4U86A

Human pin1 with cysteine sulfonic acid 113
Total Genus 44
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
44
sequence length
158
structure length
144
Chain Sequence
KLPPGWEKAMSRSSGRVYYFNHITNASQWERPEPARVRCSHLLVKHSQSRRPSSWRQEKITRTKEEALELINGYIQKIKSGEEDFESLASQFSDSSAKARGDLGAFSRGQMQKPFEDASFALRTGEMSGPVFTDSGIHIILRTE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Peptidyl-prolyl cis-trans isomerase NIMA-interacting 1
publication title Pin1 cysteine-113 oxidation inhibits its catalytic activity and cellular function in Alzheimer's disease.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Isomerase
total genus 44
structure length 144
sequence length 158
ec nomenclature ec 5.2.1.8: Peptidylprolyl isomerase.
pdb deposition date 2014-08-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00397 WW WW domain
A PF00639 Rotamase PPIC-type PPIASE domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.20.70.10 Mainly Beta Single Sheet Ubiquitin Ligase Nedd4; Chain: W; Ubiquitin Ligase Nedd4; Chain: W; 4u86A01
3.10.50.40 Alpha Beta Roll Chitinase A; domain 3 Chitinase A; domain 3 4u86A02
2VN1A 4J4OA 3KZ7A 2ZQUA 1D7JA 1ZK6A 4DH0A 4ODNA 1KT1A 5DITA 4GGQA 2ITKA 3M85A 1J6YA 3RGCA 2XP7A 2MPHA 3KAHA 1JNSA 2ZR6A 3WH0A 1J4RA 5D75A 5HT1A 3ODKA 4G50A 5GPGA 1NSGA 3CGNA 4DRQA 5DIUA 3O5OA 3MDYB 2JX8A 2DJYA 2RQSA 2F2DA 2DK1A 4E5RA 1ROTA 4ODMA 4DZ2A 1D6OA 1K9QA 2M08A 2PV2A 1NMWA 1FKFA 4TX0A 4W9OA 4DT4A 3LUOA 2KGJA 3CNGA 4JFMA 1EQ3A 4U85A 2YSGA 2ZQSA 3UQAA 3UI6A 1Q6IA 2PV1A 3L4HA 2L2SA 2LGOA 4O2TA 4FN2A 1R9HA 4JYSA 1KT0A 2JMFA 2VCDA 1N1AA 4N19A 2KE0A 2F4EA 3O5RA 4ODLA 4JFKA 3TCZA 2FAPA 2RUQA 2YSHA 2PPNA 2M3OW 3RFWA 2ZR4A 3O5FA 2XP5A 1K9RA 1Q6HA 2DG3A 2XP3A 1FAPA 2K8IA 4JFLA 4ODPA 4W9QA 2XP4A 1FKTA 3VAWA 1QPFA 3B7XA 2KXQA 1BL4A 2PPOA 4ODKA 4DRIA 3H9RB 5HKGA 5HW8A 3O5LA 3O5JA 1D7HA 3IHZA 3O5GA 4MGVA 2Q5AA 1O6WA 3TC5A 1FKBA 1FJDA 1D7IA 1J4HA 1T11A 2JXWA 3NI6A 2DG4A 2JZVA 4LAXA 3KAFA 2PBCA 3TDBA 2MLYA 2MLZA 4DRJA 2RUCA 2JV4A 3EY6A 1HXVA 2BA1A 3LE4A 4IPXA 3O5DA 1FKSA 2DG9A 1WMVA 1YW5A 4REXA 2KFWA 3CGMA 5AHTA 3PRDA 3O5PA 1FKGA 1TK7A 4DRHA 4JFIA 2YSBA 3M7NA 1PINA 4QT2A 2XP9A 1ZCNA 4BF8A 2DMVA 4DZ3A 2MF9A 2RSEA 2Y78A 2PPPA 4J4NA 4GIVA 2ZR5A 2XP8A 1ROUA 4JFJA 4NNRA 3NTPA 5J6EA 3KADA 3UF8A 2ZQVA 1I5HW 1FKDA 2M1IA 2MLXA 2IF4A 4LAYA 1PBKA 4TYOA 5HWBA 4ODQA 2MDIA 3O5EA 1Q1CA 2LPVA 1NMVA 5BXJA 4MSPA 2XP6A 1EYMA 4TW8A 4TW6A 2DWVA 1EG4A 2RE3A 1QPLA 2F21A 2XPAA 3UI4A 3JXVA 4FAPA 4DRNA 4ODOA 2MNTA 2E45A 2L4JA 1TCOC 3O5MA 2KI3A 2YSIA 4U84A 4TW7A 1B6CA 2ZAJA 4QT3A 2RURA 2M8JA 1YATA 4DROA 1F40A 3UQBA 1JNTA 1F8AB 4ITZA 3KACA 2EZ5W 5CQ2A 4DRPA 1U79A 2LAJA 3I6CA 3PA7A 5HW6A 1BKFA 4U86A 2KR7A 3FAPA 1L1PA 2AWGA 2KO7A 5HUAA 1FKJA 2PV3A 3JYJA 1FKRA 4W9PA 3KABA 5DIVA 2N87A 2D9FA 3OOBA 3IKDA 3KAGA 3KAIA 4DRKA 3GPKA 1M5YA 1EG3A 2OFNA 1Q6UA 3O5QA 4ODRA 3NRKA 4IQCA 4LAWA 5HW7A 4LAVA 5B8IC 4DRMA 1FD9A 1JMQA 5I98A 1FKHA 2UZ5A 1C9HA 1A7XA 2ZQTA 1Y0OA 4DIPA 4IQ2A 5HWCA 4TNSA 3O5KA 4R0XA 1W26A 1FKLA 3IKGA 3UI5A 1QZ2A 1WR7A 2YSFA 1P5QA 2DK7A 2M8IA 4G2PA 2M2AA 2LJ4A 5HTGA 3O5IA 3UQIA 4QIBA 3PRBA 3KCEA 2LKNA 3IK8A 1FKIA 2FKEA 3JYMA 4C02B 1J4IA 1JVWA 2XPBA 2RUDA 1FKKA
chains in the Genus database with same CATH superfamily
2VN1A 4J4OA 1X6LA 3KZ7A 2ZQUA 1D7JA 1ZK6A 4DH0A 3FXYA 1UR8A 4ODNA 1KT1A 2G8ZA 4GGQA 5DITA 2ITKA 3M85A 1J6YA 3RGCA 2XP7A 2MPHA 3KAHA 1GRJA 3WL1A 5E65A 1E9LA 3AS1A 1JNSA 2ZR6A 4WKAA 3WH0A 1J4RA 5D75A 5HT1A 5GPRA 2EULA 3BXWA 3ODKA 4G50A 5GPGA 5DF0A 1JCHB 4DWSB 1NSGA 3CGNA 4DRQA 5DIUA 3B9AA 3B9DA 1NWSA 3AS3A 3O5OA 4W5UA 2DSUA 2WLZA 3MCBA 3MDYB 2JX8A 2DJYA 1CTNA 2RQSA 4ZPVR 3WL0A 2F2DA 2DK1A 4E5RA 1ROTA 4ODMA 4DZ2A 1D6OA 1K9QA 1LL7A 1ZBKA 2M08A 2PV2A 3CHFA 1NMWA 1FKFA 1W1TA 4TX0A 4W9OA 4DT4A 3LUOA 2KGJA 3CNGA 3RM9A 4JFMA 1EQ3A 1HJXA 4U85A 3BMBA 2YSGA 2ZQSA 3UQAA 3UI6A 1LL6A 3WD4A 1Q6IA 3CHCA 2B5UB 2PV1A 3L4HA 2L2SA 1RD6A 2LGOA 4O2TA 4FN2A 1R9HA 1KT0A 4JYSA 2JMFA 2A3EA 1D2KA 2VCDA 1N1AA 4N19A 2O9OA 4GLXA 2KE0A 2F4EA 4P8WA 5HBFA 1W1PA 3O5RA 1W1VA 4ODLA 5GQBA 2DT1A 4JFKA 2OWOA 3TCZA 2FAPA 2RUQA 5JH8A 4AY1A 2YSHA 2PPNA 2ETNA 2M3OW 4MNKA 1LJYA 3RFWA 2B31A 3G6LA 2ZR4A 3O5FA 4NSBA 1WNOA 1WAWA 1XRVA 2IUZA 3RMEA 2XP5A 1K9RA 1OGBA 1W9VA 1Q6HA 2DG3A 2XP3A 1FAPA 2K8IA 4JFLA 4ODPA 2WK2A 4W9QA 2XP4A 1FKTA 3GU0A 4KQZA 3VAWA 1QPFA 1EIBA 3MQGA 3B7XA 3RM8A 2KXQA 1BL4A 4MNMA 2PPOA 4ODKA 4DRIA 3H9RB 3WQWA 3CH9A 5HKGA 3FSBA 4ML4A 5HW8A 3O5LA 3O5JA 1D7HA 3IHZA 3MCBB 2DSVA 3O5GA 3ARQA 4S3KA 5E5WA 4MGVA 1FLCA 2Q5AA 4Q22A 1O6WA 4A0TA 3TC5A 1FKBA 1FJDA 4ZPTR 1D7IA 2A3CA 4WK9A 1J4HA 1T11A 2DT0A 1W1YA 2JXWA 4WIWA 3NI6A 2DG4A 1NWTA 2JZVA 4LAXA 1ZU8A 3WKZA 3KAFA 2PBCA 3TDBA 1IX5A 4HBOA 2DSWA 4MNJA 3ARWA 2MLYA 2MLZA 4MTVA 4DRJA 2RUCA 2JV4A 1HKKA 4UDMA 3AROA 3EY6A 3ALGA 3ARYA 1HXVA 1E6NA 2BA1A 3LE4A 4IPXA 3O5DA 4Q7NA 1TFVA 3MQHA 1FKSA 2A3BA 1WMVA 2DG9A 4XAKA 1YW5A 4REXA 3EIPA 2KFWA 3B9EA 5AHTA 3CGMA 2QF8A 3PRDA 4DWSC 1LG1A 1SR0A 3O5PA 1FKGA 1TK7A 4DRHA 4JFIA 3PRAA 2YSBA 3M7NA 2DT2A 2OLHA 5E62A 1PINA 1LQ0A 4QT2A 4Z2JA 2XP9A 1ZCNA 1LL4A 2WLYA 4WJXA 4BF8A 2DMVA 3W4RA 2MF9A 3AS0A 4DZ3A 1KFWA 3LKXA 3PQHA 2RSEA 3GTYX 2Y78A 2PPPA 4J4NA 4GIVA 2ZR5A 2XP8A 3FS8A 4ZS6A 1ROUA 4JFJA 4NNRA 3NTPA 1ZB5A 5J6EA 3KADA 3AS2A 1LG2A 3UF8A 4DWSD 4WKFA 1FFRA 2PI6A 1ITXA 2WAEA 1RP5A 1EDQA 3ARTA 2ZQVA 1I5HW 1FKDA 1GUVA 2M1IA 3OA5A 2QRVA 2MLXA 1E6PA 2IF4A 3ARSA 4LAYA 1PBKA 4TYOA 5HWBA 4ODQA 3ARRA 2MDIA 3O5EA 1Q1CA 1ZBWA 4Z2KA 4S3JA 2WADA 2YBUA 2LPVA 4Z2LA 1NMVA 4L72B 4Z2HA 5BXJA 4MSPA 2XP6A 1EYMA 4TW8A 5E66A 1E6ZA 4MAVA 4TW6A 4P8XA 2DWVA 3WIJA 1EG4A 2RE3A 1QPLA 2F21A 1EHNA 4HBEA 2ESCA 4IT4A 2XPAA 1XHGA 3UI4A 3JXVA 4FAPA 4WKHA 4DRNA 1X6NA 2FDMA 4ODOA 2MNTA 2E45A 3CHDA 1E15A 2L4JA 1NWUA 1TCOC 3O5MA 1SYTA 2KI3A 2O92A 3FY1A 2YSIA 1TR8A 1W9UA 1E44A 4U84A 4TW7A 1B6CA 2ZAJA 4QT3A 2RURA 2M8JA 1YATA 4DROA 5DEZA 1F40A 4LGXA 3UQBA 1JNTA 1HKIA 1F8AB 4ITZA 3ARVA 3WQVA 1K9TA 1HKMA 3KACA 1H0IA 1ZL1A 2EZ5W 1OWQA 5CQ2A 3LKXB 4P8VA 4DRPA 1U79A 2LAJA 3I6CA 3PA7A 5HW6A 1BKFA 4U86A 4Z2IA 2KR7A 3ARXA 4R5EA 4URIA 1JNDA 3FAPA 1L1PA 2AWGA 2KO7A 5HUAA 1FKJA 2AOSA 2A3AA 2P4VA 3ARUA 2PV3A 3JYJA 1FKRA 4W9PA 4QZVB 3KABA 4L3NA 5DIVA 2N87A 2D9FA 3OOBA 3IKDA 3KAGA 3KAIA 4MNLA 4DRKA 5E64A 1GOIA 1HJWA 3GPKA 1VF8A 3WD1A 1M5YA 1EG3A 1H0GA 2OFNA 1Q6UA 4MPKA 1UR9A 4NZCA 3O5QA 4ODRA 3ARZA 3ARPA 3NRKA 4IQCA 4ZPWR 3RM4A 4LAWA 3WD0A 5HW7A 4LAVA 5B8IC 5DO2A 4DRMA 1FD9A 1JMQA 5I98A 2WM0A 1FKHA 1O6IA 1W9PA 1ZBVA 1WB0A 2UZ5A 4DWSA 1C9HA 1JNEA 5U47A 1A7XA 1NH6A 4P8UA 2ZQTA 1Y0OA 4DIPA 1GPFA 2DPEA 2Y8NB 3FSCA 4IQ2A 5HWCA 4TNSA 3CHEA 2YAJB 3B8SA 3O5KA 1E6RA 4A0UA 4R0XA 1W26A 3G6MA 1FKLA 4KR0B 3IKGA 2G41A 4HARA 3WD2A 2DSZA 3UI5A 1QZ2A 1WR7A 2YSFA 1P5QA 2DK7A 2M8IA 4G2PA 2M2AA 2LJ4A 5HTGA 3O5IA 3UQIA 4IT6A 3AQUA 1OGGA 3QOKA 1ZBCA 1HKJA 4QIBA 3CZ8A 3PRBA 2PN0A 3KCEA 2LKNA 2F23A 3ALFA 3WD3A 3IK8A 4PTMA 1FKIA 2FKEA 3JYMA 1HJVA 4C02B 2DT3A 1FFQA 1J4IA 1JVWA 2XPBA 2RUDA 1FKKA 4Z2GA 2YBTA 1NWRA 3PR9A
chains in the Genus database with same CATH topology
2VN1A 4J4OA 1X6LA 3KZ7A 2ZQUA 1D7JA 1ZK6A 4DH0A 3FXYA 1UR8A 4ODNA 1KT1A 2G8ZA 4GGQA 5DITA 2ITKA 3M85A 1J6YA 3RGCA 2XP7A 2MPHA 3KAHA 3WL1A 5E65A 1E9LA 3AS1A 1JNSA 2ZR6A 4WKAA 3WH0A 1J4RA 5D75A 5HT1A 5GPRA 3BXWA 3ODKA 4G50A 5GPGA 5DF0A 4DWSB 1NSGA 3CGNA 4DRQA 5DIUA 3B9AA 3B9DA 1NWSA 3AS3A 3O5OA 4W5UA 2DSUA 2WLZA 3MCBA 3MDYB 2JX8A 2DJYA 1CTNA 2RQSA 4ZPVR 3WL0A 2F2DA 2DK1A 4E5RA 1ROTA 4ODMA 4DZ2A 1D6OA 1K9QA 1LL7A 1ZBKA 2M08A 2PV2A 3CHFA 1NMWA 1FKFA 1W1TA 4TX0A 4W9OA 4DT4A 3LUOA 2KGJA 3CNGA 3RM9A 4JFMA 1EQ3A 1HJXA 4U85A 2YSGA 2ZQSA 3UQAA 3UI6A 1LL6A 3WD4A 1Q6IA 3CHCA 2PV1A 3L4HA 2L2SA 1RD6A 2LGOA 4O2TA 4FN2A 1R9HA 1KT0A 4JYSA 2JMFA 2A3EA 1D2KA 2VCDA 1N1AA 4N19A 2O9OA 4GLXA 2KE0A 2F4EA 4P8WA 5HBFA 1W1PA 3O5RA 1W1VA 4ODLA 5GQBA 2DT1A 4JFKA 2OWOA 3TCZA 2FAPA 2RUQA 5JH8A 4AY1A 2YSHA 2PPNA 4MNKA 2M3OW 1LJYA 3RFWA 2B31A 3G6LA 2ZR4A 3O5FA 4NSBA 1WNOA 1WAWA 1XRVA 2IUZA 3RMEA 2XP5A 1K9RA 1OGBA 1W9VA 1Q6HA 2DG3A 2XP3A 1FAPA 2K8IA 4JFLA 4ODPA 2WK2A 4W9QA 2XP4A 1FKTA 4KQZA 3VAWA 1QPFA 1EIBA 3MQGA 3B7XA 3RM8A 2KXQA 1BL4A 4MNMA 2PPOA 4ODKA 4DRIA 3H9RB 3WQWA 3CH9A 5HKGA 3FSBA 4ML4A 5HW8A 3O5LA 3O5JA 1D7HA 3IHZA 3MCBB 2DSVA 3O5GA 3ARQA 4S3KA 5E5WA 4MGVA 1FLCA 2Q5AA 4Q22A 1O6WA 4A0TA 3TC5A 1FKBA 1FJDA 4ZPTR 1D7IA 2A3CA 4WK9A 1J4HA 1T11A 2DT0A 1W1YA 2JXWA 4WIWA 3NI6A 2DG4A 1NWTA 2JZVA 4LAXA 1ZU8A 3WKZA 3KAFA 2PBCA 3TDBA 1IX5A 4HBOA 2DSWA 4MNJA 3ARWA 2MLYA 2MLZA 4MTVA 4DRJA 2RUCA 2JV4A 1HKKA 3AROA 3EY6A 3ALGA 3ARYA 1HXVA 1E6NA 2BA1A 3LE4A 4IPXA 3O5DA 4Q7NA 1TFVA 3MQHA 1FKSA 2A3BA 1WMVA 2DG9A 4XAKA 1YW5A 4REXA 2KFWA 3B9EA 5AHTA 3CGMA 2QF8A 3PRDA 4DWSC 1LG1A 1SR0A 3O5PA 1FKGA 1TK7A 4DRHA 4JFIA 3PRAA 2YSBA 3M7NA 2DT2A 2OLHA 5E62A 1PINA 1LQ0A 4QT2A 4Z2JA 2XP9A 1ZCNA 1LL4A 2WLYA 4WJXA 4BF8A 2DMVA 3W4RA 2MF9A 3AS0A 4DZ3A 1KFWA 3LKXA 3PQHA 2RSEA 2Y78A 2PPPA 4J4NA 4GIVA 2ZR5A 2XP8A 3FS8A 4ZS6A 1ROUA 4JFJA 4NNRA 3NTPA 1ZB5A 5J6EA 3KADA 3AS2A 1LG2A 3UF8A 4DWSD 4WKFA 1FFRA 2PI6A 1ITXA 2WAEA 1RP5A 1EDQA 3ARTA 2ZQVA 1I5HW 1FKDA 1GUVA 2M1IA 3OA5A 2QRVA 2MLXA 1E6PA 2IF4A 3ARSA 4LAYA 1PBKA 4TYOA 5HWBA 4ODQA 3ARRA 2MDIA 3O5EA 1Q1CA 1ZBWA 4Z2KA 4S3JA 2WADA 2YBUA 2LPVA 4Z2LA 1NMVA 4L72B 4Z2HA 5BXJA 4MSPA 2XP6A 1EYMA 4TW8A 5E66A 1E6ZA 4MAVA 4TW6A 4P8XA 2DWVA 3WIJA 1EG4A 2RE3A 1QPLA 2F21A 1EHNA 4HBEA 2ESCA 4IT4A 2XPAA 1XHGA 3UI4A 3JXVA 4FAPA 4WKHA 4DRNA 1X6NA 2FDMA 4ODOA 2MNTA 2E45A 3CHDA 1E15A 2L4JA 1NWUA 1TCOC 3O5MA 1SYTA 2KI3A 2O92A 3FY1A 2YSIA 1TR8A 1W9UA 4U84A 4TW7A 1B6CA 2ZAJA 4QT3A 2RURA 2M8JA 1YATA 4DROA 5DEZA 1F40A 4LGXA 3UQBA 1JNTA 1HKIA 1F8AB 4ITZA 3ARVA 3WQVA 1K9TA 1HKMA 3KACA 1H0IA 1ZL1A 2EZ5W 1OWQA 5CQ2A 3LKXB 4P8VA 4DRPA 1U79A 2LAJA 3I6CA 3PA7A 5HW6A 1BKFA 4U86A 4Z2IA 2KR7A 3ARXA 4R5EA 4URIA 1JNDA 3FAPA 1L1PA 2AWGA 2KO7A 5HUAA 1FKJA 2AOSA 2A3AA 3ARUA 2PV3A 3JYJA 1FKRA 4W9PA 4QZVB 3KABA 4L3NA 5DIVA 2N87A 2D9FA 3OOBA 3IKDA 3KAGA 3KAIA 4MNLA 4DRKA 5E64A 1GOIA 1HJWA 3GPKA 1VF8A 3WD1A 1M5YA 1EG3A 1H0GA 2OFNA 1Q6UA 4MPKA 1UR9A 4NZCA 3O5QA 4ODRA 3ARZA 3ARPA 3NRKA 4IQCA 4ZPWR 3RM4A 4LAWA 3WD0A 5HW7A 4LAVA 5B8IC 5DO2A 4DRMA 1FD9A 1JMQA 5I98A 2WM0A 1FKHA 1O6IA 1W9PA 1ZBVA 1WB0A 2UZ5A 4DWSA 1C9HA 1JNEA 5U47A 1A7XA 1NH6A 4P8UA 2ZQTA 1Y0OA 4DIPA 1GPFA 2DPEA 2Y8NB 3FSCA 4IQ2A 5HWCA 4TNSA 3CHEA 2YAJB 3B8SA 3O5KA 1E6RA 4A0UA 4R0XA 1W26A 3G6MA 1FKLA 4KR0B 3IKGA 2G41A 4HARA 3WD2A 2DSZA 3UI5A 1QZ2A 1WR7A 2YSFA 1P5QA 2DK7A 2M8IA 4G2PA 2M2AA 2LJ4A 5HTGA 3O5IA 3UQIA 4IT6A 3AQUA 1OGGA 3QOKA 1ZBCA 1HKJA 4QIBA 3CZ8A 3PRBA 3KCEA 2LKNA 3ALFA 3WD3A 3IK8A 4PTMA 1FKIA 2FKEA 3JYMA 1HJVA 4C02B 2DT3A 1FFQA 1J4IA 1JVWA 2XPBA 2RUDA 1FKKA 4Z2GA 2YBTA 1NWRA 3PR9A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2VN1 A;  4J4O A;  3KZ7 A;  2ZQU A;  1D7J A;  1ZK6 A;  4DH0 A;  4ODN A;  1KT1 A;  5DIT A;  4GGQ A;  2ITK A;  3M85 A;  1J6Y A;  3RGC A;  2XP7 A;  2MPH A;  3KAH A;  1JNS A;  2ZR6 A;  3WH0 A;  1J4R A;  5D75 A;  5HT1 A;  3ODK A;  4G50 A;  5GPG A;  1NSG A;  3CGN A;  4DRQ A;  5DIU A;  3O5O A;  3MDY B;  2JX8 A;  2DJY A;  2RQS A;  2F2D A;  2DK1 A;  4E5R A;  1ROT A;  4ODM A;  4DZ2 A;  1D6O A;  1K9Q A;  2M08 A;  2PV2 A;  1NMW A;  1FKF A;  4TX0 A;  4W9O A;  4DT4 A;  3LUO A;  2KGJ A;  3CNG A;  4JFM A;  1EQ3 A;  4U85 A;  2YSG A;  2ZQS A;  3UQA A;  3UI6 A;  1Q6I A;  2PV1 A;  3L4H A;  2L2S A;  2LGO A;  4O2T A;  4FN2 A;  1R9H A;  4JYS A;  1KT0 A;  2JMF A;  2VCD A;  1N1A A;  4N19 A;  2KE0 A;  2F4E A;  3O5R A;  4ODL A;  4JFK A;  3TCZ A;  2FAP A;  2RUQ A;  2YSH A;  2PPN A;  2M3O W;  3RFW A;  2ZR4 A;  3O5F A;  2XP5 A;  1K9R A;  1Q6H A;  2DG3 A;  2XP3 A;  1FAP A;  2K8I A;  4JFL A;  4ODP A;  4W9Q A;  2XP4 A;  1FKT A;  3VAW A;  1QPF A;  3B7X A;  2KXQ A;  1BL4 A;  2PPO A;  4ODK A;  4DRI A;  3H9R B;  5HKG A;  5HW8 A;  3O5L A;  3O5J A;  1D7H A;  3IHZ A;  3O5G A;  4MGV A;  2Q5A A;  1O6W A;  3TC5 A;  1FKB A;  1FJD A;  1D7I A;  1J4H A;  1T11 A;  2JXW A;  3NI6 A;  2DG4 A;  2JZV A;  4LAX A;  3KAF A;  2PBC A;  3TDB A;  2MLY A;  2MLZ A;  4DRJ A;  2RUC A;  2JV4 A;  3EY6 A;  1HXV A;  2BA1 A;  3LE4 A;  4IPX A;  3O5D A;  1FKS A;  2DG9 A;  1WMV A;  1YW5 A;  4REX A;  2KFW A;  3CGM A;  5AHT A;  3PRD A;  3O5P A;  1FKG A;  1TK7 A;  4DRH A;  4JFI A;  2YSB A;  3M7N A;  1PIN A;  4QT2 A;  2XP9 A;  1ZCN A;  4BF8 A;  2DMV A;  4DZ3 A;  2MF9 A;  2RSE A;  2Y78 A;  2PPP A;  4J4N A;  4GIV A;  2ZR5 A;  2XP8 A;  1ROU A;  4JFJ A;  4NNR A;  3NTP A;  5J6E A;  3KAD A;  3UF8 A;  2ZQV A;  1I5H W;  1FKD A;  2M1I A;  2MLX A;  2IF4 A;  4LAY A;  1PBK A;  4TYO A;  5HWB A;  4ODQ A;  2MDI A;  3O5E A;  1Q1C A;  2LPV A;  1NMV A;  5BXJ A;  4MSP A;  2XP6 A;  1EYM A;  4TW8 A;  4TW6 A;  2DWV A;  1EG4 A;  2RE3 A;  1QPL A;  2F21 A;  2XPA A;  3UI4 A;  3JXV A;  4FAP A;  4DRN A;  4ODO A;  2MNT A;  2E45 A;  2L4J A;  1TCO C;  3O5M A;  2KI3 A;  2YSI A;  4U84 A;  4TW7 A;  1B6C A;  2ZAJ A;  4QT3 A;  2RUR A;  2M8J A;  1YAT A;  4DRO A;  1F40 A;  3UQB A;  1JNT A;  1F8A B;  4ITZ A;  3KAC A;  2EZ5 W;  5CQ2 A;  4DRP A;  1U79 A;  2LAJ A;  3I6C A;  3PA7 A;  5HW6 A;  1BKF A;  4U86 A;  2KR7 A;  3FAP A;  1L1P A;  2AWG A;  2KO7 A;  5HUA A;  1FKJ A;  2PV3 A;  3JYJ A;  1FKR A;  4W9P A;  3KAB A;  5DIV A;  2N87 A;  2D9F A;  3OOB A;  3IKD A;  3KAG A;  3KAI A;  4DRK A;  3GPK A;  1M5Y A;  1EG3 A;  2OFN A;  1Q6U A;  3O5Q A;  4ODR A;  3NRK A;  4IQC A;  4LAW A;  5HW7 A;  4LAV A;  5B8I C;  4DRM A;  1FD9 A;  1JMQ A;  5I98 A;  1FKH A;  2UZ5 A;  1C9H A;  1A7X A;  2ZQT A;  1Y0O A;  4DIP A;  4IQ2 A;  5HWC A;  4TNS A;  3O5K A;  4R0X A;  1W26 A;  1FKL A;  3IKG A;  3UI5 A;  1QZ2 A;  1WR7 A;  2YSF A;  1P5Q A;  2DK7 A;  2M8I A;  4G2P A;  2M2A A;  2LJ4 A;  5HTG A;  3O5I A;  3UQI A;  4QIB A;  3PRB A;  3KCE A;  2LKN A;  3IK8 A;  1FKI A;  2FKE A;  3JYM A;  4C02 B;  1J4I A;  1JVW A;  2XPB A;  2RUD A;  1FKK A; 
#chains in the Genus database with same CATH topology
 2VN1 A;  4J4O A;  1X6L A;  3KZ7 A;  2ZQU A;  1D7J A;  1ZK6 A;  4DH0 A;  3FXY A;  1UR8 A;  4ODN A;  1KT1 A;  2G8Z A;  4GGQ A;  5DIT A;  2ITK A;  3M85 A;  1J6Y A;  3RGC A;  2XP7 A;  2MPH A;  3KAH A;  1GRJ A;  3WL1 A;  5E65 A;  1E9L A;  3AS1 A;  1JNS A;  2ZR6 A;  4WKA A;  3WH0 A;  1J4R A;  5D75 A;  5HT1 A;  5GPR A;  2EUL A;  3BXW A;  3ODK A;  4G50 A;  5GPG A;  5DF0 A;  1JCH B;  4DWS B;  1NSG A;  3CGN A;  4DRQ A;  5DIU A;  3B9A A;  3B9D A;  1NWS A;  3AS3 A;  3O5O A;  4W5U A;  2DSU A;  2WLZ A;  3MCB A;  3MDY B;  2JX8 A;  2DJY A;  1CTN A;  2RQS A;  4ZPV R;  3WL0 A;  2F2D A;  2DK1 A;  4E5R A;  1ROT A;  4ODM A;  4DZ2 A;  1D6O A;  1K9Q A;  1LL7 A;  1ZBK A;  2M08 A;  2PV2 A;  3CHF A;  1NMW A;  1FKF A;  1W1T A;  4TX0 A;  4W9O A;  4DT4 A;  3LUO A;  2KGJ A;  3CNG A;  3RM9 A;  4JFM A;  1EQ3 A;  1HJX A;  4U85 A;  3BMB A;  2YSG A;  2ZQS A;  3UQA A;  3UI6 A;  1LL6 A;  3WD4 A;  1Q6I A;  3CHC A;  2B5U B;  2PV1 A;  3L4H A;  2L2S A;  1RD6 A;  2LGO A;  4O2T A;  4FN2 A;  1R9H A;  1KT0 A;  4JYS A;  2JMF A;  2A3E A;  1D2K A;  2VCD A;  1N1A A;  4N19 A;  2O9O A;  4GLX A;  2KE0 A;  2F4E A;  4P8W A;  5HBF A;  1W1P A;  3O5R A;  1W1V A;  4ODL A;  5GQB A;  2DT1 A;  4JFK A;  2OWO A;  3TCZ A;  2FAP A;  2RUQ A;  5JH8 A;  4AY1 A;  2YSH A;  2PPN A;  2ETN A;  2M3O W;  4MNK A;  1LJY A;  3RFW A;  2B31 A;  3G6L A;  2ZR4 A;  3O5F A;  4NSB A;  1WNO A;  1WAW A;  1XRV A;  2IUZ A;  3RME A;  2XP5 A;  1K9R A;  1OGB A;  1W9V A;  1Q6H A;  2DG3 A;  2XP3 A;  1FAP A;  2K8I A;  4JFL A;  4ODP A;  2WK2 A;  4W9Q A;  2XP4 A;  1FKT A;  3GU0 A;  4KQZ A;  3VAW A;  1QPF A;  1EIB A;  3MQG A;  3B7X A;  3RM8 A;  2KXQ A;  1BL4 A;  4MNM A;  2PPO A;  4ODK A;  4DRI A;  3H9R B;  3WQW A;  3CH9 A;  5HKG A;  3FSB A;  4ML4 A;  5HW8 A;  3O5L A;  3O5J A;  1D7H A;  3IHZ A;  3MCB B;  2DSV A;  3O5G A;  3ARQ A;  4S3K A;  5E5W A;  4MGV A;  1FLC A;  2Q5A A;  4Q22 A;  1O6W A;  4A0T A;  3TC5 A;  1FKB A;  1FJD A;  4ZPT R;  1D7I A;  2A3C A;  4WK9 A;  1J4H A;  1T11 A;  2DT0 A;  1W1Y A;  2JXW A;  4WIW A;  3NI6 A;  2DG4 A;  1NWT A;  2JZV A;  4LAX A;  1ZU8 A;  3WKZ A;  3KAF A;  2PBC A;  3TDB A;  1IX5 A;  4HBO A;  2DSW A;  4MNJ A;  3ARW A;  2MLY A;  2MLZ A;  4MTV A;  4DRJ A;  2RUC A;  2JV4 A;  1HKK A;  4UDM A;  3ARO A;  3EY6 A;  3ALG A;  3ARY A;  1HXV A;  1E6N A;  2BA1 A;  3LE4 A;  4IPX A;  3O5D A;  4Q7N A;  1TFV A;  3MQH A;  1FKS A;  2A3B A;  1WMV A;  2DG9 A;  4XAK A;  1YW5 A;  4REX A;  3EIP A;  2KFW A;  3B9E A;  5AHT A;  3CGM A;  2QF8 A;  3PRD A;  4DWS C;  1LG1 A;  1SR0 A;  3O5P A;  1FKG A;  1TK7 A;  4DRH A;  4JFI A;  3PRA A;  2YSB A;  3M7N A;  2DT2 A;  2OLH A;  5E62 A;  1PIN A;  1LQ0 A;  4QT2 A;  4Z2J A;  2XP9 A;  1ZCN A;  1LL4 A;  2WLY A;  4WJX A;  4BF8 A;  2DMV A;  3W4R A;  2MF9 A;  3AS0 A;  4DZ3 A;  1KFW A;  3LKX A;  3PQH A;  2RSE A;  3GTY X;  2Y78 A;  2PPP A;  4J4N A;  4GIV A;  2ZR5 A;  2XP8 A;  3FS8 A;  4ZS6 A;  1ROU A;  4JFJ A;  4NNR A;  3NTP A;  1ZB5 A;  5J6E A;  3KAD A;  3AS2 A;  1LG2 A;  3UF8 A;  4DWS D;  4WKF A;  1FFR A;  2PI6 A;  1ITX A;  2WAE A;  1RP5 A;  1EDQ A;  3ART A;  2ZQV A;  1I5H W;  1FKD A;  1GUV A;  2M1I A;  3OA5 A;  2QRV A;  2MLX A;  1E6P A;  2IF4 A;  3ARS A;  4LAY A;  1PBK A;  4TYO A;  5HWB A;  4ODQ A;  3ARR A;  2MDI A;  3O5E A;  1Q1C A;  1ZBW A;  4Z2K A;  4S3J A;  2WAD A;  2YBU A;  2LPV A;  4Z2L A;  1NMV A;  4L72 B;  4Z2H A;  5BXJ A;  4MSP A;  2XP6 A;  1EYM A;  4TW8 A;  5E66 A;  1E6Z A;  4MAV A;  4TW6 A;  4P8X A;  2DWV A;  3WIJ A;  1EG4 A;  2RE3 A;  1QPL A;  2F21 A;  1EHN A;  4HBE A;  2ESC A;  4IT4 A;  2XPA A;  1XHG A;  3UI4 A;  3JXV A;  4FAP A;  4WKH A;  4DRN A;  1X6N A;  2FDM A;  4ODO A;  2MNT A;  2E45 A;  3CHD A;  1E15 A;  2L4J A;  1NWU A;  1TCO C;  3O5M A;  1SYT A;  2KI3 A;  2O92 A;  3FY1 A;  2YSI A;  1TR8 A;  1W9U A;  1E44 A;  4U84 A;  4TW7 A;  1B6C A;  2ZAJ A;  4QT3 A;  2RUR A;  2M8J A;  1YAT A;  4DRO A;  5DEZ A;  1F40 A;  4LGX A;  3UQB A;  1JNT A;  1HKI A;  1F8A B;  4ITZ A;  3ARV A;  3WQV A;  1K9T A;  1HKM A;  3KAC A;  1H0I A;  1ZL1 A;  2EZ5 W;  1OWQ A;  5CQ2 A;  3LKX B;  4P8V A;  4DRP A;  1U79 A;  2LAJ A;  3I6C A;  3PA7 A;  5HW6 A;  1BKF A;  4U86 A;  4Z2I A;  2KR7 A;  3ARX A;  4R5E A;  4URI A;  1JND A;  3FAP A;  1L1P A;  2AWG A;  2KO7 A;  5HUA A;  1FKJ A;  2AOS A;  2A3A A;  2P4V A;  3ARU A;  2PV3 A;  3JYJ A;  1FKR A;  4W9P A;  4QZV B;  3KAB A;  4L3N A;  5DIV A;  2N87 A;  2D9F A;  3OOB A;  3IKD A;  3KAG A;  3KAI A;  4MNL A;  4DRK A;  5E64 A;  1GOI A;  1HJW A;  3GPK A;  1VF8 A;  3WD1 A;  1M5Y A;  1EG3 A;  1H0G A;  2OFN A;  1Q6U A;  4MPK A;  1UR9 A;  4NZC A;  3O5Q A;  4ODR A;  3ARZ A;  3ARP A;  3NRK A;  4IQC A;  4ZPW R;  3RM4 A;  4LAW A;  3WD0 A;  5HW7 A;  4LAV A;  5B8I C;  5DO2 A;  4DRM A;  1FD9 A;  1JMQ A;  5I98 A;  2WM0 A;  1FKH A;  1O6I A;  1W9P A;  1ZBV A;  1WB0 A;  2UZ5 A;  4DWS A;  1C9H A;  1JNE A;  5U47 A;  1A7X A;  1NH6 A;  4P8U A;  2ZQT A;  1Y0O A;  4DIP A;  1GPF A;  2DPE A;  2Y8N B;  3FSC A;  4IQ2 A;  5HWC A;  4TNS A;  3CHE A;  2YAJ B;  3B8S A;  3O5K A;  1E6R A;  4A0U A;  4R0X A;  1W26 A;  3G6M A;  1FKL A;  4KR0 B;  3IKG A;  2G41 A;  4HAR A;  3WD2 A;  2DSZ A;  3UI5 A;  1QZ2 A;  1WR7 A;  2YSF A;  1P5Q A;  2DK7 A;  2M8I A;  4G2P A;  2M2A A;  2LJ4 A;  5HTG A;  3O5I A;  3UQI A;  4IT6 A;  3AQU A;  1OGG A;  3QOK A;  1ZBC A;  1HKJ A;  4QIB A;  3CZ8 A;  3PRB A;  2PN0 A;  3KCE A;  2LKN A;  2F23 A;  3ALF A;  3WD3 A;  3IK8 A;  4PTM A;  1FKI A;  2FKE A;  3JYM A;  1HJV A;  4C02 B;  2DT3 A;  1FFQ A;  1J4I A;  1JVW A;  2XPB A;  2RUD A;  1FKK A;  4Z2G A;  2YBT A;  1NWR A;  3PR9 A; 
#chains in the Genus database with same CATH homology
 2VN1 A;  4J4O A;  1X6L A;  3KZ7 A;  2ZQU A;  1D7J A;  1ZK6 A;  4DH0 A;  3FXY A;  1UR8 A;  4ODN A;  1KT1 A;  2G8Z A;  4GGQ A;  5DIT A;  2ITK A;  3M85 A;  1J6Y A;  3RGC A;  2XP7 A;  2MPH A;  3KAH A;  3WL1 A;  5E65 A;  1E9L A;  3AS1 A;  1JNS A;  2ZR6 A;  4WKA A;  3WH0 A;  1J4R A;  5D75 A;  5HT1 A;  5GPR A;  3BXW A;  3ODK A;  4G50 A;  5GPG A;  5DF0 A;  4DWS B;  1NSG A;  3CGN A;  4DRQ A;  5DIU A;  3B9A A;  3B9D A;  1NWS A;  3AS3 A;  3O5O A;  4W5U A;  2DSU A;  2WLZ A;  3MCB A;  3MDY B;  2JX8 A;  2DJY A;  1CTN A;  2RQS A;  4ZPV R;  3WL0 A;  2F2D A;  2DK1 A;  4E5R A;  1ROT A;  4ODM A;  4DZ2 A;  1D6O A;  1K9Q A;  1LL7 A;  1ZBK A;  2M08 A;  2PV2 A;  3CHF A;  1NMW A;  1FKF A;  1W1T A;  4TX0 A;  4W9O A;  4DT4 A;  3LUO A;  2KGJ A;  3CNG A;  3RM9 A;  4JFM A;  1EQ3 A;  1HJX A;  4U85 A;  2YSG A;  2ZQS A;  3UQA A;  3UI6 A;  1LL6 A;  3WD4 A;  1Q6I A;  3CHC A;  2PV1 A;  3L4H A;  2L2S A;  1RD6 A;  2LGO A;  4O2T A;  4FN2 A;  1R9H A;  1KT0 A;  4JYS A;  2JMF A;  2A3E A;  1D2K A;  2VCD A;  1N1A A;  4N19 A;  2O9O A;  4GLX A;  2KE0 A;  2F4E A;  4P8W A;  5HBF A;  1W1P A;  3O5R A;  1W1V A;  4ODL A;  5GQB A;  2DT1 A;  4JFK A;  2OWO A;  3TCZ A;  2FAP A;  2RUQ A;  5JH8 A;  4AY1 A;  2YSH A;  2PPN A;  4MNK A;  2M3O W;  1LJY A;  3RFW A;  2B31 A;  3G6L A;  2ZR4 A;  3O5F A;  4NSB A;  1WNO A;  1WAW A;  1XRV A;  2IUZ A;  3RME A;  2XP5 A;  1K9R A;  1OGB A;  1W9V A;  1Q6H A;  2DG3 A;  2XP3 A;  1FAP A;  2K8I A;  4JFL A;  4ODP A;  2WK2 A;  4W9Q A;  2XP4 A;  1FKT A;  4KQZ A;  3VAW A;  1QPF A;  1EIB A;  3MQG A;  3B7X A;  3RM8 A;  2KXQ A;  1BL4 A;  4MNM A;  2PPO A;  4ODK A;  4DRI A;  3H9R B;  3WQW A;  3CH9 A;  5HKG A;  3FSB A;  4ML4 A;  5HW8 A;  3O5L A;  3O5J A;  1D7H A;  3IHZ A;  3MCB B;  2DSV A;  3O5G A;  3ARQ A;  4S3K A;  5E5W A;  4MGV A;  1FLC A;  2Q5A A;  4Q22 A;  1O6W A;  4A0T A;  3TC5 A;  1FKB A;  1FJD A;  4ZPT R;  1D7I A;  2A3C A;  4WK9 A;  1J4H A;  1T11 A;  2DT0 A;  1W1Y A;  2JXW A;  4WIW A;  3NI6 A;  2DG4 A;  1NWT A;  2JZV A;  4LAX A;  1ZU8 A;  3WKZ A;  3KAF A;  2PBC A;  3TDB A;  1IX5 A;  4HBO A;  2DSW A;  4MNJ A;  3ARW A;  2MLY A;  2MLZ A;  4MTV A;  4DRJ A;  2RUC A;  2JV4 A;  1HKK A;  3ARO A;  3EY6 A;  3ALG A;  3ARY A;  1HXV A;  1E6N A;  2BA1 A;  3LE4 A;  4IPX A;  3O5D A;  4Q7N A;  1TFV A;  3MQH A;  1FKS A;  2A3B A;  1WMV A;  2DG9 A;  4XAK A;  1YW5 A;  4REX A;  2KFW A;  3B9E A;  5AHT A;  3CGM A;  2QF8 A;  3PRD A;  4DWS C;  1LG1 A;  1SR0 A;  3O5P A;  1FKG A;  1TK7 A;  4DRH A;  4JFI A;  3PRA A;  2YSB A;  3M7N A;  2DT2 A;  2OLH A;  5E62 A;  1PIN A;  1LQ0 A;  4QT2 A;  4Z2J A;  2XP9 A;  1ZCN A;  1LL4 A;  2WLY A;  4WJX A;  4BF8 A;  2DMV A;  3W4R A;  2MF9 A;  3AS0 A;  4DZ3 A;  1KFW A;  3LKX A;  3PQH A;  2RSE A;  2Y78 A;  2PPP A;  4J4N A;  4GIV A;  2ZR5 A;  2XP8 A;  3FS8 A;  4ZS6 A;  1ROU A;  4JFJ A;  4NNR A;  3NTP A;  1ZB5 A;  5J6E A;  3KAD A;  3AS2 A;  1LG2 A;  3UF8 A;  4DWS D;  4WKF A;  1FFR A;  2PI6 A;  1ITX A;  2WAE A;  1RP5 A;  1EDQ A;  3ART A;  2ZQV A;  1I5H W;  1FKD A;  1GUV A;  2M1I A;  3OA5 A;  2QRV A;  2MLX A;  1E6P A;  2IF4 A;  3ARS A;  4LAY A;  1PBK A;  4TYO A;  5HWB A;  4ODQ A;  3ARR A;  2MDI A;  3O5E A;  1Q1C A;  1ZBW A;  4Z2K A;  4S3J A;  2WAD A;  2YBU A;  2LPV A;  4Z2L A;  1NMV A;  4L72 B;  4Z2H A;  5BXJ A;  4MSP A;  2XP6 A;  1EYM A;  4TW8 A;  5E66 A;  1E6Z A;  4MAV A;  4TW6 A;  4P8X A;  2DWV A;  3WIJ A;  1EG4 A;  2RE3 A;  1QPL A;  2F21 A;  1EHN A;  4HBE A;  2ESC A;  4IT4 A;  2XPA A;  1XHG A;  3UI4 A;  3JXV A;  4FAP A;  4WKH A;  4DRN A;  1X6N A;  2FDM A;  4ODO A;  2MNT A;  2E45 A;  3CHD A;  1E15 A;  2L4J A;  1NWU A;  1TCO C;  3O5M A;  1SYT A;  2KI3 A;  2O92 A;  3FY1 A;  2YSI A;  1TR8 A;  1W9U A;  4U84 A;  4TW7 A;  1B6C A;  2ZAJ A;  4QT3 A;  2RUR A;  2M8J A;  1YAT A;  4DRO A;  5DEZ A;  1F40 A;  4LGX A;  3UQB A;  1JNT A;  1HKI A;  1F8A B;  4ITZ A;  3ARV A;  3WQV A;  1K9T A;  1HKM A;  3KAC A;  1H0I A;  1ZL1 A;  2EZ5 W;  1OWQ A;  5CQ2 A;  3LKX B;  4P8V A;  4DRP A;  1U79 A;  2LAJ A;  3I6C A;  3PA7 A;  5HW6 A;  1BKF A;  4U86 A;  4Z2I A;  2KR7 A;  3ARX A;  4R5E A;  4URI A;  1JND A;  3FAP A;  1L1P A;  2AWG A;  2KO7 A;  5HUA A;  1FKJ A;  2AOS A;  2A3A A;  3ARU A;  2PV3 A;  3JYJ A;  1FKR A;  4W9P A;  4QZV B;  3KAB A;  4L3N A;  5DIV A;  2N87 A;  2D9F A;  3OOB A;  3IKD A;  3KAG A;  3KAI A;  4MNL A;  4DRK A;  5E64 A;  1GOI A;  1HJW A;  3GPK A;  1VF8 A;  3WD1 A;  1M5Y A;  1EG3 A;  1H0G A;  2OFN A;  1Q6U A;  4MPK A;  1UR9 A;  4NZC A;  3O5Q A;  4ODR A;  3ARZ A;  3ARP A;  3NRK A;  4IQC A;  4ZPW R;  3RM4 A;  4LAW A;  3WD0 A;  5HW7 A;  4LAV A;  5B8I C;  5DO2 A;  4DRM A;  1FD9 A;  1JMQ A;  5I98 A;  2WM0 A;  1FKH A;  1O6I A;  1W9P A;  1ZBV A;  1WB0 A;  2UZ5 A;  4DWS A;  1C9H A;  1JNE A;  5U47 A;  1A7X A;  1NH6 A;  4P8U A;  2ZQT A;  1Y0O A;  4DIP A;  1GPF A;  2DPE A;  2Y8N B;  3FSC A;  4IQ2 A;  5HWC A;  4TNS A;  3CHE A;  2YAJ B;  3B8S A;  3O5K A;  1E6R A;  4A0U A;  4R0X A;  1W26 A;  3G6M A;  1FKL A;  4KR0 B;  3IKG A;  2G41 A;  4HAR A;  3WD2 A;  2DSZ A;  3UI5 A;  1QZ2 A;  1WR7 A;  2YSF A;  1P5Q A;  2DK7 A;  2M8I A;  4G2P A;  2M2A A;  2LJ4 A;  5HTG A;  3O5I A;  3UQI A;  4IT6 A;  3AQU A;  1OGG A;  3QOK A;  1ZBC A;  1HKJ A;  4QIB A;  3CZ8 A;  3PRB A;  3KCE A;  2LKN A;  3ALF A;  3WD3 A;  3IK8 A;  4PTM A;  1FKI A;  2FKE A;  3JYM A;  1HJV A;  4C02 B;  2DT3 A;  1FFQ A;  1J4I A;  1JVW A;  2XPB A;  2RUD A;  1FKK A;  4Z2G A;  2YBT A;  1NWR A;  3PR9 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...