2Q5AA

Human pin1 bound to l-peptide
Total Genus 46
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
46
sequence length
157
structure length
145
Chain Sequence
LPPGWEKAMSRSSGRVYYFNHITNASQWERPSEPARVRCSHLLVKHSQSRRPSSWRQEKITRTKEEALELINGYIQKIKSGEEDFESLASQFSDCSSAKARGDLGAFSRGQMQKPFEDASFALRTGEMSGPVFTDSGIHIILRTE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Isomerase/isomerase inhibitor
molecule keywords Peptidyl-prolyl cis-trans isomerase NIMA-interacting 1
publication title Structural basis for high-affinity peptide inhibition of human Pin1.
pubmed doi rcsb
source organism Homo sapiens
total genus 46
structure length 145
sequence length 157
ec nomenclature ec 5.2.1.8: Peptidylprolyl isomerase.
pdb deposition date 2007-05-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00397 WW WW domain
A PF00639 Rotamase PPIC-type PPIASE domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.20.70.10 Mainly Beta Single Sheet Ubiquitin Ligase Nedd4; Chain: W; Ubiquitin Ligase Nedd4; Chain: W; 2q5aA01
3.10.50.40 Alpha Beta Roll Chitinase A; domain 3 Chitinase A; domain 3 2q5aA02
3NI6A 1HXVA 3CGMA 1FKJA 5DIUA 2VN1A 1F8AB 2VCDA 1U79A 3KAIA 2XP8A 3JYMA 3M7NA 2DG4A 5HTGA 3CGNA 1QZ2A 2Y78A 2MLYA 2YSIA 2L4JA 2F21A 1ZK6A 3KZ7A 3IK8A 3TCZA 3O5KA 4IQ2A 3MDYB 3UI6A 4ODLA 2MPHA 3TC5A 3ODKA 2LAJA 3KACA 3PRDA 1FKTA 1EG3A 3O5RA 3O5EA 1NSGA 3NRKA 4JFLA 3JYJA 2JZVA 1J4HA 3O5GA 1N1AA 4IPXA 1FKDA 1BL4A 2XP9A 2ZAJA 1M5YA 2KFWA 1Q6HA 5HT1A 3IKDA 1J4RA 2LGOA 4DRPA 2ZR4A 1EG4A 2PV3A 1ROUA 2YSBA 1ZCNA 3O5MA 2PPPA 4FN2A 2JX8A 3B7XA 1FKKA 2MF9A 4GIVA 2PV2A 1Y0OA 2M2AA 4TX0A 4DRJA 1TCOC 2AWGA 3VAWA 2LPVA 3WH0A 4W9QA 2FKEA 2KI3A 4R0XA 3KCEA 2KXQA 3O5OA 4DZ3A 4DROA 2E45A 2BA1A 3O5LA 3TDBA 3KAFA 1NMVA 1WR7A 1P5QA 2DJYA 2MLXA 1EQ3A 4GGQA 2Q5AA 2DK1A 1YATA 1PINA 1FKLA 4QIBA 1JNSA 3EY6A 3O5IA 4DH0A 1WMVA 2M8IA 3NTPA 2XPBA 4G50A 3UI5A 5HW8A 1FKFA 1FKGA 4ODNA 4DRIA 4DRQA 1W26A 4ITZA 1J6YA 4W9PA 4ODPA 5BXJA 4C02B 1O6WA 2RSEA 4TW7A 1K9RA 4IQCA 4QT2A 3UI4A 2ZR6A 3GPKA 2KE0A 5I98A 4ODKA 3O5QA 1L1PA 2KO7A 4TNSA 3H9RB 3O5DA 1JMQA 1YW5A 5HWCA 4REXA 1QPLA 2OFNA 1EYMA 3FAPA 4DRMA 1KT1A 4E5RA 2XPAA 4DRKA 1D6OA 4LAWA 4FAPA 2ZQUA 4LAXA 3KADA 2YSFA 3IKGA 2N87A 5DITA 2XP7A 2RQSA 4ODOA 1FKHA 1KT0A 2RURA 1ROTA 1FKRA 3M85A 1T11A 2M3OW 3KABA 4DZ2A 1D7IA 2PPOA 4BF8A 1A7XA 3JXVA 1BKFA 1F40A 4JFIA 4JFKA 2ZQTA 2XP4A 5HWBA 2UZ5A 1PBKA 2JMFA 1C9HA 4DIPA 2PPNA 2M08A 3L4HA 4O2TA 5B8IC 2LJ4A 5GPGA 2KR7A 3UF8A 1I5HW 5HW7A 2MNTA 2DWVA 2MLZA 2XP5A 2ITKA 5DIVA 4DRHA 2RUQA 4TW6A 2JV4A 4J4NA 3I6CA 2DMVA 3RFWA 1Q6IA 4JFMA 1FJDA 1QPFA 2M1IA 4ODMA 4JFJA 2ZQVA 1D7HA 4ODRA 2K8IA 5AHTA 4U84A 1R9HA 4ODQA 4DT4A 1K9QA 4NNRA 4TYOA 4QT3A 3O5JA 4JYSA 5HUAA 2XP3A 2RUCA 5D75A 3LUOA 3PRBA 4J4OA 4LAVA 1Q6UA 2PBCA 2XP6A 3UQBA 5J6EA 4MGVA 1FKSA 1JVWA 2KGJA 2IF4A 3KAHA 4N19A 2F2DA 1FKBA 1FD9A 1B6CA 2RUDA 1TK7A 4MSPA 4G2PA 2PV1A 4TW8A 3UQIA 2DG9A 2RE3A 5HKGA 4LAYA 2YSGA 2D9FA 3O5FA 3LE4A 3OOBA 2YSHA 5CQ2A 4U86A 3UQAA 1FKIA 2EZ5W 1Q1CA 2LKNA 2ZQSA 2M8JA 2ZR5A 1NMWA 3PA7A 3O5PA 2L2SA 2F4EA 4U85A 2JXWA 3RGCA 4DRNA 3CNGA 1D7JA 2DG3A 5HW6A 1JNTA 3KAGA 1FAPA 3IHZA 2MDIA 4W9OA 1J4IA 2FAPA 2DK7A
chains in the Genus database with same CATH superfamily
4WKHA 3MQGA 3ARUA 3NI6A 3WD1A 1HXVA 3CGMA 1FKJA 5DIUA 3ARRA 2VN1A 1F8AB 1ZBWA 4Z2IA 2VCDA 3FY1A 1HKIA 5E64A 1U79A 5JH8A 3KAIA 2XP8A 2O9OA 3JYMA 3M7NA 2DSZA 2DG4A 5HTGA 3CGNA 4UDMA 2WK2A 1QZ2A 2OLHA 2Y78A 2MLYA 2PI6A 4QZVB 3AROA 2YSIA 2L4JA 2YBUA 4LGXA 2F21A 1ZK6A 1UR9A 3KZ7A 3IK8A 2QF8A 3TCZA 3O5KA 4IQ2A 3MDYB 1HKMA 3UI6A 4URIA 4ODLA 2MPHA 3TC5A 3ODKA 1GUVA 3FXYA 2LAJA 3KACA 3PRDA 1FKTA 1EG3A 3O5RA 4A0UA 1HJVA 3O5EA 1NSGA 3NRKA 4JFLA 3JYJA 2JZVA 1J4HA 1GPFA 3O5GA 1N1AA 4IPXA 1FKDA 1BL4A 2XP9A 2ZAJA 1M5YA 2KFWA 1Q6HA 1D2KA 3IKDA 5DF0A 5HT1A 4ZPVR 1J4RA 1LL4A 2LGOA 4DRPA 2ZR4A 3EIPA 1W1VA 1EG4A 1W1PA 2B31A 4L72B 1XHGA 2PV3A 1ROUA 2YSBA 1ZCNA 3O5MA 2PPPA 4FN2A 3RM4A 1HKKA 4IT6A 3WD2A 1CTNA 2JX8A 3B7XA 1FKKA 1SYTA 2MF9A 4GIVA 4KR0B 2PV2A 3WD0A 1FFRA 1Y0OA 2M2AA 4TX0A 3ARXA 3RM8A 4DRJA 1TCOC 2AWGA 4GLXA 3VAWA 2LPVA 1UR8A 3WH0A 4W9QA 1NH6A 3PR9A 2DSWA 4MNKA 2FKEA 2KI3A 4R0XA 1WAWA 3KCEA 2KXQA 3O5OA 4DZ3A 4DROA 2EULA 2E45A 3RMEA 2BA1A 3ARVA 3O5LA 3TDBA 1W9VA 3KAFA 4HARA 4ZPTR 1NMVA 1WR7A 1P5QA 2DJYA 2MLXA 1EQ3A 4GGQA 2Q5AA 2DK1A 1IX5A 1YATA 2YBTA 1PINA 1FKLA 1TR8A 4QIBA 1OGGA 4ZS6A 1JNSA 4MNLA 3EY6A 2F23A 1LL7A 3O5IA 4DH0A 1WMVA 3CH9A 2M8IA 3FS8A 3NTPA 2XPBA 3WL1A 4G50A 3UI5A 4P8WA 1FKFA 5HW8A 3ARQA 4Z2JA 2AOSA 1FKGA 4ODNA 3WL0A 4DRIA 3BMBA 4DRQA 1W26A 2WAEA 4ITZA 1J6YA 4W9PA 4ODPA 5DO2A 5BXJA 1H0GA 4C02B 1O6WA 2RSEA 4TW7A 1K9RA 2ESCA 4IQCA 1EIBA 4DWSD 1LG2A 4QT2A 3ALGA 4WIWA 3UI4A 3CHDA 2ZR6A 3GPKA 2KE0A 5I98A 3AS1A 5HBFA 4ODKA 1FLCA 3O5QA 4Z2HA 1GRJA 2A3AA 1HJXA 4Z2KA 4L3NA 1GOIA 1L1PA 4AY1A 2KO7A 4TNSA 3H9RB 3O5DA 1WB0A 1JMQA 1W9UA 3ARSA 1YW5A 5HWCA 3FSBA 4REXA 1W9PA 1NWRA 1QPLA 3B9AA 2OFNA 1EYMA 3WKZA 3FAPA 1KT1A 4E5RA 4DRMA 2XPAA 4DRKA 1D6OA 5GQBA 4LAWA 4FAPA 2ZQUA 1X6LA 4LAXA 3KADA 2YSFA 1TFVA 3IKGA 1ITXA 2WM0A 2N87A 2DT1A 5DITA 2XP7A 2RQSA 4ODOA 1FKHA 1KT0A 2RURA 3ALFA 2WLZA 1ROTA 1FKRA 3M85A 1T11A 2DT3A 1FFQA 4P8UA 2M3OW 1NWUA 3KABA 4DZ2A 1D7IA 2FDMA 3G6MA 2PPOA 1K9TA 1ZB5A 4BF8A 1A7XA 3JXVA 1BKFA 1LJYA 1F40A 4JFIA 4MNJA 3AS3A 3FSCA 4JFKA 2ZQTA 2XP4A 5HWBA 2UZ5A 1PBKA 2JMFA 1C9HA 4DIPA 3OA5A 4ZPWR 3CZ8A 1VF8A 2PPNA 2M08A 3L4HA 3PRAA 1NWSA 4XAKA 1ZU8A 1E6NA 4O2TA 5B8IC 4WK9A 4HBEA 3WD3A 4MNMA 2LJ4A 2G41A 3AQUA 3LKXB 5GPGA 2KR7A 3UF8A 1I5HW 4DWSB 5HW7A 2MNTA 3B8SA 2DWVA 2P4VA 3QOKA 2MLZA 2XP5A 1OGBA 4WJXA 3BXWA 2ITKA 3G6LA 5DIVA 4DWSC 4MPKA 3WD4A 2RUQA 1WNOA 4TW6A 4DRHA 2WADA 2DPEA 2JV4A 1E6PA 1ZBCA 4J4NA 3I6CA 2DMVA 3RFWA 1Q6IA 4JFMA 3LKXA 1W1TA 3WIJA 1FJDA 3MQHA 4PTMA 1QPFA 4DWSA 2M1IA 4ODMA 4JFJA 2ZQVA 1KFWA 1D7HA 1OWQA 3AS0A 4ODRA 2K8IA 5E65A 1E44A 1E15A 3PQHA 1LQ0A 5AHTA 4U84A 1JNDA 1R9HA 3GTYX 4Q7NA 4ODQA 4DT4A 4MTVA 2WLYA 1JCHB 1K9QA 4NNRA 1RP5A 1ZL1A 3ARPA 4TYOA 4QT3A 3O5JA 3CHCA 4WKFA 2QRVA 4JYSA 5HUAA 2XP3A 5U47A 4WKAA 2RUCA 1NWTA 4KQZA 5D75A 3LUOA 5GPRA 1JNEA 1W1YA 3PRBA 4J4OA 4LAVA 1ZBVA 1Q6UA 4P8XA 2PBCA 2XP6A 1E6RA 3ARZA 3UQBA 5J6EA 1HJWA 4MGVA 4Z2GA 1O6IA 2B5UB 3CHEA 2DT2A 4NSBA 3W4RA 5E62A 3B9EA 1FKSA 1JVWA 1LL6A 2A3EA 2KGJA 2IF4A 3KAHA 4N19A 3GU0A 1E6ZA 2F2DA 5DEZA 1FKBA 5E66A 1FD9A 1B6CA 1RD6A 2RUDA 3RM9A 1TK7A 4MSPA 4A0TA 4G2PA 2PV1A 4TW8A 1HKJA 3WQWA 2IUZA 2DG9A 3UQIA 2RE3A 5HKGA 4LAYA 2YSGA 2D9FA 2Y8NB 3O5FA 2DSVA 2A3BA 3LE4A 1EDQA 4W5UA 3OOBA 2YSHA 5CQ2A 4U86A 2PN0A 3UQAA 2DT0A 2A3CA 2DSUA 1FKIA 2EZ5W 1Q1CA 4Z2LA 2LKNA 2YAJB 2ZQSA 2ZR5A 2M8JA 4NZCA 1NMWA 1EHNA 3CHFA 4IT4A 3PA7A 3O5PA 3AS2A 3MCBB 2L2SA 2O92A 1ZBKA 2F4EA 4U85A 2G8ZA 2JXWA 3RGCA 4DRNA 3CNGA 1D7JA 1SR0A 4P8VA 1H0IA 4HBOA 3ARTA 4S3KA 2DG3A 5HW6A 1JNTA 4MAVA 1LG1A 4S3JA 3KAGA 1FAPA 3IHZA 2MDIA 3WQVA 3ARWA 1E9LA 1X6NA 1XRVA 2ETNA 4R5EA 4W9OA 4Q22A 1J4IA 4ML4A 5E5WA 2OWOA 3MCBA 2FAPA 3ARYA 2DK7A 3B9DA
chains in the Genus database with same CATH topology
4WKHA 3MQGA 3ARUA 3NI6A 3WD1A 1HXVA 3CGMA 1FKJA 5DIUA 3ARRA 2VN1A 1F8AB 1ZBWA 4Z2IA 2VCDA 3FY1A 1HKIA 5E64A 1U79A 5JH8A 3KAIA 2XP8A 2O9OA 3JYMA 3M7NA 2DSZA 2DG4A 5HTGA 3CGNA 2WK2A 1QZ2A 2OLHA 2Y78A 2MLYA 2PI6A 4QZVB 3AROA 2YSIA 2L4JA 2YBUA 4LGXA 2F21A 1ZK6A 1UR9A 3KZ7A 3IK8A 2QF8A 3TCZA 3O5KA 4IQ2A 3MDYB 1HKMA 3UI6A 4URIA 4ODLA 2MPHA 3TC5A 3ODKA 1GUVA 3FXYA 2LAJA 3KACA 3PRDA 1FKTA 1EG3A 3O5RA 4A0UA 1HJVA 3O5EA 1NSGA 3NRKA 4JFLA 3JYJA 2JZVA 1J4HA 1GPFA 3O5GA 1N1AA 4IPXA 1FKDA 1BL4A 2XP9A 2ZAJA 1M5YA 2KFWA 1Q6HA 1D2KA 3IKDA 5DF0A 5HT1A 4ZPVR 1J4RA 1LL4A 2LGOA 4DRPA 2ZR4A 1W1VA 1EG4A 1W1PA 2B31A 4L72B 1XHGA 2PV3A 1ROUA 2YSBA 1ZCNA 3O5MA 2PPPA 4FN2A 3RM4A 1HKKA 4IT6A 3WD2A 1CTNA 2JX8A 3B7XA 1FKKA 1SYTA 2MF9A 4GIVA 4KR0B 2PV2A 3WD0A 1FFRA 1Y0OA 2M2AA 4TX0A 3ARXA 3RM8A 4DRJA 1TCOC 2AWGA 4GLXA 3VAWA 2LPVA 1UR8A 3WH0A 4W9QA 1NH6A 3PR9A 2DSWA 4MNKA 2FKEA 2KI3A 4R0XA 1WAWA 3KCEA 2KXQA 3O5OA 4DZ3A 4DROA 2E45A 3RMEA 2BA1A 3ARVA 3O5LA 3TDBA 1W9VA 3KAFA 4HARA 4ZPTR 1NMVA 1WR7A 1P5QA 2DJYA 2MLXA 1EQ3A 4GGQA 2Q5AA 2DK1A 1IX5A 1YATA 2YBTA 1PINA 1FKLA 1TR8A 4QIBA 1OGGA 4ZS6A 1JNSA 4MNLA 3EY6A 1LL7A 3O5IA 4DH0A 1WMVA 3CH9A 2M8IA 3FS8A 3NTPA 2XPBA 3WL1A 4G50A 3UI5A 4P8WA 1FKFA 5HW8A 3ARQA 4Z2JA 2AOSA 1FKGA 4ODNA 3WL0A 4DRIA 4DRQA 1W26A 2WAEA 4ITZA 1J6YA 4W9PA 4ODPA 5DO2A 5BXJA 1H0GA 4C02B 1O6WA 2RSEA 4TW7A 1K9RA 2ESCA 4IQCA 1EIBA 4DWSD 1LG2A 4QT2A 3ALGA 4WIWA 3UI4A 3CHDA 2ZR6A 3GPKA 2KE0A 5I98A 3AS1A 5HBFA 4ODKA 1FLCA 3O5QA 4Z2HA 2A3AA 1HJXA 4Z2KA 4L3NA 1GOIA 1L1PA 4AY1A 2KO7A 4TNSA 3H9RB 3O5DA 1WB0A 1JMQA 1W9UA 3ARSA 1YW5A 5HWCA 3FSBA 4REXA 1W9PA 1NWRA 1QPLA 3B9AA 2OFNA 1EYMA 3WKZA 3FAPA 1KT1A 4E5RA 4DRMA 2XPAA 4DRKA 1D6OA 5GQBA 4LAWA 4FAPA 2ZQUA 1X6LA 4LAXA 3KADA 2YSFA 1TFVA 3IKGA 1ITXA 2WM0A 2N87A 2DT1A 5DITA 2XP7A 2RQSA 4ODOA 1FKHA 1KT0A 2RURA 3ALFA 2WLZA 1ROTA 1FKRA 3M85A 1T11A 2DT3A 1FFQA 4P8UA 2M3OW 1NWUA 3KABA 4DZ2A 1D7IA 2FDMA 3G6MA 2PPOA 1K9TA 1ZB5A 4BF8A 1A7XA 3JXVA 1BKFA 1LJYA 1F40A 4JFIA 4MNJA 3AS3A 3FSCA 4JFKA 2ZQTA 2XP4A 5HWBA 2UZ5A 1PBKA 2JMFA 1C9HA 4DIPA 3OA5A 4ZPWR 3CZ8A 1VF8A 2PPNA 2M08A 3L4HA 3PRAA 1NWSA 4XAKA 1ZU8A 1E6NA 4O2TA 5B8IC 4WK9A 4HBEA 3WD3A 4MNMA 2LJ4A 2G41A 3AQUA 3LKXB 5GPGA 2KR7A 3UF8A 1I5HW 4DWSB 5HW7A 2MNTA 3B8SA 2DWVA 3QOKA 2MLZA 2XP5A 1OGBA 4WJXA 3BXWA 2ITKA 3G6LA 5DIVA 4DWSC 4MPKA 3WD4A 2RUQA 1WNOA 4TW6A 4DRHA 2WADA 2DPEA 2JV4A 1E6PA 1ZBCA 4J4NA 3I6CA 2DMVA 3RFWA 1Q6IA 4JFMA 3LKXA 1W1TA 3WIJA 1FJDA 3MQHA 4PTMA 1QPFA 4DWSA 2M1IA 4ODMA 4JFJA 2ZQVA 1KFWA 1D7HA 1OWQA 3AS0A 4ODRA 2K8IA 5E65A 1E15A 3PQHA 1LQ0A 5AHTA 4U84A 1JNDA 1R9HA 4Q7NA 4ODQA 4DT4A 4MTVA 2WLYA 1K9QA 4NNRA 1RP5A 1ZL1A 3ARPA 4TYOA 4QT3A 3O5JA 3CHCA 4WKFA 2QRVA 4JYSA 5HUAA 2XP3A 5U47A 4WKAA 2RUCA 1NWTA 4KQZA 5D75A 3LUOA 5GPRA 1JNEA 1W1YA 3PRBA 4J4OA 4LAVA 1ZBVA 1Q6UA 4P8XA 2PBCA 2XP6A 1E6RA 3ARZA 3UQBA 5J6EA 1HJWA 4MGVA 4Z2GA 1O6IA 3CHEA 2DT2A 4NSBA 3W4RA 5E62A 3B9EA 1FKSA 1JVWA 1LL6A 2A3EA 2KGJA 2IF4A 3KAHA 4N19A 1E6ZA 2F2DA 5DEZA 1FKBA 5E66A 1FD9A 1B6CA 1RD6A 2RUDA 3RM9A 1TK7A 4MSPA 4A0TA 4G2PA 2PV1A 4TW8A 1HKJA 3WQWA 2IUZA 2DG9A 3UQIA 2RE3A 5HKGA 4LAYA 2YSGA 2D9FA 2Y8NB 3O5FA 2DSVA 2A3BA 3LE4A 1EDQA 4W5UA 3OOBA 2YSHA 5CQ2A 4U86A 3UQAA 2DT0A 2A3CA 2DSUA 1FKIA 2EZ5W 1Q1CA 4Z2LA 2LKNA 2YAJB 2ZQSA 2ZR5A 2M8JA 4NZCA 1NMWA 1EHNA 3CHFA 4IT4A 3PA7A 3O5PA 3AS2A 3MCBB 2L2SA 2O92A 1ZBKA 2F4EA 4U85A 2G8ZA 2JXWA 3RGCA 4DRNA 3CNGA 1D7JA 1SR0A 4P8VA 1H0IA 4HBOA 3ARTA 4S3KA 2DG3A 5HW6A 1JNTA 4MAVA 1LG1A 4S3JA 3KAGA 1FAPA 3IHZA 2MDIA 3WQVA 3ARWA 1E9LA 1X6NA 1XRVA 4R5EA 4W9OA 4Q22A 1J4IA 4ML4A 5E5WA 2OWOA 3MCBA 2FAPA 3ARYA 2DK7A 3B9DA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3NI6 A;  1HXV A;  3CGM A;  1FKJ A;  5DIU A;  2VN1 A;  1F8A B;  2VCD A;  1U79 A;  3KAI A;  2XP8 A;  3JYM A;  3M7N A;  2DG4 A;  5HTG A;  3CGN A;  1QZ2 A;  2Y78 A;  2MLY A;  2YSI A;  2L4J A;  2F21 A;  1ZK6 A;  3KZ7 A;  3IK8 A;  3TCZ A;  3O5K A;  4IQ2 A;  3MDY B;  3UI6 A;  4ODL A;  2MPH A;  3TC5 A;  3ODK A;  2LAJ A;  3KAC A;  3PRD A;  1FKT A;  1EG3 A;  3O5R A;  3O5E A;  1NSG A;  3NRK A;  4JFL A;  3JYJ A;  2JZV A;  1J4H A;  3O5G A;  1N1A A;  4IPX A;  1FKD A;  1BL4 A;  2XP9 A;  2ZAJ A;  1M5Y A;  2KFW A;  1Q6H A;  5HT1 A;  3IKD A;  1J4R A;  2LGO A;  4DRP A;  2ZR4 A;  1EG4 A;  2PV3 A;  1ROU A;  2YSB A;  1ZCN A;  3O5M A;  2PPP A;  4FN2 A;  2JX8 A;  3B7X A;  1FKK A;  2MF9 A;  4GIV A;  2PV2 A;  1Y0O A;  2M2A A;  4TX0 A;  4DRJ A;  1TCO C;  2AWG A;  3VAW A;  2LPV A;  3WH0 A;  4W9Q A;  2FKE A;  2KI3 A;  4R0X A;  3KCE A;  2KXQ A;  3O5O A;  4DZ3 A;  4DRO A;  2E45 A;  2BA1 A;  3O5L A;  3TDB A;  3KAF A;  1NMV A;  1WR7 A;  1P5Q A;  2DJY A;  2MLX A;  1EQ3 A;  4GGQ A;  2Q5A A;  2DK1 A;  1YAT A;  1PIN A;  1FKL A;  4QIB A;  1JNS A;  3EY6 A;  3O5I A;  4DH0 A;  1WMV A;  2M8I A;  3NTP A;  2XPB A;  4G50 A;  3UI5 A;  5HW8 A;  1FKF A;  1FKG A;  4ODN A;  4DRI A;  4DRQ A;  1W26 A;  4ITZ A;  1J6Y A;  4W9P A;  4ODP A;  5BXJ A;  4C02 B;  1O6W A;  2RSE A;  4TW7 A;  1K9R A;  4IQC A;  4QT2 A;  3UI4 A;  2ZR6 A;  3GPK A;  2KE0 A;  5I98 A;  4ODK A;  3O5Q A;  1L1P A;  2KO7 A;  4TNS A;  3H9R B;  3O5D A;  1JMQ A;  1YW5 A;  5HWC A;  4REX A;  1QPL A;  2OFN A;  1EYM A;  3FAP A;  4DRM A;  1KT1 A;  4E5R A;  2XPA A;  4DRK A;  1D6O A;  4LAW A;  4FAP A;  2ZQU A;  4LAX A;  3KAD A;  2YSF A;  3IKG A;  2N87 A;  5DIT A;  2XP7 A;  2RQS A;  4ODO A;  1FKH A;  1KT0 A;  2RUR A;  1ROT A;  1FKR A;  3M85 A;  1T11 A;  2M3O W;  3KAB A;  4DZ2 A;  1D7I A;  2PPO A;  4BF8 A;  1A7X A;  3JXV A;  1BKF A;  1F40 A;  4JFI A;  4JFK A;  2ZQT A;  2XP4 A;  5HWB A;  2UZ5 A;  1PBK A;  2JMF A;  1C9H A;  4DIP A;  2PPN A;  2M08 A;  3L4H A;  4O2T A;  5B8I C;  2LJ4 A;  5GPG A;  2KR7 A;  3UF8 A;  1I5H W;  5HW7 A;  2MNT A;  2DWV A;  2MLZ A;  2XP5 A;  2ITK A;  5DIV A;  4DRH A;  2RUQ A;  4TW6 A;  2JV4 A;  4J4N A;  3I6C A;  2DMV A;  3RFW A;  1Q6I A;  4JFM A;  1FJD A;  1QPF A;  2M1I A;  4ODM A;  4JFJ A;  2ZQV A;  1D7H A;  4ODR A;  2K8I A;  5AHT A;  4U84 A;  1R9H A;  4ODQ A;  4DT4 A;  1K9Q A;  4NNR A;  4TYO A;  4QT3 A;  3O5J A;  4JYS A;  5HUA A;  2XP3 A;  2RUC A;  5D75 A;  3LUO A;  3PRB A;  4J4O A;  4LAV A;  1Q6U A;  2PBC A;  2XP6 A;  3UQB A;  5J6E A;  4MGV A;  1FKS A;  1JVW A;  2KGJ A;  2IF4 A;  3KAH A;  4N19 A;  2F2D A;  1FKB A;  1FD9 A;  1B6C A;  2RUD A;  1TK7 A;  4MSP A;  4G2P A;  2PV1 A;  4TW8 A;  3UQI A;  2DG9 A;  2RE3 A;  5HKG A;  4LAY A;  2YSG A;  2D9F A;  3O5F A;  3LE4 A;  3OOB A;  2YSH A;  5CQ2 A;  4U86 A;  3UQA A;  1FKI A;  2EZ5 W;  1Q1C A;  2LKN A;  2ZQS A;  2M8J A;  2ZR5 A;  1NMW A;  3PA7 A;  3O5P A;  2L2S A;  2F4E A;  4U85 A;  2JXW A;  3RGC A;  4DRN A;  3CNG A;  1D7J A;  2DG3 A;  5HW6 A;  1JNT A;  3KAG A;  1FAP A;  3IHZ A;  2MDI A;  4W9O A;  1J4I A;  2FAP A;  2DK7 A; 
#chains in the Genus database with same CATH topology
 4WKH A;  3MQG A;  3ARU A;  3NI6 A;  3WD1 A;  1HXV A;  3CGM A;  1FKJ A;  5DIU A;  3ARR A;  2VN1 A;  1F8A B;  1ZBW A;  4Z2I A;  2VCD A;  3FY1 A;  1HKI A;  5E64 A;  1U79 A;  5JH8 A;  3KAI A;  2XP8 A;  2O9O A;  3JYM A;  3M7N A;  2DSZ A;  2DG4 A;  5HTG A;  3CGN A;  4UDM A;  2WK2 A;  1QZ2 A;  2OLH A;  2Y78 A;  2MLY A;  2PI6 A;  4QZV B;  3ARO A;  2YSI A;  2L4J A;  2YBU A;  4LGX A;  2F21 A;  1ZK6 A;  1UR9 A;  3KZ7 A;  3IK8 A;  2QF8 A;  3TCZ A;  3O5K A;  4IQ2 A;  3MDY B;  1HKM A;  3UI6 A;  4URI A;  4ODL A;  2MPH A;  3TC5 A;  3ODK A;  1GUV A;  3FXY A;  2LAJ A;  3KAC A;  3PRD A;  1FKT A;  1EG3 A;  3O5R A;  4A0U A;  1HJV A;  3O5E A;  1NSG A;  3NRK A;  4JFL A;  3JYJ A;  2JZV A;  1J4H A;  1GPF A;  3O5G A;  1N1A A;  4IPX A;  1FKD A;  1BL4 A;  2XP9 A;  2ZAJ A;  1M5Y A;  2KFW A;  1Q6H A;  1D2K A;  3IKD A;  5DF0 A;  5HT1 A;  4ZPV R;  1J4R A;  1LL4 A;  2LGO A;  4DRP A;  2ZR4 A;  3EIP A;  1W1V A;  1EG4 A;  1W1P A;  2B31 A;  4L72 B;  1XHG A;  2PV3 A;  1ROU A;  2YSB A;  1ZCN A;  3O5M A;  2PPP A;  4FN2 A;  3RM4 A;  1HKK A;  4IT6 A;  3WD2 A;  1CTN A;  2JX8 A;  3B7X A;  1FKK A;  1SYT A;  2MF9 A;  4GIV A;  4KR0 B;  2PV2 A;  3WD0 A;  1FFR A;  1Y0O A;  2M2A A;  4TX0 A;  3ARX A;  3RM8 A;  4DRJ A;  1TCO C;  2AWG A;  4GLX A;  3VAW A;  2LPV A;  1UR8 A;  3WH0 A;  4W9Q A;  1NH6 A;  3PR9 A;  2DSW A;  4MNK A;  2FKE A;  2KI3 A;  4R0X A;  1WAW A;  3KCE A;  2KXQ A;  3O5O A;  4DZ3 A;  4DRO A;  2EUL A;  2E45 A;  3RME A;  2BA1 A;  3ARV A;  3O5L A;  3TDB A;  1W9V A;  3KAF A;  4HAR A;  4ZPT R;  1NMV A;  1WR7 A;  1P5Q A;  2DJY A;  2MLX A;  1EQ3 A;  4GGQ A;  2Q5A A;  2DK1 A;  1IX5 A;  1YAT A;  2YBT A;  1PIN A;  1FKL A;  1TR8 A;  4QIB A;  1OGG A;  4ZS6 A;  1JNS A;  4MNL A;  3EY6 A;  2F23 A;  1LL7 A;  3O5I A;  4DH0 A;  1WMV A;  3CH9 A;  2M8I A;  3FS8 A;  3NTP A;  2XPB A;  3WL1 A;  4G50 A;  3UI5 A;  4P8W A;  1FKF A;  5HW8 A;  3ARQ A;  4Z2J A;  2AOS A;  1FKG A;  4ODN A;  3WL0 A;  4DRI A;  3BMB A;  4DRQ A;  1W26 A;  2WAE A;  4ITZ A;  1J6Y A;  4W9P A;  4ODP A;  5DO2 A;  5BXJ A;  1H0G A;  4C02 B;  1O6W A;  2RSE A;  4TW7 A;  1K9R A;  2ESC A;  4IQC A;  1EIB A;  4DWS D;  1LG2 A;  4QT2 A;  3ALG A;  4WIW A;  3UI4 A;  3CHD A;  2ZR6 A;  3GPK A;  2KE0 A;  5I98 A;  3AS1 A;  5HBF A;  4ODK A;  1FLC A;  3O5Q A;  4Z2H A;  1GRJ A;  2A3A A;  1HJX A;  4Z2K A;  4L3N A;  1GOI A;  1L1P A;  4AY1 A;  2KO7 A;  4TNS A;  3H9R B;  3O5D A;  1WB0 A;  1JMQ A;  1W9U A;  3ARS A;  1YW5 A;  5HWC A;  3FSB A;  4REX A;  1W9P A;  1NWR A;  1QPL A;  3B9A A;  2OFN A;  1EYM A;  3WKZ A;  3FAP A;  1KT1 A;  4E5R A;  4DRM A;  2XPA A;  4DRK A;  1D6O A;  5GQB A;  4LAW A;  4FAP A;  2ZQU A;  1X6L A;  4LAX A;  3KAD A;  2YSF A;  1TFV A;  3IKG A;  1ITX A;  2WM0 A;  2N87 A;  2DT1 A;  5DIT A;  2XP7 A;  2RQS A;  4ODO A;  1FKH A;  1KT0 A;  2RUR A;  3ALF A;  2WLZ A;  1ROT A;  1FKR A;  3M85 A;  1T11 A;  2DT3 A;  1FFQ A;  4P8U A;  2M3O W;  1NWU A;  3KAB A;  4DZ2 A;  1D7I A;  2FDM A;  3G6M A;  2PPO A;  1K9T A;  1ZB5 A;  4BF8 A;  1A7X A;  3JXV A;  1BKF A;  1LJY A;  1F40 A;  4JFI A;  4MNJ A;  3AS3 A;  3FSC A;  4JFK A;  2ZQT A;  2XP4 A;  5HWB A;  2UZ5 A;  1PBK A;  2JMF A;  1C9H A;  4DIP A;  3OA5 A;  4ZPW R;  3CZ8 A;  1VF8 A;  2PPN A;  2M08 A;  3L4H A;  3PRA A;  1NWS A;  4XAK A;  1ZU8 A;  1E6N A;  4O2T A;  5B8I C;  4WK9 A;  4HBE A;  3WD3 A;  4MNM A;  2LJ4 A;  2G41 A;  3AQU A;  3LKX B;  5GPG A;  2KR7 A;  3UF8 A;  1I5H W;  4DWS B;  5HW7 A;  2MNT A;  3B8S A;  2DWV A;  2P4V A;  3QOK A;  2MLZ A;  2XP5 A;  1OGB A;  4WJX A;  3BXW A;  2ITK A;  3G6L A;  5DIV A;  4DWS C;  4MPK A;  3WD4 A;  2RUQ A;  1WNO A;  4TW6 A;  4DRH A;  2WAD A;  2DPE A;  2JV4 A;  1E6P A;  1ZBC A;  4J4N A;  3I6C A;  2DMV A;  3RFW A;  1Q6I A;  4JFM A;  3LKX A;  1W1T A;  3WIJ A;  1FJD A;  3MQH A;  4PTM A;  1QPF A;  4DWS A;  2M1I A;  4ODM A;  4JFJ A;  2ZQV A;  1KFW A;  1D7H A;  1OWQ A;  3AS0 A;  4ODR A;  2K8I A;  5E65 A;  1E44 A;  1E15 A;  3PQH A;  1LQ0 A;  5AHT A;  4U84 A;  1JND A;  1R9H A;  3GTY X;  4Q7N A;  4ODQ A;  4DT4 A;  4MTV A;  2WLY A;  1JCH B;  1K9Q A;  4NNR A;  1RP5 A;  1ZL1 A;  3ARP A;  4TYO A;  4QT3 A;  3O5J A;  3CHC A;  4WKF A;  2QRV A;  4JYS A;  5HUA A;  2XP3 A;  5U47 A;  4WKA A;  2RUC A;  1NWT A;  4KQZ A;  5D75 A;  3LUO A;  5GPR A;  1JNE A;  1W1Y A;  3PRB A;  4J4O A;  4LAV A;  1ZBV A;  1Q6U A;  4P8X A;  2PBC A;  2XP6 A;  1E6R A;  3ARZ A;  3UQB A;  5J6E A;  1HJW A;  4MGV A;  4Z2G A;  1O6I A;  2B5U B;  3CHE A;  2DT2 A;  4NSB A;  3W4R A;  5E62 A;  3B9E A;  1FKS A;  1JVW A;  1LL6 A;  2A3E A;  2KGJ A;  2IF4 A;  3KAH A;  4N19 A;  3GU0 A;  1E6Z A;  2F2D A;  5DEZ A;  1FKB A;  5E66 A;  1FD9 A;  1B6C A;  1RD6 A;  2RUD A;  3RM9 A;  1TK7 A;  4MSP A;  4A0T A;  4G2P A;  2PV1 A;  4TW8 A;  1HKJ A;  3WQW A;  2IUZ A;  2DG9 A;  3UQI A;  2RE3 A;  5HKG A;  4LAY A;  2YSG A;  2D9F A;  2Y8N B;  3O5F A;  2DSV A;  2A3B A;  3LE4 A;  1EDQ A;  4W5U A;  3OOB A;  2YSH A;  5CQ2 A;  4U86 A;  2PN0 A;  3UQA A;  2DT0 A;  2A3C A;  2DSU A;  1FKI A;  2EZ5 W;  1Q1C A;  4Z2L A;  2LKN A;  2YAJ B;  2ZQS A;  2ZR5 A;  2M8J A;  4NZC A;  1NMW A;  1EHN A;  3CHF A;  4IT4 A;  3PA7 A;  3O5P A;  3AS2 A;  3MCB B;  2L2S A;  2O92 A;  1ZBK A;  2F4E A;  4U85 A;  2G8Z A;  2JXW A;  3RGC A;  4DRN A;  3CNG A;  1D7J A;  1SR0 A;  4P8V A;  1H0I A;  4HBO A;  3ART A;  4S3K A;  2DG3 A;  5HW6 A;  1JNT A;  4MAV A;  1LG1 A;  4S3J A;  3KAG A;  1FAP A;  3IHZ A;  2MDI A;  3WQV A;  3ARW A;  1E9L A;  1X6N A;  1XRV A;  2ETN A;  4R5E A;  4W9O A;  4Q22 A;  1J4I A;  4ML4 A;  5E5W A;  2OWO A;  3MCB A;  2FAP A;  3ARY A;  2DK7 A;  3B9D A; 
#chains in the Genus database with same CATH homology
 4WKH A;  3MQG A;  3ARU A;  3NI6 A;  3WD1 A;  1HXV A;  3CGM A;  1FKJ A;  5DIU A;  3ARR A;  2VN1 A;  1F8A B;  1ZBW A;  4Z2I A;  2VCD A;  3FY1 A;  1HKI A;  5E64 A;  1U79 A;  5JH8 A;  3KAI A;  2XP8 A;  2O9O A;  3JYM A;  3M7N A;  2DSZ A;  2DG4 A;  5HTG A;  3CGN A;  2WK2 A;  1QZ2 A;  2OLH A;  2Y78 A;  2MLY A;  2PI6 A;  4QZV B;  3ARO A;  2YSI A;  2L4J A;  2YBU A;  4LGX A;  2F21 A;  1ZK6 A;  1UR9 A;  3KZ7 A;  3IK8 A;  2QF8 A;  3TCZ A;  3O5K A;  4IQ2 A;  3MDY B;  1HKM A;  3UI6 A;  4URI A;  4ODL A;  2MPH A;  3TC5 A;  3ODK A;  1GUV A;  3FXY A;  2LAJ A;  3KAC A;  3PRD A;  1FKT A;  1EG3 A;  3O5R A;  4A0U A;  1HJV A;  3O5E A;  1NSG A;  3NRK A;  4JFL A;  3JYJ A;  2JZV A;  1J4H A;  1GPF A;  3O5G A;  1N1A A;  4IPX A;  1FKD A;  1BL4 A;  2XP9 A;  2ZAJ A;  1M5Y A;  2KFW A;  1Q6H A;  1D2K A;  3IKD A;  5DF0 A;  5HT1 A;  4ZPV R;  1J4R A;  1LL4 A;  2LGO A;  4DRP A;  2ZR4 A;  1W1V A;  1EG4 A;  1W1P A;  2B31 A;  4L72 B;  1XHG A;  2PV3 A;  1ROU A;  2YSB A;  1ZCN A;  3O5M A;  2PPP A;  4FN2 A;  3RM4 A;  1HKK A;  4IT6 A;  3WD2 A;  1CTN A;  2JX8 A;  3B7X A;  1FKK A;  1SYT A;  2MF9 A;  4GIV A;  4KR0 B;  2PV2 A;  3WD0 A;  1FFR A;  1Y0O A;  2M2A A;  4TX0 A;  3ARX A;  3RM8 A;  4DRJ A;  1TCO C;  2AWG A;  4GLX A;  3VAW A;  2LPV A;  1UR8 A;  3WH0 A;  4W9Q A;  1NH6 A;  3PR9 A;  2DSW A;  4MNK A;  2FKE A;  2KI3 A;  4R0X A;  1WAW A;  3KCE A;  2KXQ A;  3O5O A;  4DZ3 A;  4DRO A;  2E45 A;  3RME A;  2BA1 A;  3ARV A;  3O5L A;  3TDB A;  1W9V A;  3KAF A;  4HAR A;  4ZPT R;  1NMV A;  1WR7 A;  1P5Q A;  2DJY A;  2MLX A;  1EQ3 A;  4GGQ A;  2Q5A A;  2DK1 A;  1IX5 A;  1YAT A;  2YBT A;  1PIN A;  1FKL A;  1TR8 A;  4QIB A;  1OGG A;  4ZS6 A;  1JNS A;  4MNL A;  3EY6 A;  1LL7 A;  3O5I A;  4DH0 A;  1WMV A;  3CH9 A;  2M8I A;  3FS8 A;  3NTP A;  2XPB A;  3WL1 A;  4G50 A;  3UI5 A;  4P8W A;  1FKF A;  5HW8 A;  3ARQ A;  4Z2J A;  2AOS A;  1FKG A;  4ODN A;  3WL0 A;  4DRI A;  4DRQ A;  1W26 A;  2WAE A;  4ITZ A;  1J6Y A;  4W9P A;  4ODP A;  5DO2 A;  5BXJ A;  1H0G A;  4C02 B;  1O6W A;  2RSE A;  4TW7 A;  1K9R A;  2ESC A;  4IQC A;  1EIB A;  4DWS D;  1LG2 A;  4QT2 A;  3ALG A;  4WIW A;  3UI4 A;  3CHD A;  2ZR6 A;  3GPK A;  2KE0 A;  5I98 A;  3AS1 A;  5HBF A;  4ODK A;  1FLC A;  3O5Q A;  4Z2H A;  2A3A A;  1HJX A;  4Z2K A;  4L3N A;  1GOI A;  1L1P A;  4AY1 A;  2KO7 A;  4TNS A;  3H9R B;  3O5D A;  1WB0 A;  1JMQ A;  1W9U A;  3ARS A;  1YW5 A;  5HWC A;  3FSB A;  4REX A;  1W9P A;  1NWR A;  1QPL A;  3B9A A;  2OFN A;  1EYM A;  3WKZ A;  3FAP A;  1KT1 A;  4E5R A;  4DRM A;  2XPA A;  4DRK A;  1D6O A;  5GQB A;  4LAW A;  4FAP A;  2ZQU A;  1X6L A;  4LAX A;  3KAD A;  2YSF A;  1TFV A;  3IKG A;  1ITX A;  2WM0 A;  2N87 A;  2DT1 A;  5DIT A;  2XP7 A;  2RQS A;  4ODO A;  1FKH A;  1KT0 A;  2RUR A;  3ALF A;  2WLZ A;  1ROT A;  1FKR A;  3M85 A;  1T11 A;  2DT3 A;  1FFQ A;  4P8U A;  2M3O W;  1NWU A;  3KAB A;  4DZ2 A;  1D7I A;  2FDM A;  3G6M A;  2PPO A;  1K9T A;  1ZB5 A;  4BF8 A;  1A7X A;  3JXV A;  1BKF A;  1LJY A;  1F40 A;  4JFI A;  4MNJ A;  3AS3 A;  3FSC A;  4JFK A;  2ZQT A;  2XP4 A;  5HWB A;  2UZ5 A;  1PBK A;  2JMF A;  1C9H A;  4DIP A;  3OA5 A;  4ZPW R;  3CZ8 A;  1VF8 A;  2PPN A;  2M08 A;  3L4H A;  3PRA A;  1NWS A;  4XAK A;  1ZU8 A;  1E6N A;  4O2T A;  5B8I C;  4WK9 A;  4HBE A;  3WD3 A;  4MNM A;  2LJ4 A;  2G41 A;  3AQU A;  3LKX B;  5GPG A;  2KR7 A;  3UF8 A;  1I5H W;  4DWS B;  5HW7 A;  2MNT A;  3B8S A;  2DWV A;  3QOK A;  2MLZ A;  2XP5 A;  1OGB A;  4WJX A;  3BXW A;  2ITK A;  3G6L A;  5DIV A;  4DWS C;  4MPK A;  3WD4 A;  2RUQ A;  1WNO A;  4TW6 A;  4DRH A;  2WAD A;  2DPE A;  2JV4 A;  1E6P A;  1ZBC A;  4J4N A;  3I6C A;  2DMV A;  3RFW A;  1Q6I A;  4JFM A;  3LKX A;  1W1T A;  3WIJ A;  1FJD A;  3MQH A;  4PTM A;  1QPF A;  4DWS A;  2M1I A;  4ODM A;  4JFJ A;  2ZQV A;  1KFW A;  1D7H A;  1OWQ A;  3AS0 A;  4ODR A;  2K8I A;  5E65 A;  1E15 A;  3PQH A;  1LQ0 A;  5AHT A;  4U84 A;  1JND A;  1R9H A;  4Q7N A;  4ODQ A;  4DT4 A;  4MTV A;  2WLY A;  1K9Q A;  4NNR A;  1RP5 A;  1ZL1 A;  3ARP A;  4TYO A;  4QT3 A;  3O5J A;  3CHC A;  4WKF A;  2QRV A;  4JYS A;  5HUA A;  2XP3 A;  5U47 A;  4WKA A;  2RUC A;  1NWT A;  4KQZ A;  5D75 A;  3LUO A;  5GPR A;  1JNE A;  1W1Y A;  3PRB A;  4J4O A;  4LAV A;  1ZBV A;  1Q6U A;  4P8X A;  2PBC A;  2XP6 A;  1E6R A;  3ARZ A;  3UQB A;  5J6E A;  1HJW A;  4MGV A;  4Z2G A;  1O6I A;  3CHE A;  2DT2 A;  4NSB A;  3W4R A;  5E62 A;  3B9E A;  1FKS A;  1JVW A;  1LL6 A;  2A3E A;  2KGJ A;  2IF4 A;  3KAH A;  4N19 A;  1E6Z A;  2F2D A;  5DEZ A;  1FKB A;  5E66 A;  1FD9 A;  1B6C A;  1RD6 A;  2RUD A;  3RM9 A;  1TK7 A;  4MSP A;  4A0T A;  4G2P A;  2PV1 A;  4TW8 A;  1HKJ A;  3WQW A;  2IUZ A;  2DG9 A;  3UQI A;  2RE3 A;  5HKG A;  4LAY A;  2YSG A;  2D9F A;  2Y8N B;  3O5F A;  2DSV A;  2A3B A;  3LE4 A;  1EDQ A;  4W5U A;  3OOB A;  2YSH A;  5CQ2 A;  4U86 A;  3UQA A;  2DT0 A;  2A3C A;  2DSU A;  1FKI A;  2EZ5 W;  1Q1C A;  4Z2L A;  2LKN A;  2YAJ B;  2ZQS A;  2ZR5 A;  2M8J A;  4NZC A;  1NMW A;  1EHN A;  3CHF A;  4IT4 A;  3PA7 A;  3O5P A;  3AS2 A;  3MCB B;  2L2S A;  2O92 A;  1ZBK A;  2F4E A;  4U85 A;  2G8Z A;  2JXW A;  3RGC A;  4DRN A;  3CNG A;  1D7J A;  1SR0 A;  4P8V A;  1H0I A;  4HBO A;  3ART A;  4S3K A;  2DG3 A;  5HW6 A;  1JNT A;  4MAV A;  1LG1 A;  4S3J A;  3KAG A;  1FAP A;  3IHZ A;  2MDI A;  3WQV A;  3ARW A;  1E9L A;  1X6N A;  1XRV A;  4R5E A;  4W9O A;  4Q22 A;  1J4I A;  4ML4 A;  5E5W A;  2OWO A;  3MCB A;  2FAP A;  3ARY A;  2DK7 A;  3B9D A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...