2Q5AA

Human pin1 bound to l-peptide
Total Genus 46
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
46
sequence length
157
structure length
145
Chain Sequence
LPPGWEKAMSRSSGRVYYFNHITNASQWERPSEPARVRCSHLLVKHSQSRRPSSWRQEKITRTKEEALELINGYIQKIKSGEEDFESLASQFSDCSSAKARGDLGAFSRGQMQKPFEDASFALRTGEMSGPVFTDSGIHIILRTE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural basis for high-affinity peptide inhibition of human Pin1.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Isomerase/isomerase inhibitor
molecule keywords Peptidyl-prolyl cis-trans isomerase NIMA-interacting 1
total genus 46
structure length 145
sequence length 157
ec nomenclature ec 5.2.1.8: Peptidylprolyl isomerase.
pdb deposition date 2007-05-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00397 WW WW domain
A PF00639 Rotamase PPIC-type PPIASE domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.20.70.10 Mainly Beta Single Sheet Ubiquitin Ligase Nedd4; Chain: W; Ubiquitin Ligase Nedd4; Chain: W; 2q5aA01
3.10.50.40 Alpha Beta Roll Chitinase A; domain 3 Chitinase A; domain 3 2q5aA02
2D9FA 2KGJA 3PA7A 1PBKA 2F2DA 3PRBA 2DG9A 4DRIA 1FD9A 4QT2A 1D7JA 1QPFA 2EZ5W 2XP3A 3O5IA 1JVWA 3KZ7A 3O5EA 2YSIA 1D6OA 2XP4A 1D7HA 3TCZA 3FAPA 3O5LA 3M7NA 1FKBA 4ODRA 3O5RA 2MPHA 1FKKA 3NTPA 1TCOC 2Q5AA 1NMWA 3KCEA 1Q6UA 4DZ2A 1YATA 2MLZA 1F8AB 2RE3A 3O5PA 4LAVA 3RGCA 2XP5A 4DT4A 3H9RB 1EYMA 3UF8A 2XP7A 4DROA 1KT1A 2ZR4A 3TDBA 3KAFA 3MDYB 4W9PA 4IPXA 5HWCA 4DRQA 3CGNA 2VN1A 2LAJA 2XPAA 1FKFA 4IQCA 4DRPA 1I5HW 2PBCA 1ROTA 1EQ3A 2LJ4A 5GPGA 1TK7A 2DWVA 5DIVA 1B6CA 3NRKA 3UQAA 3LE4A 3O5QA 4TW7A 5DITA 1P5QA 4U86A 5HUAA 1JNSA 2JMFA 2JX8A 2KR7A 2M2AA 2PV3A 1K9QA 1D7IA 2PV2A 3VAWA 1EG3A 1R9HA 3IHZA 2PPOA 2MNTA 2RUQA 5HT1A 4DRMA 4DZ3A 3IK8A 4NNRA 1U79A 3CNGA 2M8IA 2LKNA 1Q6HA 5AHTA 2DG4A 4LAYA 2DK7A 4C02B 2M1IA 5HWBA 2UZ5A 3KAIA 5D75A 4FAPA 4ODMA 4JFIA 1FKJA 1Q6IA 1NSGA 3O5OA 4LAWA 4TW6A 4ITZA 3O5KA 2F21A 2AWGA 4W9QA 4LAXA 3IKDA 1W26A 2KFWA 4GGQA 2YSBA 2E45A 4FN2A 3KADA 2VCDA 2JV4A 4E5RA 1Y0OA 2JXWA 1FKHA 2L4JA 3I6CA 1PINA 2DJYA 2OFNA 2PV1A 3NI6A 3O5DA 3PRDA 4G50A 4W9OA 4MSPA 4DH0A 2M3OW 2XPBA 1FKGA 1QPLA 3O5MA 4DRJA 2FAPA 1FKTA 1T11A 5HW7A 2RSEA 3EY6A 2IF4A 3LUOA 2XP8A 2ZQSA 3IKGA 1NMVA 5B8IC 2KO7A 4U84A 3ODKA 2YSGA 3CGMA 3O5JA 5HW8A 1FAPA 2XP9A 2FKEA 1C9HA 1FKIA 1EG4A 2L2SA 2RUDA 2RURA 1J6YA 4QT3A 2MLXA 4TX0A 3JXVA 5BXJA 2MLYA 3M85A 5HW6A 3L4HA 4IQ2A 1ROUA 1JNTA 1FKRA 3UQBA 1FKSA 5I98A 3KAGA 1JMQA 1Q1CA 2ZAJA 2RQSA 3UI5A 3UI4A 4BF8A 2ITKA 3GPKA 4TW8A 2N87A 2ZQTA 3KABA 2Y78A 2XP6A 3O5FA 3OOBA 3UQIA 5DIUA 4DRNA 3RFWA 4ODLA 4U85A 1ZK6A 4ODNA 1ZCNA 1FJDA 1YW5A 2MF9A 1WMVA 2KI3A 2M8JA 1QZ2A 3KAHA 4JFMA 5CQ2A 2LPVA 3B7XA 1FKLA 4TNSA 1J4IA 1KT0A 2M08A 5J6EA 3KACA 4ODPA 4R0XA 3TC5A 1WR7A 2KE0A 4J4NA 2ZR6A 4ODQA 2BA1A 3O5GA 2ZQUA 2K8IA 5HKGA 4DRKA 1HXVA 1M5YA 4JFKA 4DIPA 3UI6A 1N1AA 4J4OA 4QIBA 5HTGA 1A7XA 4REXA 2RUCA 2PPPA 2PPNA 4MGVA 1K9RA 1J4HA 4N19A 1F40A 2YSHA 2F4EA 3JYMA 3JYJA 4JFLA 2KXQA 1L1PA 1O6WA 4JFJA 4O2TA 2YSFA 2ZR5A 1BKFA 2DK1A 2LGOA 4DRHA 4G2PA 2DG3A 4GIVA 1FKDA 4JYSA 2JZVA 3WH0A 1BL4A 1J4RA 4ODOA 4TYOA 2ZQVA 2MDIA 4ODKA 2DMVA
chains in the Genus database with same CATH superfamily
2KGJA 3PA7A 4DRIA 1ZU8A 1H0IA 1LJYA 3O5IA 3CZ8A 1JVWA 1D7HA 1D6OA 2XP4A 3WKZA 2WADA 4ODRA 2MPHA 1GUVA 5E5WA 1ZL1A 4MTVA 3ARQA 2WLZA 4AY1A 3O5PA 2RE3A 1NWTA 1W1TA 2G8ZA 1FFRA 2ZR4A 1E44A 5HWCA 3CGNA 2VN1A 1GOIA 1ROTA 5GPGA 3LE4A 4ZPTR 1P5QA 3ARWA 4MNLA 2PV3A 5DO2A 5GQBA 1R9HA 5DEZA 4NNRA 5AHTA 2DK7A 4HARA 3FY1A 4JFIA 4NZCA 1Q6IA 4LAWA 2DT0A 1ZBCA 4W9QA 4LAXA 3MCBB 3WQVA 4HBOA 2E45A 4A0UA 1Y0OA 2JXWA 4J4OA 2L4JA 4WKHA 1PINA 2PV1A 2OFNA 4W9OA 3NI6A 4DRMA 3WQWA 4MSPA 2M3OW 2XPBA 2IF4A 3LUOA 1FKIA 1EG4A 2RURA 5BXJA 2MLYA 3M85A 1ROUA 3UQBA 2G41A 3UI4A 3UQIA 4LGXA 4ODLA 3MQGA 1W9UA 2WLYA 5GPRA 1WMVA 1OWQA 3B9DA 2KI3A 2YBTA 4DWSD 1QZ2A 3KAHA 3B9EA 2LPVA 3B7XA 1FKLA 1LL4A 4ZPWR 3CH9A 4ODPA 3TC5A 1WR7A 2QRVA 4J4NA 4ODQA 2BA1A 1RD6A 3CHCA 3MQHA 1W9VA 5HTGA 4REXA 2PPNA 1F40A 2AOSA 1TR8A 1NWRA 3ARVA 2ZR5A 1BKFA 1WAWA 3CHEA 4GIVA 3RM4A 1FKDA 1J4RA 3GU0A 2DMVA 1X6NA 1FLCA 2D9FA 1PBKA 2F2DA 2QF8A 3O5EA 2YSIA 3TCZA 3FAPA 3ALGA 1ZBWA 3O5RA 1GRJA 1FFQA 2Q5AA 1NMWA 3RGCA 5JH8A 3ARRA 5E64A 3TDBA 3ARZA 4DRQA 5U47A 2LAJA 1FKFA 4A0TA 2DPEA 5DF0A 2A3CA 1JNEA 1TK7A 3UQAA 3O5QA 4Z2HA 4ZPVR 2PV2A 3IHZA 2DSUA 2O9OA 2MNTA 1WB0A 3IK8A 1ITXA 1NH6A 5D75A 3RM8A 2PN0A 1D2KA 1XRVA 3FS8A 1HJXA 4GGQA 3KADA 2VCDA 3G6MA 2JV4A 3O5DA 3I6CA 4G50A 4DH0A 1EHNA 4DRJA 2A3AA 3ALFA 2ESCA 2FDMA 3EY6A 2XP8A 2ZQSA 5B8IC 4IT4A 4U84A 3ODKA 2WM0A 2L2SA 2FKEA 4QT3A 4TX0A 1EIBA 1JNTA 1SR0A 1JMQA 4BF8A 2ITKA 2N87A 2ZQTA 4UDMA 1CTNA 3RFWA 4ODNA 1ZCNA 4P8UA 4WKFA 2MF9A 1IX5A 1E6RA 1HKKA 4ML4A 1J4IA 1KT0A 2M08A 3KACA 4R0XA 2O92A 3ARTA 4Z2IA 2ZR6A 3O5GA 2K8IA 3UI6A 3WD2A 3EIPA 1HKJA 2PPPA 4MGVA 2YSHA 4JFLA 3JYJA 2WK2A 4XAKA 2KXQA 4DWSB 1ZBVA 1XHGA 2YSFA 2DK1A 1VF8A 3WIJA 3ARPA 4JYSA 4ODOA 2PI6A 2YBUA 2MDIA 3O5KA 3W4RA 2DG9A 1RP5A 4QZVB 4QT2A 1D7JA 1LL6A 1QPFA 2EZ5W 2XP3A 1FKBA 3FXYA 1FKKA 1TCOC 1W1VA 1Q6UA 1YATA 1F8AB 4DT4A 4DWSA 3BXWA 3H9RB 4WIWA 2XP7A 4DROA 1KT1A 4W9PA 3MDYB 4IPXA 3AS1A 3LKXB 4W5UA 1I5HW 1EQ3A 1O6IA 2LJ4A 2DWVA 3NRKA 4TW7A 5HUAA 2DT1A 2JX8A 2KR7A 2M2AA 3ARYA 1K9QA 3AS2A 1D7IA 3VAWA 5HT1A 3FSBA 2OLHA 3CNGA 2M8IA 2LKNA 4LAYA 2UZ5A 3KAIA 4FAPA 4ODMA 1E15A 4TW6A 3BMBA 4ITZA 2AWGA 1W26A 1GPFA 1OGBA 2P4VA 4Q7NA 3CHFA 3ARXA 3PRDA 5E62A 2DJYA 1W9PA 4R5EA 1KFWA 4DWSC 4P8WA 1FKTA 1T11A 2F23A 4Q22A 2B5UB 2DT3A 2RSEA 3B8SA 5HW7A 3WD1A 4HBEA 2A3EA 4ZS6A 3IKGA 3CGMA 5HW8A 2YSGA 3WD0A 2XP9A 1C9HA 2RUDA 4MPKA 2MLXA 4S3JA 5HW6A 1FKRA 1FKSA 3MCBA 2ZAJA 1Q1CA 2RQSA 3ARUA 4TW8A 2Y78A 5DIUA 1LQ0A 3AQUA 4U85A 1ZK6A 1FJDA 1YW5A 3AROA 1NWSA 2M8JA 1UR9A 5J6EA 1TFVA 2DSVA 1W1PA 5HKGA 1HXVA 4DRKA 1M5YA 2IUZA 4JFKA 4DIPA 3QOKA 1N1AA 4QIBA 2RUCA 1J4HA 1K9TA 1H0GA 2DSZA 1ZB5A 3PQHA 2LGOA 3WD4A 2DSWA 4MNMA 4TYOA 1BL4A 3GTYX 4ODKA 3PRBA 1FD9A 2EULA 4MAVA 2WAEA 3KZ7A 3WL0A 3O5LA 3M7NA 3ARSA 4L3NA 5HBFA 3NTPA 4DZ2A 3KCEA 2MLZA 4LAVA 2XP5A 1E6NA 1EYMA 1ZBKA 3UF8A 3WL1A 3KAFA 1JCHB 4PTMA 4MNJA 2XPAA 4DRPA 4IQCA 1EDQA 2PBCA 4Z2JA 1JNDA 1LL7A 5DIVA 1B6CA 1E9LA 5DITA 1JNSA 4U86A 4S3KA 2JMFA 1EG3A 3PR9A 2PPOA 4DZ3A 2RUQA 1E6PA 1U79A 1Q6HA 2DG4A 4C02B 3FSCA 2M1IA 5HWBA 1NWUA 3B9AA 1FKJA 1NSGA 3O5OA 2F21A 4NSBA 3IKDA 2KFWA 3WD3A 2YSBA 3CHDA 4FN2A 2YAJB 4E5RA 3AS0A 1FKHA 1W1YA 1LG1A 1OGGA 1FKGA 3O5MA 1QPLA 4MNKA 2FAPA 1SYTA 1HKIA 5E65A 4IT6A 1WNOA 4KR0B 4P8XA 1NMVA 2Y8NB 3PRAA 2KO7A 3O5JA 1FAPA 1J6YA 4WK9A 1X6LA 3JXVA 4Z2KA 4P8VA 3L4HA 4IQ2A 5I98A 3KAGA 3UI5A 3GPKA 3RM9A 3KABA 3O5FA 2XP6A 1HKMA 3OOBA 5E66A 4DRNA 4Z2GA 1UR8A 1E6ZA 4WJXA 4GLXA 2OWOA 3OA5A 4JFMA 5CQ2A 4TNSA 1HJWA 2A3BA 2KE0A 3AS3A 4Z2LA 2ZQUA 4L72B 1A7XA 1LG2A 1K9RA 4N19A 2F4EA 3JYMA 1HJVA 4KQZA 2DT2A 1L1PA 1O6WA 4JFJA 4O2TA 3LKXA 4DRHA 4G2PA 4WKAA 2DG3A 3RMEA 2B31A 3G6LA 2ETNA 2JZVA 3WH0A 4URIA 2ZQVA
chains in the Genus database with same CATH topology
2KGJA 3PA7A 4DRIA 1ZU8A 1H0IA 1LJYA 3O5IA 3CZ8A 1JVWA 1D7HA 1D6OA 2XP4A 3WKZA 2WADA 4ODRA 2MPHA 1GUVA 5E5WA 1ZL1A 4MTVA 3ARQA 2WLZA 4AY1A 3O5PA 2RE3A 1NWTA 1W1TA 2G8ZA 1FFRA 2ZR4A 5HWCA 3CGNA 2VN1A 1GOIA 1ROTA 5GPGA 3LE4A 4ZPTR 1P5QA 3ARWA 4MNLA 2PV3A 5DO2A 5GQBA 1R9HA 5DEZA 4NNRA 5AHTA 2DK7A 4HARA 3FY1A 4JFIA 4NZCA 1Q6IA 4LAWA 2DT0A 1ZBCA 4W9QA 4LAXA 3MCBB 3WQVA 4HBOA 2E45A 4A0UA 1Y0OA 2JXWA 4J4OA 2L4JA 4WKHA 1PINA 2PV1A 2OFNA 4W9OA 3NI6A 4DRMA 3WQWA 4MSPA 2M3OW 2XPBA 2IF4A 3LUOA 1FKIA 1EG4A 2RURA 5BXJA 2MLYA 3M85A 1ROUA 3UQBA 2G41A 3UI4A 3UQIA 4LGXA 4ODLA 3MQGA 1W9UA 2WLYA 5GPRA 1WMVA 1OWQA 3B9DA 2KI3A 2YBTA 4DWSD 1QZ2A 3KAHA 3B9EA 2LPVA 3B7XA 1FKLA 1LL4A 4ZPWR 3CH9A 4ODPA 3TC5A 1WR7A 2QRVA 4J4NA 4ODQA 2BA1A 1RD6A 3CHCA 3MQHA 1W9VA 5HTGA 4REXA 2PPNA 1F40A 2AOSA 1TR8A 1NWRA 3ARVA 2ZR5A 1BKFA 1WAWA 3CHEA 4GIVA 3RM4A 1FKDA 1J4RA 2DMVA 1X6NA 1FLCA 2D9FA 1PBKA 2F2DA 2QF8A 3O5EA 2YSIA 3TCZA 3FAPA 3ALGA 1ZBWA 3O5RA 1FFQA 2Q5AA 1NMWA 3RGCA 5JH8A 3ARRA 5E64A 3TDBA 3ARZA 4DRQA 5U47A 2LAJA 1FKFA 4A0TA 2DPEA 5DF0A 2A3CA 1JNEA 1TK7A 3UQAA 3O5QA 4Z2HA 4ZPVR 2PV2A 3IHZA 2DSUA 2O9OA 2MNTA 1WB0A 3IK8A 1ITXA 1NH6A 5D75A 3RM8A 1D2KA 1XRVA 3FS8A 1HJXA 4GGQA 3KADA 2VCDA 3G6MA 2JV4A 3O5DA 3I6CA 4G50A 4DH0A 1EHNA 4DRJA 2A3AA 3ALFA 2ESCA 2FDMA 3EY6A 2XP8A 2ZQSA 5B8IC 4IT4A 4U84A 3ODKA 2WM0A 2L2SA 2FKEA 4QT3A 4TX0A 1EIBA 1JNTA 1SR0A 1JMQA 4BF8A 2ITKA 2N87A 2ZQTA 1CTNA 3RFWA 4ODNA 1ZCNA 4P8UA 4WKFA 2MF9A 1IX5A 1E6RA 1HKKA 4ML4A 1J4IA 1KT0A 2M08A 3KACA 4R0XA 2O92A 3ARTA 4Z2IA 2ZR6A 3O5GA 2K8IA 3UI6A 3WD2A 1HKJA 2PPPA 4MGVA 2YSHA 4JFLA 3JYJA 2WK2A 4XAKA 2KXQA 4DWSB 1ZBVA 1XHGA 2YSFA 2DK1A 1VF8A 3WIJA 3ARPA 4JYSA 4ODOA 2PI6A 2YBUA 2MDIA 3O5KA 3W4RA 2DG9A 1RP5A 4QZVB 4QT2A 1D7JA 1LL6A 1QPFA 2EZ5W 2XP3A 1FKBA 3FXYA 1FKKA 1TCOC 1W1VA 1Q6UA 1YATA 1F8AB 4DT4A 4DWSA 3BXWA 3H9RB 4WIWA 2XP7A 4DROA 1KT1A 4W9PA 3MDYB 4IPXA 3AS1A 3LKXB 4W5UA 1I5HW 1EQ3A 1O6IA 2LJ4A 2DWVA 3NRKA 4TW7A 5HUAA 2DT1A 2JX8A 2KR7A 2M2AA 3ARYA 1K9QA 3AS2A 1D7IA 3VAWA 5HT1A 3FSBA 2OLHA 3CNGA 2M8IA 2LKNA 4LAYA 2UZ5A 3KAIA 4FAPA 4ODMA 1E15A 4TW6A 4ITZA 2AWGA 1W26A 1GPFA 1OGBA 4Q7NA 3CHFA 3ARXA 3PRDA 5E62A 2DJYA 1W9PA 4R5EA 1KFWA 4DWSC 4P8WA 1FKTA 1T11A 5HW7A 4Q22A 2DT3A 2RSEA 3B8SA 3WD1A 4HBEA 2A3EA 4ZS6A 3IKGA 3CGMA 5HW8A 2YSGA 3WD0A 2XP9A 1C9HA 2RUDA 4MPKA 2MLXA 4S3JA 5HW6A 1FKRA 1FKSA 3MCBA 2ZAJA 1Q1CA 2RQSA 3ARUA 4TW8A 2Y78A 5DIUA 1LQ0A 3AQUA 4U85A 1ZK6A 1FJDA 1YW5A 3AROA 1NWSA 2M8JA 1UR9A 5J6EA 1TFVA 2DSVA 1W1PA 5HKGA 1HXVA 4DRKA 1M5YA 2IUZA 4JFKA 4DIPA 3QOKA 1N1AA 4QIBA 2RUCA 1J4HA 1K9TA 1H0GA 2DSZA 1ZB5A 3PQHA 2LGOA 3WD4A 2DSWA 4MNMA 4TYOA 1BL4A 4ODKA 3PRBA 1FD9A 4MAVA 2WAEA 3KZ7A 3WL0A 3O5LA 3M7NA 3ARSA 4L3NA 5HBFA 3NTPA 4DZ2A 3KCEA 2MLZA 4LAVA 2XP5A 1E6NA 1EYMA 1ZBKA 3UF8A 3WL1A 3KAFA 4PTMA 4MNJA 2XPAA 4DRPA 4IQCA 1EDQA 2PBCA 4Z2JA 1JNDA 1LL7A 5DIVA 1B6CA 1E9LA 5DITA 1JNSA 4U86A 4S3KA 2JMFA 1EG3A 3PR9A 2PPOA 4DZ3A 2RUQA 1E6PA 1U79A 1Q6HA 2DG4A 4C02B 3FSCA 2M1IA 5HWBA 1NWUA 3B9AA 1FKJA 1NSGA 3O5OA 2F21A 4NSBA 3IKDA 2KFWA 3WD3A 2YSBA 3CHDA 4FN2A 2YAJB 4E5RA 3AS0A 1FKHA 1W1YA 1LG1A 1OGGA 1FKGA 3O5MA 1QPLA 4MNKA 2FAPA 1SYTA 1HKIA 5E65A 4IT6A 1WNOA 4KR0B 4P8XA 1NMVA 2Y8NB 3PRAA 2KO7A 3O5JA 1FAPA 1J6YA 4WK9A 1X6LA 3JXVA 4Z2KA 4P8VA 3L4HA 4IQ2A 5I98A 3KAGA 3UI5A 3GPKA 3RM9A 3KABA 3O5FA 2XP6A 1HKMA 3OOBA 5E66A 4DRNA 4Z2GA 1UR8A 1E6ZA 4WJXA 4GLXA 2OWOA 3OA5A 4JFMA 5CQ2A 4TNSA 1HJWA 2A3BA 2KE0A 3AS3A 4Z2LA 2ZQUA 4L72B 1A7XA 1LG2A 1K9RA 4N19A 2F4EA 3JYMA 1HJVA 4KQZA 2DT2A 1L1PA 1O6WA 4JFJA 4O2TA 3LKXA 4DRHA 4G2PA 4WKAA 2DG3A 3RMEA 2B31A 3G6LA 2JZVA 3WH0A 4URIA 2ZQVA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2D9F A;  2KGJ A;  3PA7 A;  1PBK A;  2F2D A;  3PRB A;  2DG9 A;  4DRI A;  1FD9 A;  4QT2 A;  1D7J A;  1QPF A;  2EZ5 W;  2XP3 A;  3O5I A;  1JVW A;  3KZ7 A;  3O5E A;  2YSI A;  1D6O A;  2XP4 A;  1D7H A;  3TCZ A;  3FAP A;  3O5L A;  3M7N A;  1FKB A;  4ODR A;  3O5R A;  2MPH A;  1FKK A;  3NTP A;  1TCO C;  2Q5A A;  1NMW A;  3KCE A;  1Q6U A;  4DZ2 A;  1YAT A;  2MLZ A;  1F8A B;  2RE3 A;  3O5P A;  4LAV A;  3RGC A;  2XP5 A;  4DT4 A;  3H9R B;  1EYM A;  3UF8 A;  2XP7 A;  4DRO A;  1KT1 A;  2ZR4 A;  3TDB A;  3KAF A;  3MDY B;  4W9P A;  4IPX A;  5HWC A;  4DRQ A;  3CGN A;  2VN1 A;  2LAJ A;  2XPA A;  1FKF A;  4IQC A;  4DRP A;  1I5H W;  2PBC A;  1ROT A;  1EQ3 A;  2LJ4 A;  5GPG A;  1TK7 A;  2DWV A;  5DIV A;  1B6C A;  3NRK A;  3UQA A;  3LE4 A;  3O5Q A;  4TW7 A;  5DIT A;  1P5Q A;  4U86 A;  5HUA A;  1JNS A;  2JMF A;  2JX8 A;  2KR7 A;  2M2A A;  2PV3 A;  1K9Q A;  1D7I A;  2PV2 A;  3VAW A;  1EG3 A;  1R9H A;  3IHZ A;  2PPO A;  2MNT A;  2RUQ A;  5HT1 A;  4DRM A;  4DZ3 A;  3IK8 A;  4NNR A;  1U79 A;  3CNG A;  2M8I A;  2LKN A;  1Q6H A;  5AHT A;  2DG4 A;  4LAY A;  2DK7 A;  4C02 B;  2M1I A;  5HWB A;  2UZ5 A;  3KAI A;  5D75 A;  4FAP A;  4ODM A;  4JFI A;  1FKJ A;  1Q6I A;  1NSG A;  3O5O A;  4LAW A;  4TW6 A;  4ITZ A;  3O5K A;  2F21 A;  2AWG A;  4W9Q A;  4LAX A;  3IKD A;  1W26 A;  2KFW A;  4GGQ A;  2YSB A;  2E45 A;  4FN2 A;  3KAD A;  2VCD A;  2JV4 A;  4E5R A;  1Y0O A;  2JXW A;  1FKH A;  2L4J A;  3I6C A;  1PIN A;  2DJY A;  2OFN A;  2PV1 A;  3NI6 A;  3O5D A;  3PRD A;  4G50 A;  4W9O A;  4MSP A;  4DH0 A;  2M3O W;  2XPB A;  1FKG A;  1QPL A;  3O5M A;  4DRJ A;  2FAP A;  1FKT A;  1T11 A;  5HW7 A;  2RSE A;  3EY6 A;  2IF4 A;  3LUO A;  2XP8 A;  2ZQS A;  3IKG A;  1NMV A;  5B8I C;  2KO7 A;  4U84 A;  3ODK A;  2YSG A;  3CGM A;  3O5J A;  5HW8 A;  1FAP A;  2XP9 A;  2FKE A;  1C9H A;  1FKI A;  1EG4 A;  2L2S A;  2RUD A;  2RUR A;  1J6Y A;  4QT3 A;  2MLX A;  4TX0 A;  3JXV A;  5BXJ A;  2MLY A;  3M85 A;  5HW6 A;  3L4H A;  4IQ2 A;  1ROU A;  1JNT A;  1FKR A;  3UQB A;  1FKS A;  5I98 A;  3KAG A;  1JMQ A;  1Q1C A;  2ZAJ A;  2RQS A;  3UI5 A;  3UI4 A;  4BF8 A;  2ITK A;  3GPK A;  4TW8 A;  2N87 A;  2ZQT A;  3KAB A;  2Y78 A;  2XP6 A;  3O5F A;  3OOB A;  3UQI A;  5DIU A;  4DRN A;  3RFW A;  4ODL A;  4U85 A;  1ZK6 A;  4ODN A;  1ZCN A;  1FJD A;  1YW5 A;  2MF9 A;  1WMV A;  2KI3 A;  2M8J A;  1QZ2 A;  3KAH A;  4JFM A;  5CQ2 A;  2LPV A;  3B7X A;  1FKL A;  4TNS A;  1J4I A;  1KT0 A;  2M08 A;  5J6E A;  3KAC A;  4ODP A;  4R0X A;  3TC5 A;  1WR7 A;  2KE0 A;  4J4N A;  2ZR6 A;  4ODQ A;  2BA1 A;  3O5G A;  2ZQU A;  2K8I A;  5HKG A;  4DRK A;  1HXV A;  1M5Y A;  4JFK A;  4DIP A;  3UI6 A;  1N1A A;  4J4O A;  4QIB A;  5HTG A;  1A7X A;  4REX A;  2RUC A;  2PPP A;  2PPN A;  4MGV A;  1K9R A;  1J4H A;  4N19 A;  1F40 A;  2YSH A;  2F4E A;  3JYM A;  3JYJ A;  4JFL A;  2KXQ A;  1L1P A;  1O6W A;  4JFJ A;  4O2T A;  2YSF A;  2ZR5 A;  1BKF A;  2DK1 A;  2LGO A;  4DRH A;  4G2P A;  2DG3 A;  4GIV A;  1FKD A;  4JYS A;  2JZV A;  3WH0 A;  1BL4 A;  1J4R A;  4ODO A;  4TYO A;  2ZQV A;  2MDI A;  4ODK A;  2DMV A; 
#chains in the Genus database with same CATH topology
 2KGJ A;  3PA7 A;  4DRI A;  1ZU8 A;  1H0I A;  1LJY A;  3O5I A;  3CZ8 A;  1JVW A;  1D7H A;  1D6O A;  2XP4 A;  3WKZ A;  2WAD A;  4ODR A;  2MPH A;  1GUV A;  5E5W A;  1ZL1 A;  4MTV A;  3ARQ A;  2WLZ A;  4AY1 A;  3O5P A;  2RE3 A;  1NWT A;  1W1T A;  2G8Z A;  1FFR A;  2ZR4 A;  1E44 A;  5HWC A;  3CGN A;  2VN1 A;  1GOI A;  1ROT A;  5GPG A;  3LE4 A;  4ZPT R;  1P5Q A;  3ARW A;  4MNL A;  2PV3 A;  5DO2 A;  5GQB A;  1R9H A;  5DEZ A;  4NNR A;  5AHT A;  2DK7 A;  4HAR A;  3FY1 A;  4JFI A;  4NZC A;  1Q6I A;  4LAW A;  2DT0 A;  1ZBC A;  4W9Q A;  4LAX A;  3MCB B;  3WQV A;  4HBO A;  2E45 A;  4A0U A;  1Y0O A;  2JXW A;  4J4O A;  2L4J A;  4WKH A;  1PIN A;  2PV1 A;  2OFN A;  4W9O A;  3NI6 A;  4DRM A;  3WQW A;  4MSP A;  2M3O W;  2XPB A;  2IF4 A;  3LUO A;  1FKI A;  1EG4 A;  2RUR A;  5BXJ A;  2MLY A;  3M85 A;  1ROU A;  3UQB A;  2G41 A;  3UI4 A;  3UQI A;  4LGX A;  4ODL A;  3MQG A;  1W9U A;  2WLY A;  5GPR A;  1WMV A;  1OWQ A;  3B9D A;  2KI3 A;  2YBT A;  4DWS D;  1QZ2 A;  3KAH A;  3B9E A;  2LPV A;  3B7X A;  1FKL A;  1LL4 A;  4ZPW R;  3CH9 A;  4ODP A;  3TC5 A;  1WR7 A;  2QRV A;  4J4N A;  4ODQ A;  2BA1 A;  1RD6 A;  3CHC A;  3MQH A;  1W9V A;  5HTG A;  4REX A;  2PPN A;  1F40 A;  2AOS A;  1TR8 A;  1NWR A;  3ARV A;  2ZR5 A;  1BKF A;  1WAW A;  3CHE A;  4GIV A;  3RM4 A;  1FKD A;  1J4R A;  3GU0 A;  2DMV A;  1X6N A;  1FLC A;  2D9F A;  1PBK A;  2F2D A;  2QF8 A;  3O5E A;  2YSI A;  3TCZ A;  3FAP A;  3ALG A;  1ZBW A;  3O5R A;  1GRJ A;  1FFQ A;  2Q5A A;  1NMW A;  3RGC A;  5JH8 A;  3ARR A;  5E64 A;  3TDB A;  3ARZ A;  4DRQ A;  5U47 A;  2LAJ A;  1FKF A;  4A0T A;  2DPE A;  5DF0 A;  2A3C A;  1JNE A;  1TK7 A;  3UQA A;  3O5Q A;  4Z2H A;  4ZPV R;  2PV2 A;  3IHZ A;  2DSU A;  2O9O A;  2MNT A;  1WB0 A;  3IK8 A;  1ITX A;  1NH6 A;  5D75 A;  3RM8 A;  2PN0 A;  1D2K A;  1XRV A;  3FS8 A;  1HJX A;  4GGQ A;  3KAD A;  2VCD A;  3G6M A;  2JV4 A;  3O5D A;  3I6C A;  4G50 A;  4DH0 A;  1EHN A;  4DRJ A;  2A3A A;  3ALF A;  2ESC A;  2FDM A;  3EY6 A;  2XP8 A;  2ZQS A;  5B8I C;  4IT4 A;  4U84 A;  3ODK A;  2WM0 A;  2L2S A;  2FKE A;  4QT3 A;  4TX0 A;  1EIB A;  1JNT A;  1SR0 A;  1JMQ A;  4BF8 A;  2ITK A;  2N87 A;  2ZQT A;  4UDM A;  1CTN A;  3RFW A;  4ODN A;  1ZCN A;  4P8U A;  4WKF A;  2MF9 A;  1IX5 A;  1E6R A;  1HKK A;  4ML4 A;  1J4I A;  1KT0 A;  2M08 A;  3KAC A;  4R0X A;  2O92 A;  3ART A;  4Z2I A;  2ZR6 A;  3O5G A;  2K8I A;  3UI6 A;  3WD2 A;  3EIP A;  1HKJ A;  2PPP A;  4MGV A;  2YSH A;  4JFL A;  3JYJ A;  2WK2 A;  4XAK A;  2KXQ A;  4DWS B;  1ZBV A;  1XHG A;  2YSF A;  2DK1 A;  1VF8 A;  3WIJ A;  3ARP A;  4JYS A;  4ODO A;  2PI6 A;  2YBU A;  2MDI A;  3O5K A;  3W4R A;  2DG9 A;  1RP5 A;  4QZV B;  4QT2 A;  1D7J A;  1LL6 A;  1QPF A;  2EZ5 W;  2XP3 A;  1FKB A;  3FXY A;  1FKK A;  1TCO C;  1W1V A;  1Q6U A;  1YAT A;  1F8A B;  4DT4 A;  4DWS A;  3BXW A;  3H9R B;  4WIW A;  2XP7 A;  4DRO A;  1KT1 A;  4W9P A;  3MDY B;  4IPX A;  3AS1 A;  3LKX B;  4W5U A;  1I5H W;  1EQ3 A;  1O6I A;  2LJ4 A;  2DWV A;  3NRK A;  4TW7 A;  5HUA A;  2DT1 A;  2JX8 A;  2KR7 A;  2M2A A;  3ARY A;  1K9Q A;  3AS2 A;  1D7I A;  3VAW A;  5HT1 A;  3FSB A;  2OLH A;  3CNG A;  2M8I A;  2LKN A;  4LAY A;  2UZ5 A;  3KAI A;  4FAP A;  4ODM A;  1E15 A;  4TW6 A;  3BMB A;  4ITZ A;  2AWG A;  1W26 A;  1GPF A;  1OGB A;  2P4V A;  4Q7N A;  3CHF A;  3ARX A;  3PRD A;  5E62 A;  2DJY A;  1W9P A;  4R5E A;  1KFW A;  4DWS C;  4P8W A;  1FKT A;  1T11 A;  2F23 A;  4Q22 A;  2B5U B;  2DT3 A;  2RSE A;  3B8S A;  5HW7 A;  3WD1 A;  4HBE A;  2A3E A;  4ZS6 A;  3IKG A;  3CGM A;  5HW8 A;  2YSG A;  3WD0 A;  2XP9 A;  1C9H A;  2RUD A;  4MPK A;  2MLX A;  4S3J A;  5HW6 A;  1FKR A;  1FKS A;  3MCB A;  2ZAJ A;  1Q1C A;  2RQS A;  3ARU A;  4TW8 A;  2Y78 A;  5DIU A;  1LQ0 A;  3AQU A;  4U85 A;  1ZK6 A;  1FJD A;  1YW5 A;  3ARO A;  1NWS A;  2M8J A;  1UR9 A;  5J6E A;  1TFV A;  2DSV A;  1W1P A;  5HKG A;  1HXV A;  4DRK A;  1M5Y A;  2IUZ A;  4JFK A;  4DIP A;  3QOK A;  1N1A A;  4QIB A;  2RUC A;  1J4H A;  1K9T A;  1H0G A;  2DSZ A;  1ZB5 A;  3PQH A;  2LGO A;  3WD4 A;  2DSW A;  4MNM A;  4TYO A;  1BL4 A;  3GTY X;  4ODK A;  3PRB A;  1FD9 A;  2EUL A;  4MAV A;  2WAE A;  3KZ7 A;  3WL0 A;  3O5L A;  3M7N A;  3ARS A;  4L3N A;  5HBF A;  3NTP A;  4DZ2 A;  3KCE A;  2MLZ A;  4LAV A;  2XP5 A;  1E6N A;  1EYM A;  1ZBK A;  3UF8 A;  3WL1 A;  3KAF A;  1JCH B;  4PTM A;  4MNJ A;  2XPA A;  4DRP A;  4IQC A;  1EDQ A;  2PBC A;  4Z2J A;  1JND A;  1LL7 A;  5DIV A;  1B6C A;  1E9L A;  5DIT A;  1JNS A;  4U86 A;  4S3K A;  2JMF A;  1EG3 A;  3PR9 A;  2PPO A;  4DZ3 A;  2RUQ A;  1E6P A;  1U79 A;  1Q6H A;  2DG4 A;  4C02 B;  3FSC A;  2M1I A;  5HWB A;  1NWU A;  3B9A A;  1FKJ A;  1NSG A;  3O5O A;  2F21 A;  4NSB A;  3IKD A;  2KFW A;  3WD3 A;  2YSB A;  3CHD A;  4FN2 A;  2YAJ B;  4E5R A;  3AS0 A;  1FKH A;  1W1Y A;  1LG1 A;  1OGG A;  1FKG A;  3O5M A;  1QPL A;  4MNK A;  2FAP A;  1SYT A;  1HKI A;  5E65 A;  4IT6 A;  1WNO A;  4KR0 B;  4P8X A;  1NMV A;  2Y8N B;  3PRA A;  2KO7 A;  3O5J A;  1FAP A;  1J6Y A;  4WK9 A;  1X6L A;  3JXV A;  4Z2K A;  4P8V A;  3L4H A;  4IQ2 A;  5I98 A;  3KAG A;  3UI5 A;  3GPK A;  3RM9 A;  3KAB A;  3O5F A;  2XP6 A;  1HKM A;  3OOB A;  5E66 A;  4DRN A;  4Z2G A;  1UR8 A;  1E6Z A;  4WJX A;  4GLX A;  2OWO A;  3OA5 A;  4JFM A;  5CQ2 A;  4TNS A;  1HJW A;  2A3B A;  2KE0 A;  3AS3 A;  4Z2L A;  2ZQU A;  4L72 B;  1A7X A;  1LG2 A;  1K9R A;  4N19 A;  2F4E A;  3JYM A;  1HJV A;  4KQZ A;  2DT2 A;  1L1P A;  1O6W A;  4JFJ A;  4O2T A;  3LKX A;  4DRH A;  4G2P A;  4WKA A;  2DG3 A;  3RME A;  2B31 A;  3G6L A;  2ETN A;  2JZV A;  3WH0 A;  4URI A;  2ZQV A; 
#chains in the Genus database with same CATH homology
 2KGJ A;  3PA7 A;  4DRI A;  1ZU8 A;  1H0I A;  1LJY A;  3O5I A;  3CZ8 A;  1JVW A;  1D7H A;  1D6O A;  2XP4 A;  3WKZ A;  2WAD A;  4ODR A;  2MPH A;  1GUV A;  5E5W A;  1ZL1 A;  4MTV A;  3ARQ A;  2WLZ A;  4AY1 A;  3O5P A;  2RE3 A;  1NWT A;  1W1T A;  2G8Z A;  1FFR A;  2ZR4 A;  5HWC A;  3CGN A;  2VN1 A;  1GOI A;  1ROT A;  5GPG A;  3LE4 A;  4ZPT R;  1P5Q A;  3ARW A;  4MNL A;  2PV3 A;  5DO2 A;  5GQB A;  1R9H A;  5DEZ A;  4NNR A;  5AHT A;  2DK7 A;  4HAR A;  3FY1 A;  4JFI A;  4NZC A;  1Q6I A;  4LAW A;  2DT0 A;  1ZBC A;  4W9Q A;  4LAX A;  3MCB B;  3WQV A;  4HBO A;  2E45 A;  4A0U A;  1Y0O A;  2JXW A;  4J4O A;  2L4J A;  4WKH A;  1PIN A;  2PV1 A;  2OFN A;  4W9O A;  3NI6 A;  4DRM A;  3WQW A;  4MSP A;  2M3O W;  2XPB A;  2IF4 A;  3LUO A;  1FKI A;  1EG4 A;  2RUR A;  5BXJ A;  2MLY A;  3M85 A;  1ROU A;  3UQB A;  2G41 A;  3UI4 A;  3UQI A;  4LGX A;  4ODL A;  3MQG A;  1W9U A;  2WLY A;  5GPR A;  1WMV A;  1OWQ A;  3B9D A;  2KI3 A;  2YBT A;  4DWS D;  1QZ2 A;  3KAH A;  3B9E A;  2LPV A;  3B7X A;  1FKL A;  1LL4 A;  4ZPW R;  3CH9 A;  4ODP A;  3TC5 A;  1WR7 A;  2QRV A;  4J4N A;  4ODQ A;  2BA1 A;  1RD6 A;  3CHC A;  3MQH A;  1W9V A;  5HTG A;  4REX A;  2PPN A;  1F40 A;  2AOS A;  1TR8 A;  1NWR A;  3ARV A;  2ZR5 A;  1BKF A;  1WAW A;  3CHE A;  4GIV A;  3RM4 A;  1FKD A;  1J4R A;  2DMV A;  1X6N A;  1FLC A;  2D9F A;  1PBK A;  2F2D A;  2QF8 A;  3O5E A;  2YSI A;  3TCZ A;  3FAP A;  3ALG A;  1ZBW A;  3O5R A;  1FFQ A;  2Q5A A;  1NMW A;  3RGC A;  5JH8 A;  3ARR A;  5E64 A;  3TDB A;  3ARZ A;  4DRQ A;  5U47 A;  2LAJ A;  1FKF A;  4A0T A;  2DPE A;  5DF0 A;  2A3C A;  1JNE A;  1TK7 A;  3UQA A;  3O5Q A;  4Z2H A;  4ZPV R;  2PV2 A;  3IHZ A;  2DSU A;  2O9O A;  2MNT A;  1WB0 A;  3IK8 A;  1ITX A;  1NH6 A;  5D75 A;  3RM8 A;  1D2K A;  1XRV A;  3FS8 A;  1HJX A;  4GGQ A;  3KAD A;  2VCD A;  3G6M A;  2JV4 A;  3O5D A;  3I6C A;  4G50 A;  4DH0 A;  1EHN A;  4DRJ A;  2A3A A;  3ALF A;  2ESC A;  2FDM A;  3EY6 A;  2XP8 A;  2ZQS A;  5B8I C;  4IT4 A;  4U84 A;  3ODK A;  2WM0 A;  2L2S A;  2FKE A;  4QT3 A;  4TX0 A;  1EIB A;  1JNT A;  1SR0 A;  1JMQ A;  4BF8 A;  2ITK A;  2N87 A;  2ZQT A;  1CTN A;  3RFW A;  4ODN A;  1ZCN A;  4P8U A;  4WKF A;  2MF9 A;  1IX5 A;  1E6R A;  1HKK A;  4ML4 A;  1J4I A;  1KT0 A;  2M08 A;  3KAC A;  4R0X A;  2O92 A;  3ART A;  4Z2I A;  2ZR6 A;  3O5G A;  2K8I A;  3UI6 A;  3WD2 A;  1HKJ A;  2PPP A;  4MGV A;  2YSH A;  4JFL A;  3JYJ A;  2WK2 A;  4XAK A;  2KXQ A;  4DWS B;  1ZBV A;  1XHG A;  2YSF A;  2DK1 A;  1VF8 A;  3WIJ A;  3ARP A;  4JYS A;  4ODO A;  2PI6 A;  2YBU A;  2MDI A;  3O5K A;  3W4R A;  2DG9 A;  1RP5 A;  4QZV B;  4QT2 A;  1D7J A;  1LL6 A;  1QPF A;  2EZ5 W;  2XP3 A;  1FKB A;  3FXY A;  1FKK A;  1TCO C;  1W1V A;  1Q6U A;  1YAT A;  1F8A B;  4DT4 A;  4DWS A;  3BXW A;  3H9R B;  4WIW A;  2XP7 A;  4DRO A;  1KT1 A;  4W9P A;  3MDY B;  4IPX A;  3AS1 A;  3LKX B;  4W5U A;  1I5H W;  1EQ3 A;  1O6I A;  2LJ4 A;  2DWV A;  3NRK A;  4TW7 A;  5HUA A;  2DT1 A;  2JX8 A;  2KR7 A;  2M2A A;  3ARY A;  1K9Q A;  3AS2 A;  1D7I A;  3VAW A;  5HT1 A;  3FSB A;  2OLH A;  3CNG A;  2M8I A;  2LKN A;  4LAY A;  2UZ5 A;  3KAI A;  4FAP A;  4ODM A;  1E15 A;  4TW6 A;  4ITZ A;  2AWG A;  1W26 A;  1GPF A;  1OGB A;  4Q7N A;  3CHF A;  3ARX A;  3PRD A;  5E62 A;  2DJY A;  1W9P A;  4R5E A;  1KFW A;  4DWS C;  4P8W A;  1FKT A;  1T11 A;  5HW7 A;  4Q22 A;  2DT3 A;  2RSE A;  3B8S A;  3WD1 A;  4HBE A;  2A3E A;  4ZS6 A;  3IKG A;  3CGM A;  5HW8 A;  2YSG A;  3WD0 A;  2XP9 A;  1C9H A;  2RUD A;  4MPK A;  2MLX A;  4S3J A;  5HW6 A;  1FKR A;  1FKS A;  3MCB A;  2ZAJ A;  1Q1C A;  2RQS A;  3ARU A;  4TW8 A;  2Y78 A;  5DIU A;  1LQ0 A;  3AQU A;  4U85 A;  1ZK6 A;  1FJD A;  1YW5 A;  3ARO A;  1NWS A;  2M8J A;  1UR9 A;  5J6E A;  1TFV A;  2DSV A;  1W1P A;  5HKG A;  1HXV A;  4DRK A;  1M5Y A;  2IUZ A;  4JFK A;  4DIP A;  3QOK A;  1N1A A;  4QIB A;  2RUC A;  1J4H A;  1K9T A;  1H0G A;  2DSZ A;  1ZB5 A;  3PQH A;  2LGO A;  3WD4 A;  2DSW A;  4MNM A;  4TYO A;  1BL4 A;  4ODK A;  3PRB A;  1FD9 A;  4MAV A;  2WAE A;  3KZ7 A;  3WL0 A;  3O5L A;  3M7N A;  3ARS A;  4L3N A;  5HBF A;  3NTP A;  4DZ2 A;  3KCE A;  2MLZ A;  4LAV A;  2XP5 A;  1E6N A;  1EYM A;  1ZBK A;  3UF8 A;  3WL1 A;  3KAF A;  4PTM A;  4MNJ A;  2XPA A;  4DRP A;  4IQC A;  1EDQ A;  2PBC A;  4Z2J A;  1JND A;  1LL7 A;  5DIV A;  1B6C A;  1E9L A;  5DIT A;  1JNS A;  4U86 A;  4S3K A;  2JMF A;  1EG3 A;  3PR9 A;  2PPO A;  4DZ3 A;  2RUQ A;  1E6P A;  1U79 A;  1Q6H A;  2DG4 A;  4C02 B;  3FSC A;  2M1I A;  5HWB A;  1NWU A;  3B9A A;  1FKJ A;  1NSG A;  3O5O A;  2F21 A;  4NSB A;  3IKD A;  2KFW A;  3WD3 A;  2YSB A;  3CHD A;  4FN2 A;  2YAJ B;  4E5R A;  3AS0 A;  1FKH A;  1W1Y A;  1LG1 A;  1OGG A;  1FKG A;  3O5M A;  1QPL A;  4MNK A;  2FAP A;  1SYT A;  1HKI A;  5E65 A;  4IT6 A;  1WNO A;  4KR0 B;  4P8X A;  1NMV A;  2Y8N B;  3PRA A;  2KO7 A;  3O5J A;  1FAP A;  1J6Y A;  4WK9 A;  1X6L A;  3JXV A;  4Z2K A;  4P8V A;  3L4H A;  4IQ2 A;  5I98 A;  3KAG A;  3UI5 A;  3GPK A;  3RM9 A;  3KAB A;  3O5F A;  2XP6 A;  1HKM A;  3OOB A;  5E66 A;  4DRN A;  4Z2G A;  1UR8 A;  1E6Z A;  4WJX A;  4GLX A;  2OWO A;  3OA5 A;  4JFM A;  5CQ2 A;  4TNS A;  1HJW A;  2A3B A;  2KE0 A;  3AS3 A;  4Z2L A;  2ZQU A;  4L72 B;  1A7X A;  1LG2 A;  1K9R A;  4N19 A;  2F4E A;  3JYM A;  1HJV A;  4KQZ A;  2DT2 A;  1L1P A;  1O6W A;  4JFJ A;  4O2T A;  3LKX A;  4DRH A;  4G2P A;  4WKA A;  2DG3 A;  3RME A;  2B31 A;  3G6L A;  2JZV A;  3WH0 A;  4URI A;  2ZQV A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...