolyl isomerase.
pdb deposition date 2007-05-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00397 WW WW domain
A PF00639 Rotamase PPIC-type PPIASE domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.20.70.10 Mainly Beta Single Sheet Ubiquitin Ligase Nedd4; Chain: W; Ubiquitin Ligase Nedd4; Chain: W; 2q5aA01
3.10.50.40 Alpha Beta Roll Chitinase A; domain 3 Chitinase A; domain 3 2q5aA02
4J4NA 2ZQVA 1Q1CA 4MSPA 2ZQUA 3O5MA 4E5RA 2L2SA 1C9HA 3PRBA 3IKGA 5HW8A 4DRNA 2F4EA 2RUDA 4IQ2A 2KFWA 3O5IA 5HTGA 1FJDA 1K9RA 4IPXA 4TW8A 3LE4A 4ODLA 2PV3A 4DT4A 2ZQSA 2LKNA 4BF8A 2JZVA 2RUCA 4JFMA 3H9RB 3KCEA 2MNTA 1KT0A 2XPBA 3EY6A 1YATA 3O5LA 5HT1A 1D7IA 4LAWA 1O6WA 3RGCA 2KI3A 3LUOA 4ODQA 5HUAA 2LAJA 1FKTA 1L1PA 1FKRA 2YSGA 4JFIA 4O2TA 2KGJA 1EG4A 2LJ4A 1NMWA 2KE0A 3O5FA 1ZCNA 2M2AA 1Q6HA 4TW6A 2M08A 3UI4A 2VN1A 2ZR5A 1FD9A 2FAPA 3CGNA 2E45A 3PA7A 4MGVA 1WR7A 2XP7A 1JVWA 2MLZA 4ODKA 1M5YA 4DROA 3O5OA 3TDBA 2LGOA 1FAPA 4DRMA 2XP6A 3UQIA 2ZQTA 3FAPA 3TC5A 4JFJA 2RURA 4QT3A 3NTPA 1D6OA 3GPKA 3UI6A 1F40A 1B6CA 1D7JA 4DZ3A 4DRKA 5DITA 2OFNA 1T11A 1FKFA 2JX8A 2AWGA 4FAPA 2PPNA 3MDYB 2MLXA 2KXQA 2MPHA 4ITZA 2Q5AA 1W26A 3O5PA 1FKHA 1BL4A 2N87A 2DG4A 1JMQA 2F21A 5AHTA 3IKDA 5B8IC 2DK1A 4GIVA 3VAWA 1FKSA 1NMVA 4DRHA 1FKBA 3O5EA 2YSBA 3M85A 1P5QA 4DRIA 5BXJA 1ROTA 5DIVA 3I6CA 5CQ2A 2XP5A 3KAFA 1NSGA 4DRQA 4DH0A 4DIPA 5HWBA 4C02B 1J4HA 1U79A 3O5JA 3O5QA 2RE3A 1FKJA 2DK7A 3JYMA 1HXVA 2JV4A 1I5HW 1J4RA 1Q6IA 2RUQA 4GGQA 3O5KA 2XP8A 3CGMA 3RFWA 2YSFA 5I98A 3KAGA 4TYOA 3WH0A 4N19A 1EQ3A 2XP4A 2JXWA 2VCDA 3KZ7A 2XPAA 3PRDA 2ZR4A 2PV2A 2DG9A 1A7XA 2RSEA 1WMVA 4JFLA 3KABA 3B7XA 4QT2A 4QIBA 4U85A 2PPOA 1J4IA 1ROUA 2M1IA 1FKKA 1FKIA 3IK8A 3NRKA 2KR7A 1PBKA 3UQAA 2XP3A 5HW6A 4J4OA 4FN2A 5HW7A 2ZR6A 4ODRA 5J6EA 2MDIA 4ODOA 3NI6A 2PPPA 4ODMA 4TW7A 5DIUA 1JNTA 1QPLA 2DG3A 2M8JA 3O5DA 4JFKA 2DWVA 1EG3A 4LAXA 3KADA 3JXVA 3KACA 2K8IA 4G50A 4W9PA 1QZ2A 1F8AB 3UI5A 4DRPA 3JYJA 2XP9A 5HKGA 4TX0A 1FKDA 3KAIA 1R9HA 2LPVA 4G2PA 4ODPA 3OOBA 2ITKA 2KO7A 3KAHA 4W9QA 4W9OA 1YW5A 1JNSA 1K9QA 2PBCA 2PV1A 4LAYA 4TNSA 1QPFA 1Y0OA 5D75A 2EZ5W 2JMFA 4DZ2A 3ODKA 2D9FA 3UF8A 2YSIA 1PINA 3TCZA 5GPGA 1N1AA 1TCOC 2UZ5A 4DRJA 2MF9A 4R0XA 3IHZA 1D7HA 3O5RA 3UQBA 1TK7A 1EYMA 2IF4A 2DMVA 1FKGA 3O5GA 4ODNA 1Q6UA 2BA1A 1BKFA 1FKLA 1KT1A 1ZK6A 4U86A 3M7NA 2F2DA 4JYSA 2M8IA 2YSHA 2MLYA 4LAVA 2M3OW 4NNRA 2L4JA 3CNGA 2Y78A 2RQSA 5HWCA 2ZAJA 2DJYA 2FKEA 4IQCA 3L4HA 4REXA 4U84A 1J6YA
chains in the Genus database with same CATH superfamily
4R5EA 4J4NA 3O5MA 4E5RA 2DT3A 2L2SA 4A0TA 3PRBA 1NWSA 5HW8A 3WL0A 1K9RA 1EIBA 2G8ZA 4ODLA 4S3JA 2ZQSA 2LKNA 5U47A 1KT0A 2XPBA 3PRAA 4ZS6A 1YATA 3O5LA 4Z2GA 4LAWA 2LAJA 1FKTA 1FKRA 2LJ4A 1NMWA 2KE0A 2ZR5A 4HARA 2FAPA 3RM4A 5E64A 3PA7A 1OWQA 1HKMA 3O5OA 3TDBA 3WIJA 1FAPA 3WD4A 3CHDA 2OWOA 4QT3A 3NTPA 5DO2A 3ALFA 2O9OA 4DZ3A 1OGBA 4Q7NA 2OFNA 4Z2LA 5E65A 2MPHA 4ITZA 2AOSA 4A0UA 2F21A 5B8IC 4GLXA 3ARXA 5HWBA 2G41A 3MCBB 2RE3A 1HXVA 2YSFA 5I98A 3KAGA 2XP4A 1H0GA 3KZ7A 4HBOA 4P8VA 1ZB5A 2ZR4A 2RSEA 1A7XA 2WM0A 1WMVA 4DWSD 2DSUA 4QT2A 4QIBA 4U85A 1E6PA 2M1IA 3ARSA 3CHEA 4ZPWR 2KR7A 3B9AA 2XP3A 3FSCA 4J4OA 5HW6A 5J6EA 3OA5A 4ODOA 5DIUA 1JNTA 2DG3A 2M8JA 4AY1A 1EG3A 4LAXA 1E15A 3JXVA 3KACA 3AS2A 4DRPA 4MTVA 1W1TA 4G2PA 2PV1A 4TNSA 3UF8A 2YSIA 5GPGA 4DRJA 1N1AA 1TCOC 3UQBA 1ZBCA 3AS1A 3PR9A 4KR0B 2BA1A 2F2DA 1ZBVA 1RD6A 3FY1A 4LAVA 2L4JA 2DT2A 2A3EA 3G6LA 3RM9A 1Q1CA 4MSPA 2ETNA 4ZPVR 1K9TA 2PI6A 3IKGA 4HBEA 1W1YA 2KFWA 1H0IA 1W9PA 3O5IA 5HTGA 4TW8A 3ARPA 2JZVA 3EY6A 5HT1A 1HKIA 1D7IA 1O6WA 4ODQA 5HUAA 1L1PA 4JFIA 4Z2JA 2A3BA 1SYTA 3UI4A 1FD9A 1WR7A 1JVWA 1UR8A 1OGGA 2MLZA 1LJYA 2LGOA 1W9UA 4DRMA 4JFJA 2B5UB 2QRVA 1D7JA 2F23A 3BXWA 2JX8A 2AWGA 2PPNA 3FSBA 2KXQA 2EULA 3ARQA 1JMQA 2WK2A 3IKDA 2DK1A 5E5WA 3VAWA 1NMVA 1LG1A 1FKBA 3M85A 4UDMA 4DRIA 1GPFA 5DIVA 4DRQA 5CQ2A 1J4HA 1KFWA 1U79A 3ARWA 1FKJA 1I5HW 1J4RA 1Q6IA 3PQHA 4WKFA 3O5KA 3RFWA 3CGMA 4TYOA 3WH0A 2JXWA 4NSBA 2DT1A 2VCDA 3ALGA 1NWRA 4Z2IA 3KABA 1WAWA 3B7XA 1ROUA 4WK9A 2WLZA 1LL4A 4WKAA 1ZU8A 1PBKA 3UQAA 2DSWA 5HW7A 2ZR6A 1LG2A 1HJVA 1QPLA 4JFKA 4G50A 4W9PA 1QZ2A 1HKJA 3UI5A 2B31A 4URIA 1FKDA 1JNSA 2P4VA 4W9QA 1YW5A 1K9QA 3AROA 1QPFA 1Y0OA 3ARUA 5D75A 4DWSC 3LKXB 3ODKA 3TCZA 2MF9A 4R0XA 3IHZA 1D7HA 4LGXA 1TK7A 5E62A 1EYMA 1FKGA 3O5GA 1KT1A 1VF8A 4U86A 4JYSA 3CZ8A 2A3AA 2Y78A 2RQSA 2DJYA 2OLHA 4IQCA 3L4HA 1LQ0A 1J6YA 4DRNA 4MPKA 2F4EA 2RUDA 4IQ2A 4IPXA 3LE4A 5JH8A 2PV3A 4DT4A 1JCHB 5GPRA 2RUCA 1NH6A 2DT0A 3RGCA 3CH9A 4MNLA 3LUOA 3ARTA 3FS8A 2YSGA 2DSZA 3RM8A 2KGJA 3AQUA 1EHNA 3O5FA 1ZCNA 2M2AA 1Q6HA 2VN1A 2E45A 4ODKA 3WQWA 1XRVA 1M5YA 4DROA 3UQIA 2ZQTA 3FAPA 3WL1A 4ML4A 1F40A 3GPKA 3UI6A 3AS3A 4MNMA 3LKXA 3WD0A 1FKFA 3MDYB 5DF0A 4L3NA 1BL4A 2DG4A 3GTYX 1FKSA 4DRHA 2YSBA 5BXJA 1NWTA 2XP5A 3WD2A 1FLCA 1NSGA 2QF8A 3WD1A 4DIPA 3O5QA 1RP5A 2A3CA 2JV4A 1W1PA 4N19A 1EQ3A 2XPAA 2WAEA 1XHGA 2PV2A 4JFLA 3IK8A 1J4IA 2DSVA 1FKKA 1FKIA 4L72B 2ESCA 4W5UA 4ODRA 3NI6A 4ODMA 1LL6A 4TW7A 2DWVA 3G6MA 1R9HA 5GQBA 3OOBA 2ITKA 4W9OA 3KAHA 3GU0A 4LAYA 3MCBA 1E44A 1HJXA 2EZ5W 1E6NA 4DZ2A 1CTNA 4P8WA 1ITXA 2D9FA 3EIPA 1PINA 3MQGA 2UZ5A 1FFQA 5E66A 2IF4A 2DMVA 1E9LA 1Q6UA 1FFRA 2YSHA 4QZVB 3B9EA 1NWUA 3ARYA 5HWCA 2ZAJA 1EDQA 4MAVA 2ZQVA 3QOKA 2ZQUA 1C9HA 5HBFA 1ZBKA 1O6IA 2FDMA 1FJDA 3ARRA 3MQHA 4WKHA 4BF8A 2O92A 4JFMA 3H9RB 3KCEA 2MNTA 4XAKA 1ZL1A 2KI3A 3ARVA 3ARZA 1LL7A 1JNDA 4NZCA 1GUVA 1HJWA 4O2TA 1EG4A 1GOIA 3B9DA 4TW6A 2M08A 4P8XA 3WD3A 4DWSA 3CGNA 4WJXA 4MGVA 2XP7A 1WB0A 3CHFA 2XP6A 2Y8NB 3TC5A 2RURA 1D6OA 4KQZA 1B6CA 4DRKA 5DITA 1T11A 4FAPA 2MLXA 1X6LA 2Q5AA 1W26A 3O5PA 1FKHA 2N87A 1JNEA 1W9VA 5AHTA 4GIVA 3O5EA 1P5QA 1E6RA 2IUZA 4P8UA 1ROTA 3I6CA 3KAFA 4DH0A 4C02B 1TR8A 2WLYA 3O5JA 2DK7A 3JYMA 2RUQA 4GGQA 2XP8A 4IT6A 4S3KA 4WIWA 2PN0A 4MNJA 4ZPTR 4Z2KA 2WADA 3BMBA 3PRDA 1UR9A 1HKKA 2DG9A 3FXYA 2YAJB 2PPOA 3NRKA 2YBTA 4FN2A 4IT4A 3WKZA 2MDIA 3W4RA 2PPPA 3B8SA 3O5DA 1X6NA 1WNOA 3KADA 1ZBWA 4DWSB 2K8IA 1TFVA 1F8AB 3JYJA 2XP9A 4Q22A 5HKGA 4TX0A 3KAIA 2LPVA 4ODPA 2KO7A 2PBCA 2JMFA 4Z2HA 1SR0A 3WQVA 1IX5A 3O5RA 1W1VA 4ODNA 4MNKA 1FKLA 1BKFA 1D2KA 1ZK6A 3M7NA 3AS0A 4NNRA 1GRJA 2M8IA 2MLYA 2M3OW 5DEZA 3CNGA 1E6ZA 2DPEA 3CHCA 3RMEA 4PTMA 2FKEA 4REXA 4U84A 2YBUA
chains in the Genus database with same CATH topology
4R5EA 4J4NA 3O5MA 4E5RA 2DT3A 2L2SA 4A0TA 3PRBA 1NWSA 5HW8A 3WL0A 1K9RA 1EIBA 2G8ZA 4ODLA 4S3JA 2ZQSA 2LKNA 5U47A 1KT0A 2XPBA 3PRAA 4ZS6A 1YATA 3O5LA 4Z2GA 4LAWA 2LAJA 1FKTA 1FKRA 2LJ4A 1NMWA 2KE0A 2ZR5A 4HARA 2FAPA 3RM4A 5E64A 3PA7A 1OWQA 1HKMA 3O5OA 3TDBA 3WIJA 1FAPA 3WD4A 3CHDA 2OWOA 4QT3A 3NTPA 5DO2A 3ALFA 2O9OA 4DZ3A 1OGBA 4Q7NA 2OFNA 4Z2LA 5E65A 2MPHA 4ITZA 2AOSA 4A0UA 2F21A 5B8IC 4GLXA 3ARXA 5HWBA 2G41A 3MCBB 2RE3A 1HXVA 2YSFA 5I98A 3KAGA 2XP4A 1H0GA 3KZ7A 4HBOA 4P8VA 1ZB5A 2ZR4A 2RSEA 1A7XA 2WM0A 1WMVA 4DWSD 2DSUA 4QT2A 4QIBA 4U85A 1E6PA 2M1IA 3ARSA 3CHEA 4ZPWR 2KR7A 3B9AA 2XP3A 3FSCA 4J4OA 5HW6A 5J6EA 3OA5A 4ODOA 5DIUA 1JNTA 2DG3A 2M8JA 4AY1A 1EG3A 4LAXA 1E15A 3JXVA 3KACA 3AS2A 4DRPA 4MTVA 1W1TA 4G2PA 2PV1A 4TNSA 3UF8A 2YSIA 5GPGA 4DRJA 1N1AA 1TCOC 3UQBA 1ZBCA 3AS1A 3PR9A 4KR0B 2BA1A 2F2DA 1ZBVA 1RD6A 3FY1A 4LAVA 2L4JA 2DT2A 2A3EA 3G6LA 3RM9A 1Q1CA 4MSPA 4ZPVR 1K9TA 2PI6A 3IKGA 4HBEA 1W1YA 2KFWA 1H0IA 1W9PA 3O5IA 5HTGA 4TW8A 3ARPA 2JZVA 3EY6A 5HT1A 1HKIA 1D7IA 1O6WA 4ODQA 5HUAA 1L1PA 4JFIA 4Z2JA 2A3BA 1SYTA 3UI4A 1FD9A 1WR7A 1JVWA 1UR8A 1OGGA 2MLZA 1LJYA 2LGOA 1W9UA 4DRMA 4JFJA 2QRVA 1D7JA 3BXWA 2JX8A 2AWGA 2PPNA 3FSBA 2KXQA 3ARQA 1JMQA 2WK2A 3IKDA 2DK1A 5E5WA 3VAWA 1NMVA 1LG1A 1FKBA 3M85A 4DRIA 1GPFA 5DIVA 4DRQA 5CQ2A 1J4HA 1KFWA 1U79A 3ARWA 1FKJA 1I5HW 1J4RA 1Q6IA 3PQHA 4WKFA 3O5KA 3RFWA 3CGMA 4TYOA 3WH0A 2JXWA 4NSBA 2DT1A 2VCDA 3ALGA 1NWRA 4Z2IA 3KABA 1WAWA 3B7XA 1ROUA 4WK9A 2WLZA 1LL4A 4WKAA 1ZU8A 1PBKA 3UQAA 2DSWA 5HW7A 2ZR6A 1LG2A 1HJVA 1QPLA 4JFKA 4G50A 4W9PA 1QZ2A 1HKJA 3UI5A 2B31A 4URIA 1FKDA 1JNSA 4W9QA 1YW5A 1K9QA 3AROA 1QPFA 1Y0OA 3ARUA 5D75A 4DWSC 3LKXB 3ODKA 3TCZA 2MF9A 4R0XA 3IHZA 1D7HA 4LGXA 1TK7A 5E62A 1EYMA 1FKGA 3O5GA 1KT1A 1VF8A 4U86A 4JYSA 3CZ8A 2A3AA 2Y78A 2RQSA 2DJYA 2OLHA 4IQCA 3L4HA 1LQ0A 1J6YA 4DRNA 4MPKA 2F4EA 2RUDA 4IQ2A 4IPXA 3LE4A 5JH8A 2PV3A 4DT4A 5GPRA 2RUCA 1NH6A 2DT0A 3RGCA 3CH9A 4MNLA 3LUOA 3ARTA 3FS8A 2YSGA 2DSZA 3RM8A 2KGJA 3AQUA 1EHNA 3O5FA 1ZCNA 2M2AA 1Q6HA 2VN1A 2E45A 4ODKA 3WQWA 1XRVA 1M5YA 4DROA 3UQIA 2ZQTA 3FAPA 3WL1A 4ML4A 1F40A 3GPKA 3UI6A 3AS3A 4MNMA 3LKXA 3WD0A 1FKFA 3MDYB 5DF0A 4L3NA 1BL4A 2DG4A 1FKSA 4DRHA 2YSBA 5BXJA 1NWTA 2XP5A 3WD2A 1FLCA 1NSGA 2QF8A 3WD1A 4DIPA 3O5QA 1RP5A 2A3CA 2JV4A 1W1PA 4N19A 1EQ3A 2XPAA 2WAEA 1XHGA 2PV2A 4JFLA 3IK8A 1J4IA 2DSVA 1FKKA 1FKIA 4L72B 2ESCA 4W5UA 4ODRA 3NI6A 4ODMA 1LL6A 4TW7A 2DWVA 3G6MA 1R9HA 5GQBA 3OOBA 2ITKA 4W9OA 3KAHA 4LAYA 3MCBA 1HJXA 2EZ5W 1E6NA 4DZ2A 1CTNA 4P8WA 1ITXA 2D9FA 1PINA 3MQGA 2UZ5A 1FFQA 5E66A 2IF4A 2DMVA 1E9LA 1Q6UA 1FFRA 2YSHA 4QZVB 3B9EA 1NWUA 3ARYA 5HWCA 2ZAJA 1EDQA 4MAVA 2ZQVA 3QOKA 2ZQUA 1C9HA 5HBFA 1ZBKA 1O6IA 2FDMA 1FJDA 3ARRA 3MQHA 4WKHA 4BF8A 2O92A 4JFMA 3H9RB 3KCEA 2MNTA 4XAKA 1ZL1A 2KI3A 3ARVA 3ARZA 1LL7A 1JNDA 4NZCA 1GUVA 1HJWA 4O2TA 1EG4A 1GOIA 3B9DA 4TW6A 2M08A 4P8XA 3WD3A 4DWSA 3CGNA 4WJXA 4MGVA 2XP7A 1WB0A 3CHFA 2XP6A 2Y8NB 3TC5A 2RURA 1D6OA 4KQZA 1B6CA 4DRKA 5DITA 1T11A 4FAPA 2MLXA 1X6LA 2Q5AA 1W26A 3O5PA 1FKHA 2N87A 1JNEA 1W9VA 5AHTA 4GIVA 3O5EA 1P5QA 1E6RA 2IUZA 4P8UA 1ROTA 3I6CA 3KAFA 4DH0A 4C02B 1TR8A 2WLYA 3O5JA 2DK7A 3JYMA 2RUQA 4GGQA 2XP8A 4IT6A 4S3KA 4WIWA 4Z2KA 4MNJA 4ZPTR 2WADA 3PRDA 1UR9A 1HKKA 2DG9A 3FXYA 2YAJB 2PPOA 3NRKA 2YBTA 4FN2A 4IT4A 3WKZA 2MDIA 3W4RA 2PPPA 3B8SA 3O5DA 1X6NA 1WNOA 3KADA 1ZBWA 4DWSB 2K8IA 1TFVA 1F8AB 3JYJA 2XP9A 4Q22A 5HKGA 4TX0A 3KAIA 2LPVA 4ODPA 2KO7A 2PBCA 2JMFA 4Z2HA 1SR0A 3WQVA 1IX5A 3O5RA 1W1VA 4ODNA 4MNKA 1FKLA 1BKFA 1D2KA 1ZK6A 3M7NA 3AS0A 4NNRA 2M8IA 2MLYA 2M3OW 5DEZA 3CNGA 1E6ZA 2DPEA 3CHCA 3RMEA 4PTMA 2FKEA 4REXA 4U84A 2YBUA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4J4N A;  2ZQV A;  1Q1C A;  4MSP A;  2ZQU A;  3O5M A;  4E5R A;  2L2S A;  1C9H A;  3PRB A;  3IKG A;  5HW8 A;  4DRN A;  2F4E A;  2RUD A;  4IQ2 A;  2KFW A;  3O5I A;  5HTG A;  1FJD A;  1K9R A;  4IPX A;  4TW8 A;  3LE4 A;  4ODL A;  2PV3 A;  4DT4 A;  2ZQS A;  2LKN A;  4BF8 A;  2JZV A;  2RUC A;  4JFM A;  3H9R B;  3KCE A;  2MNT A;  1KT0 A;  2XPB A;  3EY6 A;  1YAT A;  3O5L A;  5HT1 A;  1D7I A;  4LAW A;  1O6W A;  3RGC A;  2KI3 A;  3LUO A;  4ODQ A;  5HUA A;  2LAJ A;  1FKT A;  1L1P A;  1FKR A;  2YSG A;  4JFI A;  4O2T A;  2KGJ A;  1EG4 A;  2LJ4 A;  1NMW A;  2KE0 A;  3O5F A;  1ZCN A;  2M2A A;  1Q6H A;  4TW6 A;  2M08 A;  3UI4 A;  2VN1 A;  2ZR5 A;  1FD9 A;  2FAP A;  3CGN A;  2E45 A;  3PA7 A;  4MGV A;  1WR7 A;  2XP7 A;  1JVW A;  2MLZ A;  4ODK A;  1M5Y A;  4DRO A;  3O5O A;  3TDB A;  2LGO A;  1FAP A;  4DRM A;  2XP6 A;  3UQI A;  2ZQT A;  3FAP A;  3TC5 A;  4JFJ A;  2RUR A;  4QT3 A;  3NTP A;  1D6O A;  3GPK A;  3UI6 A;  1F40 A;  1B6C A;  1D7J A;  4DZ3 A;  4DRK A;  5DIT A;  2OFN A;  1T11 A;  1FKF A;  2JX8 A;  2AWG A;  4FAP A;  2PPN A;  3MDY B;  2MLX A;  2KXQ A;  2MPH A;  4ITZ A;  2Q5A A;  1W26 A;  3O5P A;  1FKH A;  1BL4 A;  2N87 A;  2DG4 A;  1JMQ A;  2F21 A;  5AHT A;  3IKD A;  5B8I C;  2DK1 A;  4GIV A;  3VAW A;  1FKS A;  1NMV A;  4DRH A;  1FKB A;  3O5E A;  2YSB A;  3M85 A;  1P5Q A;  4DRI A;  5BXJ A;  1ROT A;  5DIV A;  3I6C A;  5CQ2 A;  2XP5 A;  3KAF A;  1NSG A;  4DRQ A;  4DH0 A;  4DIP A;  5HWB A;  4C02 B;  1J4H A;  1U79 A;  3O5J A;  3O5Q A;  2RE3 A;  1FKJ A;  2DK7 A;  3JYM A;  1HXV A;  2JV4 A;  1I5H W;  1J4R A;  1Q6I A;  2RUQ A;  4GGQ A;  3O5K A;  2XP8 A;  3CGM A;  3RFW A;  2YSF A;  5I98 A;  3KAG A;  4TYO A;  3WH0 A;  4N19 A;  1EQ3 A;  2XP4 A;  2JXW A;  2VCD A;  3KZ7 A;  2XPA A;  3PRD A;  2ZR4 A;  2PV2 A;  2DG9 A;  1A7X A;  2RSE A;  1WMV A;  4JFL A;  3KAB A;  3B7X A;  4QT2 A;  4QIB A;  4U85 A;  2PPO A;  1J4I A;  1ROU A;  2M1I A;  1FKK A;  1FKI A;  3IK8 A;  3NRK A;  2KR7 A;  1PBK A;  3UQA A;  2XP3 A;  5HW6 A;  4J4O A;  4FN2 A;  5HW7 A;  2ZR6 A;  4ODR A;  5J6E A;  2MDI A;  4ODO A;  3NI6 A;  2PPP A;  4ODM A;  4TW7 A;  5DIU A;  1JNT A;  1QPL A;  2DG3 A;  2M8J A;  3O5D A;  4JFK A;  2DWV A;  1EG3 A;  4LAX A;  3KAD A;  3JXV A;  3KAC A;  2K8I A;  4G50 A;  4W9P A;  1QZ2 A;  1F8A B;  3UI5 A;  4DRP A;  3JYJ A;  2XP9 A;  5HKG A;  4TX0 A;  1FKD A;  3KAI A;  1R9H A;  2LPV A;  4G2P A;  4ODP A;  3OOB A;  2ITK A;  2KO7 A;  3KAH A;  4W9Q A;  4W9O A;  1YW5 A;  1JNS A;  1K9Q A;  2PBC A;  2PV1 A;  4LAY A;  4TNS A;  1QPF A;  1Y0O A;  5D75 A;  2EZ5 W;  2JMF A;  4DZ2 A;  3ODK A;  2D9F A;  3UF8 A;  2YSI A;  1PIN A;  3TCZ A;  5GPG A;  1N1A A;  1TCO C;  2UZ5 A;  4DRJ A;  2MF9 A;  4R0X A;  3IHZ A;  1D7H A;  3O5R A;  3UQB A;  1TK7 A;  1EYM A;  2IF4 A;  2DMV A;  1FKG A;  3O5G A;  4ODN A;  1Q6U A;  2BA1 A;  1BKF A;  1FKL A;  1KT1 A;  1ZK6 A;  4U86 A;  3M7N A;  2F2D A;  4JYS A;  2M8I A;  2YSH A;  2MLY A;  4LAV A;  2M3O W;  4NNR A;  2L4J A;  3CNG A;  2Y78 A;  2RQS A;  5HWC A;  2ZAJ A;  2DJY A;  2FKE A;  4IQC A;  3L4H A;  4REX A;  4U84 A;  1J6Y A; 
#chains in the Genus database with same CATH topology
 4R5E A;  4J4N A;  3O5M A;  4E5R A;  2DT3 A;  2L2S A;  4A0T A;  3PRB A;  1NWS A;  5HW8 A;  3WL0 A;  1K9R A;  1EIB A;  2G8Z A;  4ODL A;  4S3J A;  2ZQS A;  2LKN A;  5U47 A;  1KT0 A;  2XPB A;  3PRA A;  4ZS6 A;  1YAT A;  3O5L A;  4Z2G A;  4LAW A;  2LAJ A;  1FKT A;  1FKR A;  2LJ4 A;  1NMW A;  2KE0 A;  2ZR5 A;  4HAR A;  2FAP A;  3RM4 A;  5E64 A;  3PA7 A;  1OWQ A;  1HKM A;  3O5O A;  3TDB A;  3WIJ A;  1FAP A;  3WD4 A;  3CHD A;  2OWO A;  4QT3 A;  3NTP A;  5DO2 A;  3ALF A;  2O9O A;  4DZ3 A;  1OGB A;  4Q7N A;  2OFN A;  4Z2L A;  5E65 A;  2MPH A;  4ITZ A;  2AOS A;  4A0U A;  2F21 A;  5B8I C;  4GLX A;  3ARX A;  5HWB A;  2G41 A;  3MCB B;  2RE3 A;  1HXV A;  2YSF A;  5I98 A;  3KAG A;  2XP4 A;  1H0G A;  3KZ7 A;  4HBO A;  4P8V A;  1ZB5 A;  2ZR4 A;  2RSE A;  1A7X A;  2WM0 A;  1WMV A;  4DWS D;  2DSU A;  4QT2 A;  4QIB A;  4U85 A;  1E6P A;  2M1I A;  3ARS A;  3CHE A;  4ZPW R;  2KR7 A;  3B9A A;  2XP3 A;  3FSC A;  4J4O A;  5HW6 A;  5J6E A;  3OA5 A;  4ODO A;  5DIU A;  1JNT A;  2DG3 A;  2M8J A;  4AY1 A;  1EG3 A;  4LAX A;  1E15 A;  3JXV A;  3KAC A;  3AS2 A;  4DRP A;  4MTV A;  1W1T A;  4G2P A;  2PV1 A;  4TNS A;  3UF8 A;  2YSI A;  5GPG A;  4DRJ A;  1N1A A;  1TCO C;  3UQB A;  1ZBC A;  3AS1 A;  3PR9 A;  4KR0 B;  2BA1 A;  2F2D A;  1ZBV A;  1RD6 A;  3FY1 A;  4LAV A;  2L4J A;  2DT2 A;  2A3E A;  3G6L A;  3RM9 A;  1Q1C A;  4MSP A;  2ETN A;  4ZPV R;  1K9T A;  2PI6 A;  3IKG A;  4HBE A;  1W1Y A;  2KFW A;  1H0I A;  1W9P A;  3O5I A;  5HTG A;  4TW8 A;  3ARP A;  2JZV A;  3EY6 A;  5HT1 A;  1HKI A;  1D7I A;  1O6W A;  4ODQ A;  5HUA A;  1L1P A;  4JFI A;  4Z2J A;  2A3B A;  1SYT A;  3UI4 A;  1FD9 A;  1WR7 A;  1JVW A;  1UR8 A;  1OGG A;  2MLZ A;  1LJY A;  2LGO A;  1W9U A;  4DRM A;  4JFJ A;  2B5U B;  2QRV A;  1D7J A;  2F23 A;  3BXW A;  2JX8 A;  2AWG A;  2PPN A;  3FSB A;  2KXQ A;  2EUL A;  3ARQ A;  1JMQ A;  2WK2 A;  3IKD A;  2DK1 A;  5E5W A;  3VAW A;  1NMV A;  1LG1 A;  1FKB A;  3M85 A;  4UDM A;  4DRI A;  1GPF A;  5DIV A;  4DRQ A;  5CQ2 A;  1J4H A;  1KFW A;  1U79 A;  3ARW A;  1FKJ A;  1I5H W;  1J4R A;  1Q6I A;  3PQH A;  4WKF A;  3O5K A;  3RFW A;  3CGM A;  4TYO A;  3WH0 A;  2JXW A;  4NSB A;  2DT1 A;  2VCD A;  3ALG A;  1NWR A;  4Z2I A;  3KAB A;  1WAW A;  3B7X A;  1ROU A;  4WK9 A;  2WLZ A;  1LL4 A;  4WKA A;  1ZU8 A;  1PBK A;  3UQA A;  2DSW A;  5HW7 A;  2ZR6 A;  1LG2 A;  1HJV A;  1QPL A;  4JFK A;  4G50 A;  4W9P A;  1QZ2 A;  1HKJ A;  3UI5 A;  2B31 A;  4URI A;  1FKD A;  1JNS A;  2P4V A;  4W9Q A;  1YW5 A;  1K9Q A;  3ARO A;  1QPF A;  1Y0O A;  3ARU A;  5D75 A;  4DWS C;  3LKX B;  3ODK A;  3TCZ A;  2MF9 A;  4R0X A;  3IHZ A;  1D7H A;  4LGX A;  1TK7 A;  5E62 A;  1EYM A;  1FKG A;  3O5G A;  1KT1 A;  1VF8 A;  4U86 A;  4JYS A;  3CZ8 A;  2A3A A;  2Y78 A;  2RQS A;  2DJY A;  2OLH A;  4IQC A;  3L4H A;  1LQ0 A;  1J6Y A;  4DRN A;  4MPK A;  2F4E A;  2RUD A;  4IQ2 A;  4IPX A;  3LE4 A;  5JH8 A;  2PV3 A;  4DT4 A;  1JCH B;  5GPR A;  2RUC A;  1NH6 A;  2DT0 A;  3RGC A;  3CH9 A;  4MNL A;  3LUO A;  3ART A;  3FS8 A;  2YSG A;  2DSZ A;  3RM8 A;  2KGJ A;  3AQU A;  1EHN A;  3O5F A;  1ZCN A;  2M2A A;  1Q6H A;  2VN1 A;  2E45 A;  4ODK A;  3WQW A;  1XRV A;  1M5Y A;  4DRO A;  3UQI A;  2ZQT A;  3FAP A;  3WL1 A;  4ML4 A;  1F40 A;  3GPK A;  3UI6 A;  3AS3 A;  4MNM A;  3LKX A;  3WD0 A;  1FKF A;  3MDY B;  5DF0 A;  4L3N A;  1BL4 A;  2DG4 A;  3GTY X;  1FKS A;  4DRH A;  2YSB A;  5BXJ A;  1NWT A;  2XP5 A;  3WD2 A;  1FLC A;  1NSG A;  2QF8 A;  3WD1 A;  4DIP A;  3O5Q A;  1RP5 A;  2A3C A;  2JV4 A;  1W1P A;  4N19 A;  1EQ3 A;  2XPA A;  2WAE A;  1XHG A;  2PV2 A;  4JFL A;  3IK8 A;  1J4I A;  2DSV A;  1FKK A;  1FKI A;  4L72 B;  2ESC A;  4W5U A;  4ODR A;  3NI6 A;  4ODM A;  1LL6 A;  4TW7 A;  2DWV A;  3G6M A;  1R9H A;  5GQB A;  3OOB A;  2ITK A;  4W9O A;  3KAH A;  3GU0 A;  4LAY A;  3MCB A;  1E44 A;  1HJX A;  2EZ5 W;  1E6N A;  4DZ2 A;  1CTN A;  4P8W A;  1ITX A;  2D9F A;  3EIP A;  1PIN A;  3MQG A;  2UZ5 A;  1FFQ A;  5E66 A;  2IF4 A;  2DMV A;  1E9L A;  1Q6U A;  1FFR A;  2YSH A;  4QZV B;  3B9E A;  1NWU A;  3ARY A;  5HWC A;  2ZAJ A;  1EDQ A;  4MAV A;  2ZQV A;  3QOK A;  2ZQU A;  1C9H A;  5HBF A;  1ZBK A;  1O6I A;  2FDM A;  1FJD A;  3ARR A;  3MQH A;  4WKH A;  4BF8 A;  2O92 A;  4JFM A;  3H9R B;  3KCE A;  2MNT A;  4XAK A;  1ZL1 A;  2KI3 A;  3ARV A;  3ARZ A;  1LL7 A;  1JND A;  4NZC A;  1GUV A;  1HJW A;  4O2T A;  1EG4 A;  1GOI A;  3B9D A;  4TW6 A;  2M08 A;  4P8X A;  3WD3 A;  4DWS A;  3CGN A;  4WJX A;  4MGV A;  2XP7 A;  1WB0 A;  3CHF A;  2XP6 A;  2Y8N B;  3TC5 A;  2RUR A;  1D6O A;  4KQZ A;  1B6C A;  4DRK A;  5DIT A;  1T11 A;  4FAP A;  2MLX A;  1X6L A;  2Q5A A;  1W26 A;  3O5P A;  1FKH A;  2N87 A;  1JNE A;  1W9V A;  5AHT A;  4GIV A;  3O5E A;  1P5Q A;  1E6R A;  2IUZ A;  4P8U A;  1ROT A;  3I6C A;  3KAF A;  4DH0 A;  4C02 B;  1TR8 A;  2WLY A;  3O5J A;  2DK7 A;  3JYM A;  2RUQ A;  4GGQ A;  2XP8 A;  4IT6 A;  4S3K A;  4WIW A;  2PN0 A;  4MNJ A;  4ZPT R;  4Z2K A;  2WAD A;  3BMB A;  3PRD A;  1UR9 A;  1HKK A;  2DG9 A;  3FXY A;  2YAJ B;  2PPO A;  3NRK A;  2YBT A;  4FN2 A;  4IT4 A;  3WKZ A;  2MDI A;  3W4R A;  2PPP A;  3B8S A;  3O5D A;  1X6N A;  1WNO A;  3KAD A;  1ZBW A;  4DWS B;  2K8I A;  1TFV A;  1F8A B;  3JYJ A;  2XP9 A;  4Q22 A;  5HKG A;  4TX0 A;  3KAI A;  2LPV A;  4ODP A;  2KO7 A;  2PBC A;  2JMF A;  4Z2H A;  1SR0 A;  3WQV A;  1IX5 A;  3O5R A;  1W1V A;  4ODN A;  4MNK A;  1FKL A;  1BKF A;  1D2K A;  1ZK6 A;  3M7N A;  3AS0 A;  4NNR A;  1GRJ A;  2M8I A;  2MLY A;  2M3O W;  5DEZ A;  3CNG A;  1E6Z A;  2DPE A;  3CHC A;  3RME A;  4PTM A;  2FKE A;  4REX A;  4U84 A;  2YBU A; 
#chains in the Genus database with same CATH homology
 4R5E A;  4J4N A;  3O5M A;  4E5R A;  2DT3 A;  2L2S A;  4A0T A;  3PRB A;  1NWS A;  5HW8 A;  3WL0 A;  1K9R A;  1EIB A;  2G8Z A;  4ODL A;  4S3J A;  2ZQS A;  2LKN A;  5U47 A;  1KT0 A;  2XPB A;  3PRA A;  4ZS6 A;  1YAT A;  3O5L A;  4Z2G A;  4LAW A;  2LAJ A;  1FKT A;  1FKR A;  2LJ4 A;  1NMW A;  2KE0 A;  2ZR5 A;  4HAR A;  2FAP A;  3RM4 A;  5E64 A;  3PA7 A;  1OWQ A;  1HKM A;  3O5O A;  3TDB A;  3WIJ A;  1FAP A;  3WD4 A;  3CHD A;  2OWO A;  4QT3 A;  3NTP A;  5DO2 A;  3ALF A;  2O9O A;  4DZ3 A;  1OGB A;  4Q7N A;  2OFN A;  4Z2L A;  5E65 A;  2MPH A;  4ITZ A;  2AOS A;  4A0U A;  2F21 A;  5B8I C;  4GLX A;  3ARX A;  5HWB A;  2G41 A;  3MCB B;  2RE3 A;  1HXV A;  2YSF A;  5I98 A;  3KAG A;  2XP4 A;  1H0G A;  3KZ7 A;  4HBO A;  4P8V A;  1ZB5 A;  2ZR4 A;  2RSE A;  1A7X A;  2WM0 A;  1WMV A;  4DWS D;  2DSU A;  4QT2 A;  4QIB A;  4U85 A;  1E6P A;  2M1I A;  3ARS A;  3CHE A;  4ZPW R;  2KR7 A;  3B9A A;  2XP3 A;  3FSC A;  4J4O A;  5HW6 A;  5J6E A;  3OA5 A;  4ODO A;  5DIU A;  1JNT A;  2DG3 A;  2M8J A;  4AY1 A;  1EG3 A;  4LAX A;  1E15 A;  3JXV A;  3KAC A;  3AS2 A;  4DRP A;  4MTV A;  1W1T A;  4G2P A;  2PV1 A;  4TNS A;  3UF8 A;  2YSI A;  5GPG A;  4DRJ A;  1N1A A;  1TCO C;  3UQB A;  1ZBC A;  3AS1 A;  3PR9 A;  4KR0 B;  2BA1 A;  2F2D A;  1ZBV A;  1RD6 A;  3FY1 A;  4LAV A;  2L4J A;  2DT2 A;  2A3E A;  3G6L A;  3RM9 A;  1Q1C A;  4MSP A;  4ZPV R;  1K9T A;  2PI6 A;  3IKG A;  4HBE A;  1W1Y A;  2KFW A;  1H0I A;  1W9P A;  3O5I A;  5HTG A;  4TW8 A;  3ARP A;  2JZV A;  3EY6 A;  5HT1 A;  1HKI A;  1D7I A;  1O6W A;  4ODQ A;  5HUA A;  1L1P A;  4JFI A;  4Z2J A;  2A3B A;  1SYT A;  3UI4 A;  1FD9 A;  1WR7 A;  1JVW A;  1UR8 A;  1OGG A;  2MLZ A;  1LJY A;  2LGO A;  1W9U A;  4DRM A;  4JFJ A;  2QRV A;  1D7J A;  3BXW A;  2JX8 A;  2AWG A;  2PPN A;  3FSB A;  2KXQ A;  3ARQ A;  1JMQ A;  2WK2 A;  3IKD A;  2DK1 A;  5E5W A;  3VAW A;  1NMV A;  1LG1 A;  1FKB A;  3M85 A;  4DRI A;  1GPF A;  5DIV A;  4DRQ A;  5CQ2 A;  1J4H A;  1KFW A;  1U79 A;  3ARW A;  1FKJ A;  1I5H W;  1J4R A;  1Q6I A;  3PQH A;  4WKF A;  3O5K A;  3RFW A;  3CGM A;  4TYO A;  3WH0 A;  2JXW A;  4NSB A;  2DT1 A;  2VCD A;  3ALG A;  1NWR A;  4Z2I A;  3KAB A;  1WAW A;  3B7X A;  1ROU A;  4WK9 A;  2WLZ A;  1LL4 A;  4WKA A;  1ZU8 A;  1PBK A;  3UQA A;  2DSW A;  5HW7 A;  2ZR6 A;  1LG2 A;  1HJV A;  1QPL A;  4JFK A;  4G50 A;  4W9P A;  1QZ2 A;  1HKJ A;  3UI5 A;  2B31 A;  4URI A;  1FKD A;  1JNS A;  4W9Q A;  1YW5 A;  1K9Q A;  3ARO A;  1QPF A;  1Y0O A;  3ARU A;  5D75 A;  4DWS C;  3LKX B;  3ODK A;  3TCZ A;  2MF9 A;  4R0X A;  3IHZ A;  1D7H A;  4LGX A;  1TK7 A;  5E62 A;  1EYM A;  1FKG A;  3O5G A;  1KT1 A;  1VF8 A;  4U86 A;  4JYS A;  3CZ8 A;  2A3A A;  2Y78 A;  2RQS A;  2DJY A;  2OLH A;  4IQC A;  3L4H A;  1LQ0 A;  1J6Y A;  4DRN A;  4MPK A;  2F4E A;  2RUD A;  4IQ2 A;  4IPX A;  3LE4 A;  5JH8 A;  2PV3 A;  4DT4 A;  5GPR A;  2RUC A;  1NH6 A;  2DT0 A;  3RGC A;  3CH9 A;  4MNL A;  3LUO A;  3ART A;  3FS8 A;  2YSG A;  2DSZ A;  3RM8 A;  2KGJ A;  3AQU A;  1EHN A;  3O5F A;  1ZCN A;  2M2A A;  1Q6H A;  2VN1 A;  2E45 A;  4ODK A;  3WQW A;  1XRV A;  1M5Y A;  4DRO A;  3UQI A;  2ZQT A;  3FAP A;  3WL1 A;  4ML4 A;  1F40 A;  3GPK A;  3UI6 A;  3AS3 A;  4MNM A;  3LKX A;  3WD0 A;  1FKF A;  3MDY B;  5DF0 A;  4L3N A;  1BL4 A;  2DG4 A;  1FKS A;  4DRH A;  2YSB A;  5BXJ A;  1NWT A;  2XP5 A;  3WD2 A;  1FLC A;  1NSG A;  2QF8 A;  3WD1 A;  4DIP A;  3O5Q A;  1RP5 A;  2A3C A;  2JV4 A;  1W1P A;  4N19 A;  1EQ3 A;  2XPA A;  2WAE A;  1XHG A;  2PV2 A;  4JFL A;  3IK8 A;  1J4I A;  2DSV A;  1FKK A;  1FKI A;  4L72 B;  2ESC A;  4W5U A;  4ODR A;  3NI6 A;  4ODM A;  1LL6 A;  4TW7 A;  2DWV A;  3G6M A;  1R9H A;  5GQB A;  3OOB A;  2ITK A;  4W9O A;  3KAH A;  4LAY A;  3MCB A;  1HJX A;  2EZ5 W;  1E6N A;  4DZ2 A;  1CTN A;  4P8W A;  1ITX A;  2D9F A;  1PIN A;  3MQG A;  2UZ5 A;  1FFQ A;  5E66 A;  2IF4 A;  2DMV A;  1E9L A;  1Q6U A;  1FFR A;  2YSH A;  4QZV B;  3B9E A;  1NWU A;  3ARY A;  5HWC A;  2ZAJ A;  1EDQ A;  4MAV A;  2ZQV A;  3QOK A;  2ZQU A;  1C9H A;  5HBF A;  1ZBK A;  1O6I A;  2FDM A;  1FJD A;  3ARR A;  3MQH A;  4WKH A;  4BF8 A;  2O92 A;  4JFM A;  3H9R B;  3KCE A;  2MNT A;  4XAK A;  1ZL1 A;  2KI3 A;  3ARV A;  3ARZ A;  1LL7 A;  1JND A;  4NZC A;  1GUV A;  1HJW A;  4O2T A;  1EG4 A;  1GOI A;  3B9D A;  4TW6 A;  2M08 A;  4P8X A;  3WD3 A;  4DWS A;  3CGN A;  4WJX A;  4MGV A;  2XP7 A;  1WB0 A;  3CHF A;  2XP6 A;  2Y8N B;  3TC5 A;  2RUR A;  1D6O A;  4KQZ A;  1B6C A;  4DRK A;  5DIT A;  1T11 A;  4FAP A;  2MLX A;  1X6L A;  2Q5A A;  1W26 A;  3O5P A;  1FKH A;  2N87 A;  1JNE A;  1W9V A;  5AHT A;  4GIV A;  3O5E A;  1P5Q A;  1E6R A;  2IUZ A;  4P8U A;  1ROT A;  3I6C A;  3KAF A;  4DH0 A;  4C02 B;  1TR8 A;  2WLY A;  3O5J A;  2DK7 A;  3JYM A;  2RUQ A;  4GGQ A;  2XP8 A;  4IT6 A;  4S3K A;  4WIW A;  4Z2K A;  4MNJ A;  4ZPT R;  2WAD A;  3PRD A;  1UR9 A;  1HKK A;  2DG9 A;  3FXY A;  2YAJ B;  2PPO A;  3NRK A;  2YBT A;  4FN2 A;  4IT4 A;  3WKZ A;  2MDI A;  3W4R A;  2PPP A;  3B8S A;  3O5D A;  1X6N A;  1WNO A;  3KAD A;  1ZBW A;  4DWS B;  2K8I A;  1TFV A;  1F8A B;  3JYJ A;  2XP9 A;  4Q22 A;  5HKG A;  4TX0 A;  3KAI A;  2LPV A;  4ODP A;  2KO7 A;  2PBC A;  2JMF A;  4Z2H A;  1SR0 A;  3WQV A;  1IX5 A;  3O5R A;  1W1V A;  4ODN A;  4MNK A;  1FKL A;  1BKF A;  1D2K A;  1ZK6 A;  3M7N A;  3AS0 A;  4NNR A;  2M8I A;  2MLY A;  2M3O W;  5DEZ A;  3CNG A;  1E6Z A;  2DPE A;  3CHC A;  3RME A;  4PTM A;  2FKE A;  4REX A;  4U84 A;  2YBU A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...