4U86A

Human pin1 with cysteine sulfonic acid 113
Total Genus 44
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
44
sequence length
158
structure length
144
Chain Sequence
KLPPGWEKAMSRSSGRVYYFNHITNASQWERPEPARVRCSHLLVKHSQSRRPSSWRQEKITRTKEEALELINGYIQKIKSGEEDFESLASQFSDSSAKARGDLGAFSRGQMQKPFEDASFALRTGEMSGPVFTDSGIHIILRTE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Pin1 cysteine-113 oxidation inhibits its catalytic activity and cellular function in Alzheimer's disease.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Isomerase
molecule keywords Peptidyl-prolyl cis-trans isomerase NIMA-interacting 1
total genus 44
structure length 144
sequence length 158
ec nomenclature ec 5.2.1.8: Peptidylprolyl isomerase.
pdb deposition date 2014-08-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00397 WW WW domain
A PF00639 Rotamase PPIC-type PPIASE domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.20.70.10 Mainly Beta Single Sheet Ubiquitin Ligase Nedd4; Chain: W; Ubiquitin Ligase Nedd4; Chain: W; 4u86A01
3.10.50.40 Alpha Beta Roll Chitinase A; domain 3 Chitinase A; domain 3 4u86A02
4JFMA 3UI4A 1QPLA 1NSGA 2JXWA 3M7NA 2F2DA 2XP7A 2ZQTA 3JYMA 2JX8A 3IHZA 3B7XA 4TX0A 2LKNA 4ODQA 1BL4A 2UZ5A 1D7JA 4JFIA 1FKBA 3O5FA 3IKDA 1WR7A 1FAPA 4ITZA 4JFKA 4U85A 4IQCA 4LAXA 4LAVA 3NTPA 4N19A 2L4JA 1J4HA 2RUQA 3O5DA 2PBCA 1YATA 4LAWA 2F4EA 3PRBA 2RURA 2DWVA 3O5MA 3UF8A 3UI5A 4ODKA 3MDYB 5HW6A 3UQBA 2M2AA 4J4OA 2LGOA 2ZAJA 4QIBA 3KAIA 3KZ7A 3CNGA 2KO7A 2MLZA 2Y78A 2BA1A 2FAPA 2DK1A 2M08A 4J4NA 1FKFA 4JFJA 3UQAA 1J4RA 1N1AA 1D7IA 2MPHA 3KAGA 1EG4A 5CQ2A 4IQ2A 3UI6A 4DROA 2Q5AA 2N87A 3LE4A 5HT1A 5HW7A 1FKTA 3I6CA 1BKFA 4G50A 2YSBA 3ODKA 3LUOA 2XP3A 2XP9A 3O5EA 3O5LA 2XP5A 2ZR5A 1FKIA 3TCZA 1W26A 3JXVA 4C02B 4DRHA 2ZQVA 5B8IC 5J6EA 3O5QA 3TC5A 1T11A 4DRQA 2ZR6A 1JNTA 1R9HA 3TDBA 3FAPA 2JZVA 2PV3A 4GIVA 5DITA 2PV1A 5HW8A 1Q6IA 2L2SA 1A7XA 2MDIA 1WMVA 1P5QA 5DIVA 1B6CA 2XP4A 2YSHA 1K9RA 1QZ2A 2DG4A 2DJYA 2YSFA 3KAHA 1D6OA 1EG3A 1QPFA 1I5HW 1FKSA 2XPAA 2EZ5W 5D75A 3CGMA 1EYMA 3O5PA 2F21A 1KT1A 4W9PA 1L1PA 2AWGA 4GGQA 2ZR4A 1FD9A 4LAYA 2LAJA 2JMFA 3PRDA 2D9FA 4DT4A 2M8IA 2DG3A 2MLXA 1NMVA 2PPNA 1PBKA 1Q6UA 3O5GA 2IF4A 4JYSA 3KAFA 5DIUA 5HWCA 5AHTA 3KABA 4ODPA 2DMVA 4R0XA 4FAPA 2RUCA 1FKKA 3NRKA 4DH0A 4DRKA 2MNTA 3WH0A 2K8IA 3O5OA 4O2TA 4DZ3A 2VN1A 3CGNA 1FKDA 5HWBA 1TCOC 2M3OW 1FJDA 3KADA 2M1IA 3M85A 2MF9A 2PPPA 3NI6A 2YSGA 3PA7A 2KR7A 4TYOA 2XP8A 4TW6A 4IPXA 3O5KA 3EY6A 2M8JA 4DRNA 2XP6A 1M5YA 3UQIA 3RFWA 1O6WA 1F8AB 2RQSA 2RUDA 1PINA 2RSEA 4DIPA 2ZQSA 5BXJA 1YW5A 1NMWA 1Q6HA 4QT3A 2OFNA 4BF8A 1Y0OA 1ROUA 4MGVA 3IK8A 2KE0A 2VCDA 4TNSA 5HTGA 2ZQUA 4TW7A 2LJ4A 2MLYA 3O5RA 1FKHA 1U79A 4NNRA 1F40A 3VAWA 4ODRA 4REXA 1ZK6A 2DG9A 4DRMA 1FKRA 1ZCNA 1J4IA 2FKEA 2DK7A 4MSPA 1ROTA 4TW8A 3L4HA 3RGCA 2XPBA 1KT0A 4QT2A 1K9QA 4JFLA 1Q1CA 4W9QA 4DRIA 4DRPA 4DZ2A 1EQ3A 2JV4A 3KCEA 1D7HA 4ODMA 5I98A 2ITKA 1JMQA 1FKLA 4W9OA 1JNSA 3IKGA 1FKGA 1TK7A 5HUAA 4ODNA 4U84A 2LPVA 2E45A 4DRJA 4E5RA 2PV2A 3OOBA 2RE3A 4U86A 4ODOA 2KGJA 5HKGA 1J6YA 3GPKA 4FN2A 1JVWA 3O5JA 4ODLA 2KFWA 2YSIA 3JYJA 1C9HA 3H9RB 3O5IA 1FKJA 2PPOA 1HXVA 2KXQA 3KACA 5GPGA 2KI3A 4G2PA
chains in the Genus database with same CATH superfamily
3UI4A 1NSGA 4KQZA 2JXWA 3M7NA 2P4VA 4Z2LA 4Z2GA 3JYMA 3PR9A 5U47A 1FKBA 2EULA 2ETNA 1WR7A 4U85A 4LAVA 3ALFA 3UF8A 3BXWA 3UI5A 3MDYB 3B9EA 4P8VA 3KZ7A 3CHDA 2MLZA 2DPEA 3FS8A 5E66A 2DK1A 2F23A 1FKFA 3ARTA 4WKFA 3UQAA 1D7IA 4MNMA 4XAKA 4ZPVR 3UI6A 4IQ2A 2N87A 3LE4A 1FKTA 5DEZA 3FSBA 3I6CA 1W9VA 1LJYA 2XP3A 4GLXA 1RP5A 3WIJA 4C02B 2A3EA 3WD1A 3O5QA 4DRQA 1R9HA 2PV3A 2PV1A 1A7XA 1H0IA 2DG4A 1OGBA 1D6OA 1W1PA 1FKSA 3CGMA 2ZR4A 2LAJA 4DT4A 2DG3A 3MQHA 1E9LA 4Q7NA 5DIUA 1EHNA 5HWCA 1E6RA 2YBUA 4MNJA 3ARSA 2MNTA 3WH0A 3ALGA 1FKDA 1TCOC 1HKMA 3NI6A 3PA7A 2KR7A 5E65A 1XHGA 3RFWA 2FDMA 4BF8A 2KE0A 4TW7A 1ZBCA 1LQ0A 2LJ4A 3O5RA 1U79A 4NNRA 3ARYA 2DT0A 1WB0A 3VAWA 1FKRA 4MSPA 4PTMA 1K9QA 4DZ2A 1ZBKA 1ZBWA 1FKLA 1HKJA 3IKGA 1FKGA 3ARXA 4MPKA 1JNDA 1E44A 1W1YA 4MNLA 5DO2A 3O5JA 3AS3A 2KFWA 3JYJA 1FKJA 3O5LA 2KI3A 4DWSB 1SR0A 4DWSD 2XP7A 1EDQA 4MTVA 4TX0A 2UZ5A 3IKDA 4R5EA 4Q22A 1LL6A 4L3NA 2L4JA 3AS1A 1YATA 1XRVA 2F4EA 2DWVA 4DWSA 1FFQA 5HW6A 3UQBA 2M2AA 3KAIA 3WQVA 1TFVA 2PI6A 2MPHA 4DROA 1EG4A 2Q5AA 5E62A 1BKFA 3PRAA 1CTNA 4ML4A 4A0UA 4A0TA 2XP9A 2XP5A 2ZR5A 3JXVA 4P8XA 2ZQVA 2ESCA 5J6EA 1D2KA 2AOSA 1FJDA 2A3CA 5HW8A 3FY1A 2DT2A 2DT1A 1QZ2A 1K9RA 1W9UA 2PN0A 3GTYX 1QPFA 1NWRA 2DSWA 2EZ5W 3AS0A 1EYMA 2F21A 2AWGA 3AROA 3PRDA 1K9TA 4DWSC 2A3AA 1E6PA 1ZU8A 3O5GA 4JYSA 3KAFA 1LG2A 2RUCA 1FKKA 3RM9A 3O5OA 3CGNA 4HBOA 5HWBA 2M3OW 1GRJA 2MF9A 2PPPA 3CHFA 2YSGA 2A3BA 3EY6A 4DRNA 2XP6A 4W5UA 3UQIA 1NMWA 1Q6HA 1HKKA 1OGGA 1Y0OA 1ZBVA 3IK8A 4IT4A 2VCDA 2QF8A 4ODRA 3G6MA 2OWOA 1ROTA 3L4HA 1UR8A 4TW8A 1KT0A 3CZ8A 4QT2A 3BMBA 1X6LA 3ARZA 4DRIA 2JV4A 1JNSA 1HKIA 4AY1A 5I98A 2ITKA 1JMQA 1JNEA 4WIWA 2E45A 4DRJA 4ODOA 4U86A 3ARUA 3MCBA 3WL1A 3WKZA 3H9RB 2Y8NB 4G2PA 4JFMA 4ZS6A 2ZQTA 3CHEA 2JX8A 3IHZA 2LKNA 1BL4A 1SYTA 4WK9A 3O5FA 3WD0A 4IQCA 3FXYA 3NTPA 1KFWA 4N19A 2PBCA 2RURA 1GUVA 2WADA 4J4OA 2LGOA 2ZAJA 1W9PA 2Y78A 4IT6A 1UR9A 3ARWA 1E6NA 1J4RA 1N1AA 2DT3A 2WAEA 3RM8A 5HT1A 3OA5A 2YSBA 4ZPWR 4Z2JA 1HJXA 2WLYA 3LUOA 2DSZA 1FKIA 3TCZA 1W26A 4DRHA 1FFRA 3TC5A 1T11A 2ZR6A 1JNTA 5DITA 3TDBA 3FAPA 2JZVA 4URIA 5JH8A 1P5QA 5DIVA 3B8SA 2YSHA 1ITXA 2DJYA 1EG3A 3CH9A 4QZVB 5D75A 1L1PA 3WD2A 1KT1A 5GQBA 4GGQA 2YAJB 4LAYA 3CHCA 2D9FA 1NMVA 4KR0B 3LKXB 3AS2A 1X6NA 4P8UA 2IUZA 3KABA 2G41A 4ODPA 1LG1A 2B31A 4MAVA 4MNKA 4S3KA 4WJXA 4DZ3A 2VN1A 3M85A 4Z2HA 2YBTA 4IPXA 3O5KA 1W1VA 4S3JA 1GOIA 1M5YA 2RUDA 2RQSA 1PINA 2WLZA 2ZQSA 5BXJA 3B9AA 1JCHB 4MGVA 2ZQUA 1FKHA 1F40A 1ZK6A 2DG9A 1ZCNA 1J4IA 2DK7A 1NWUA 3RGCA 3EIPA 4JFLA 4DRPA 1Q1CA 4ODMA 1D7HA 3WQWA 3AQUA 4W9OA 1TK7A 3MQGA 2LPVA 4E5RA 2PV2A 3OOBA 1ZB5A 3GPKA 2B5UB 1NH6A 3O5IA 1HXVA 2KXQA 2WM0A 3KACA 1QPLA 2F2DA 1H0GA 4NSBA 4Z2KA 3B7XA 1E15A 4ODQA 1D7JA 4JFIA 2OLHA 1FAPA 4ITZA 4JFKA 1O6IA 4L72B 4LAXA 3FSCA 3ARVA 1J4HA 1NWSA 2RUQA 3ARRA 1E6ZA 3O5DA 4LAWA 4ZPTR 3PRBA 1RD6A 3O5MA 3ARQA 4ODKA 1IX5A 4QIBA 3CNGA 5E5WA 2KO7A 2O9OA 3GU0A 2BA1A 3PQHA 2FAPA 2M08A 4J4NA 4JFJA 3KAGA 5CQ2A 3WL0A 5HW7A 4G50A 1VF8A 2DSUA 3ODKA 3O5EA 2WK2A 1LL4A 1ZL1A 5B8IC 3B9DA 4Z2IA 4GIVA 1Q6IA 2L2SA 1OWQA 4WKAA 2MDIA 1WMVA 1B6CA 2XP4A 1NWTA 3RMEA 2YSFA 3KAHA 1FLCA 1HJWA 2O92A 1I5HW 2XPAA 3O5PA 4W9PA 1GPFA 1FD9A 1WAWA 5GPRA 3G6LA 2JMFA 2M8IA 2MLXA 2PPNA 5DF0A 1HJVA 1PBKA 1Q6UA 2IF4A 5AHTA 2DMVA 4R0XA 4P8WA 4FAPA 4DH0A 3NRKA 4DRKA 3LKXA 2K8IA 4O2TA 2DSVA 4HARA 3QOKA 3KADA 2M1IA 4HBEA 2G8ZA 4TYOA 4NZCA 2XP8A 4TW6A 2M8JA 3ARPA 1F8AB 1O6WA 3RM4A 2RSEA 4DIPA 1YW5A 4QT3A 2OFNA 4LGXA 4WKHA 1ROUA 4UDMA 3W4RA 5HTGA 4TNSA 1TR8A 2MLYA 1W1TA 4REXA 4DRMA 2FKEA 3MCBB 2XPBA 4W9QA 1EQ3A 3WD4A 1EIBA 3KCEA 5HUAA 4ODNA 4U84A 5E64A 2QRVA 1J6YA 2RE3A 3WD3A 5HKGA 2KGJA 4FN2A 1JVWA 4ODLA 5HBFA 2YSIA 1C9HA 2PPOA 1WNOA 5GPGA 1LL7A
chains in the Genus database with same CATH topology
3UI4A 1NSGA 4KQZA 2JXWA 3M7NA 4Z2LA 4Z2GA 3JYMA 3PR9A 5U47A 1FKBA 1WR7A 4U85A 4LAVA 3ALFA 3UF8A 3BXWA 3UI5A 3MDYB 3B9EA 4P8VA 3KZ7A 3CHDA 2MLZA 2DPEA 3FS8A 5E66A 2DK1A 1FKFA 3ARTA 4WKFA 3UQAA 1D7IA 4MNMA 4XAKA 4ZPVR 3UI6A 4IQ2A 2N87A 3LE4A 1FKTA 5DEZA 3FSBA 3I6CA 1W9VA 1LJYA 2XP3A 4GLXA 1RP5A 3WIJA 4C02B 2A3EA 3WD1A 3O5QA 4DRQA 1R9HA 2PV3A 2PV1A 1A7XA 1H0IA 2DG4A 1OGBA 1D6OA 1W1PA 1FKSA 3CGMA 2ZR4A 2LAJA 4DT4A 2DG3A 3MQHA 1E9LA 4Q7NA 5DIUA 1EHNA 5HWCA 1E6RA 2YBUA 4MNJA 3ARSA 2MNTA 3WH0A 3ALGA 1FKDA 1TCOC 1HKMA 3NI6A 3PA7A 2KR7A 5E65A 1XHGA 3RFWA 2FDMA 4BF8A 2KE0A 4TW7A 1ZBCA 1LQ0A 2LJ4A 3O5RA 1U79A 4NNRA 3ARYA 2DT0A 1WB0A 3VAWA 1FKRA 4MSPA 4PTMA 1K9QA 4DZ2A 1ZBKA 1ZBWA 1FKLA 1HKJA 3IKGA 1FKGA 3ARXA 4MPKA 1JNDA 1W1YA 4MNLA 5DO2A 3O5JA 3AS3A 2KFWA 3JYJA 1FKJA 3O5LA 2KI3A 4DWSB 1SR0A 4DWSD 2XP7A 1EDQA 4MTVA 4TX0A 2UZ5A 3IKDA 4R5EA 4Q22A 1LL6A 4L3NA 2L4JA 3AS1A 1YATA 1XRVA 2F4EA 2DWVA 4DWSA 1FFQA 5HW6A 3UQBA 2M2AA 3KAIA 3WQVA 1TFVA 2PI6A 2MPHA 4DROA 1EG4A 2Q5AA 5E62A 1BKFA 3PRAA 1CTNA 4ML4A 4A0UA 4A0TA 2XP9A 2XP5A 2ZR5A 3JXVA 4P8XA 2ZQVA 2ESCA 5J6EA 1D2KA 2AOSA 1FJDA 2A3CA 5HW8A 3FY1A 2DT2A 2DT1A 1QZ2A 1K9RA 1W9UA 1QPFA 1NWRA 2DSWA 2EZ5W 3AS0A 1EYMA 2F21A 2AWGA 3AROA 3PRDA 1K9TA 4DWSC 2A3AA 1E6PA 1ZU8A 3O5GA 4JYSA 3KAFA 1LG2A 2RUCA 1FKKA 3RM9A 3O5OA 3CGNA 4HBOA 5HWBA 2M3OW 2MF9A 2PPPA 3CHFA 2YSGA 2A3BA 3EY6A 4DRNA 2XP6A 4W5UA 3UQIA 1NMWA 1Q6HA 1HKKA 1OGGA 1Y0OA 1ZBVA 3IK8A 4IT4A 2VCDA 2QF8A 4ODRA 3G6MA 2OWOA 1ROTA 3L4HA 1UR8A 4TW8A 1KT0A 3CZ8A 4QT2A 4DRIA 1X6LA 3ARZA 2JV4A 1JNSA 1HKIA 4AY1A 5I98A 2ITKA 1JMQA 1JNEA 4WIWA 2E45A 4DRJA 4ODOA 4U86A 3ARUA 3MCBA 3WL1A 3WKZA 3H9RB 2Y8NB 4G2PA 4JFMA 4ZS6A 2ZQTA 3CHEA 2JX8A 3IHZA 2LKNA 1BL4A 1SYTA 4WK9A 3O5FA 3WD0A 4IQCA 3FXYA 3NTPA 1KFWA 4N19A 2PBCA 2RURA 1GUVA 2WADA 4J4OA 2LGOA 2ZAJA 1W9PA 2Y78A 4IT6A 1UR9A 3ARWA 1E6NA 1J4RA 1N1AA 2DT3A 2WAEA 3RM8A 5HT1A 3OA5A 2YSBA 4ZPWR 4Z2JA 1HJXA 2WLYA 3LUOA 2DSZA 1FKIA 3TCZA 1W26A 4DRHA 1FFRA 3TC5A 1T11A 2ZR6A 1JNTA 5DITA 3TDBA 3FAPA 2JZVA 4URIA 5JH8A 1P5QA 5DIVA 3B8SA 2YSHA 1ITXA 2DJYA 1EG3A 3CH9A 4QZVB 5D75A 1L1PA 3WD2A 1KT1A 5GQBA 4GGQA 2YAJB 4LAYA 3CHCA 2D9FA 1NMVA 4KR0B 3LKXB 3AS2A 1X6NA 4P8UA 2IUZA 3KABA 2G41A 4ODPA 1LG1A 2B31A 4MAVA 4MNKA 4S3KA 4WJXA 4DZ3A 2VN1A 3M85A 4Z2HA 2YBTA 4IPXA 3O5KA 1W1VA 4S3JA 1GOIA 1M5YA 2RUDA 2RQSA 1PINA 2WLZA 2ZQSA 5BXJA 3B9AA 4MGVA 2ZQUA 1FKHA 1F40A 1ZK6A 2DG9A 1ZCNA 1J4IA 2DK7A 1NWUA 3RGCA 4JFLA 4DRPA 1Q1CA 4ODMA 1D7HA 3WQWA 3AQUA 4W9OA 1TK7A 3MQGA 2LPVA 4E5RA 2PV2A 3OOBA 1ZB5A 3GPKA 1NH6A 3O5IA 1HXVA 2KXQA 2WM0A 3KACA 1QPLA 2F2DA 1H0GA 4NSBA 4Z2KA 3B7XA 1E15A 4ODQA 1D7JA 4JFIA 2OLHA 1FAPA 4ITZA 4JFKA 1O6IA 4L72B 4LAXA 3FSCA 3ARVA 1J4HA 1NWSA 2RUQA 3ARRA 1E6ZA 3O5DA 4LAWA 4ZPTR 3PRBA 1RD6A 3O5MA 3ARQA 4ODKA 1IX5A 4QIBA 3CNGA 5E5WA 2KO7A 2O9OA 2BA1A 3PQHA 2FAPA 2M08A 4J4NA 4JFJA 3KAGA 5CQ2A 3WL0A 5HW7A 4G50A 1VF8A 2DSUA 3ODKA 3O5EA 2WK2A 1LL4A 1ZL1A 5B8IC 3B9DA 4Z2IA 4GIVA 1Q6IA 2L2SA 1OWQA 4WKAA 2MDIA 1WMVA 1B6CA 2XP4A 1NWTA 3RMEA 2YSFA 3KAHA 1FLCA 1HJWA 2O92A 1I5HW 2XPAA 3O5PA 4W9PA 1GPFA 1FD9A 1WAWA 5GPRA 3G6LA 2JMFA 2M8IA 2MLXA 2PPNA 5DF0A 1HJVA 1PBKA 1Q6UA 2IF4A 5AHTA 2DMVA 4R0XA 4P8WA 4FAPA 4DH0A 3NRKA 4DRKA 3LKXA 2K8IA 4O2TA 2DSVA 4HARA 3QOKA 3KADA 2M1IA 4HBEA 2G8ZA 4TYOA 4NZCA 2XP8A 4TW6A 2M8JA 3ARPA 1F8AB 1O6WA 3RM4A 2RSEA 4DIPA 1YW5A 4QT3A 2OFNA 4LGXA 4WKHA 1ROUA 3W4RA 5HTGA 4TNSA 1TR8A 2MLYA 1W1TA 4REXA 4DRMA 2FKEA 3MCBB 2XPBA 4W9QA 1EQ3A 3WD4A 1EIBA 3KCEA 5HUAA 4ODNA 4U84A 5E64A 2QRVA 1J6YA 2RE3A 3WD3A 5HKGA 2KGJA 4FN2A 1JVWA 4ODLA 5HBFA 2YSIA 1C9HA 2PPOA 1WNOA 5GPGA 1LL7A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4JFM A;  3UI4 A;  1QPL A;  1NSG A;  2JXW A;  3M7N A;  2F2D A;  2XP7 A;  2ZQT A;  3JYM A;  2JX8 A;  3IHZ A;  3B7X A;  4TX0 A;  2LKN A;  4ODQ A;  1BL4 A;  2UZ5 A;  1D7J A;  4JFI A;  1FKB A;  3O5F A;  3IKD A;  1WR7 A;  1FAP A;  4ITZ A;  4JFK A;  4U85 A;  4IQC A;  4LAX A;  4LAV A;  3NTP A;  4N19 A;  2L4J A;  1J4H A;  2RUQ A;  3O5D A;  2PBC A;  1YAT A;  4LAW A;  2F4E A;  3PRB A;  2RUR A;  2DWV A;  3O5M A;  3UF8 A;  3UI5 A;  4ODK A;  3MDY B;  5HW6 A;  3UQB A;  2M2A A;  4J4O A;  2LGO A;  2ZAJ A;  4QIB A;  3KAI A;  3KZ7 A;  3CNG A;  2KO7 A;  2MLZ A;  2Y78 A;  2BA1 A;  2FAP A;  2DK1 A;  2M08 A;  4J4N A;  1FKF A;  4JFJ A;  3UQA A;  1J4R A;  1N1A A;  1D7I A;  2MPH A;  3KAG A;  1EG4 A;  5CQ2 A;  4IQ2 A;  3UI6 A;  4DRO A;  2Q5A A;  2N87 A;  3LE4 A;  5HT1 A;  5HW7 A;  1FKT A;  3I6C A;  1BKF A;  4G50 A;  2YSB A;  3ODK A;  3LUO A;  2XP3 A;  2XP9 A;  3O5E A;  3O5L A;  2XP5 A;  2ZR5 A;  1FKI A;  3TCZ A;  1W26 A;  3JXV A;  4C02 B;  4DRH A;  2ZQV A;  5B8I C;  5J6E A;  3O5Q A;  3TC5 A;  1T11 A;  4DRQ A;  2ZR6 A;  1JNT A;  1R9H A;  3TDB A;  3FAP A;  2JZV A;  2PV3 A;  4GIV A;  5DIT A;  2PV1 A;  5HW8 A;  1Q6I A;  2L2S A;  1A7X A;  2MDI A;  1WMV A;  1P5Q A;  5DIV A;  1B6C A;  2XP4 A;  2YSH A;  1K9R A;  1QZ2 A;  2DG4 A;  2DJY A;  2YSF A;  3KAH A;  1D6O A;  1EG3 A;  1QPF A;  1I5H W;  1FKS A;  2XPA A;  2EZ5 W;  5D75 A;  3CGM A;  1EYM A;  3O5P A;  2F21 A;  1KT1 A;  4W9P A;  1L1P A;  2AWG A;  4GGQ A;  2ZR4 A;  1FD9 A;  4LAY A;  2LAJ A;  2JMF A;  3PRD A;  2D9F A;  4DT4 A;  2M8I A;  2DG3 A;  2MLX A;  1NMV A;  2PPN A;  1PBK A;  1Q6U A;  3O5G A;  2IF4 A;  4JYS A;  3KAF A;  5DIU A;  5HWC A;  5AHT A;  3KAB A;  4ODP A;  2DMV A;  4R0X A;  4FAP A;  2RUC A;  1FKK A;  3NRK A;  4DH0 A;  4DRK A;  2MNT A;  3WH0 A;  2K8I A;  3O5O A;  4O2T A;  4DZ3 A;  2VN1 A;  3CGN A;  1FKD A;  5HWB A;  1TCO C;  2M3O W;  1FJD A;  3KAD A;  2M1I A;  3M85 A;  2MF9 A;  2PPP A;  3NI6 A;  2YSG A;  3PA7 A;  2KR7 A;  4TYO A;  2XP8 A;  4TW6 A;  4IPX A;  3O5K A;  3EY6 A;  2M8J A;  4DRN A;  2XP6 A;  1M5Y A;  3UQI A;  3RFW A;  1O6W A;  1F8A B;  2RQS A;  2RUD A;  1PIN A;  2RSE A;  4DIP A;  2ZQS A;  5BXJ A;  1YW5 A;  1NMW A;  1Q6H A;  4QT3 A;  2OFN A;  4BF8 A;  1Y0O A;  1ROU A;  4MGV A;  3IK8 A;  2KE0 A;  2VCD A;  4TNS A;  5HTG A;  2ZQU A;  4TW7 A;  2LJ4 A;  2MLY A;  3O5R A;  1FKH A;  1U79 A;  4NNR A;  1F40 A;  3VAW A;  4ODR A;  4REX A;  1ZK6 A;  2DG9 A;  4DRM A;  1FKR A;  1ZCN A;  1J4I A;  2FKE A;  2DK7 A;  4MSP A;  1ROT A;  4TW8 A;  3L4H A;  3RGC A;  2XPB A;  1KT0 A;  4QT2 A;  1K9Q A;  4JFL A;  1Q1C A;  4W9Q A;  4DRI A;  4DRP A;  4DZ2 A;  1EQ3 A;  2JV4 A;  3KCE A;  1D7H A;  4ODM A;  5I98 A;  2ITK A;  1JMQ A;  1FKL A;  4W9O A;  1JNS A;  3IKG A;  1FKG A;  1TK7 A;  5HUA A;  4ODN A;  4U84 A;  2LPV A;  2E45 A;  4DRJ A;  4E5R A;  2PV2 A;  3OOB A;  2RE3 A;  4U86 A;  4ODO A;  2KGJ A;  5HKG A;  1J6Y A;  3GPK A;  4FN2 A;  1JVW A;  3O5J A;  4ODL A;  2KFW A;  2YSI A;  3JYJ A;  1C9H A;  3H9R B;  3O5I A;  1FKJ A;  2PPO A;  1HXV A;  2KXQ A;  3KAC A;  5GPG A;  2KI3 A;  4G2P A; 
#chains in the Genus database with same CATH topology
 3UI4 A;  1NSG A;  4KQZ A;  2JXW A;  3M7N A;  2P4V A;  4Z2L A;  4Z2G A;  3JYM A;  3PR9 A;  5U47 A;  1FKB A;  2EUL A;  2ETN A;  1WR7 A;  4U85 A;  4LAV A;  3ALF A;  3UF8 A;  3BXW A;  3UI5 A;  3MDY B;  3B9E A;  4P8V A;  3KZ7 A;  3CHD A;  2MLZ A;  2DPE A;  3FS8 A;  5E66 A;  2DK1 A;  2F23 A;  1FKF A;  3ART A;  4WKF A;  3UQA A;  1D7I A;  4MNM A;  4XAK A;  4ZPV R;  3UI6 A;  4IQ2 A;  2N87 A;  3LE4 A;  1FKT A;  5DEZ A;  3FSB A;  3I6C A;  1W9V A;  1LJY A;  2XP3 A;  4GLX A;  1RP5 A;  3WIJ A;  4C02 B;  2A3E A;  3WD1 A;  3O5Q A;  4DRQ A;  1R9H A;  2PV3 A;  2PV1 A;  1A7X A;  1H0I A;  2DG4 A;  1OGB A;  1D6O A;  1W1P A;  1FKS A;  3CGM A;  2ZR4 A;  2LAJ A;  4DT4 A;  2DG3 A;  3MQH A;  1E9L A;  4Q7N A;  5DIU A;  1EHN A;  5HWC A;  1E6R A;  2YBU A;  4MNJ A;  3ARS A;  2MNT A;  3WH0 A;  3ALG A;  1FKD A;  1TCO C;  1HKM A;  3NI6 A;  3PA7 A;  2KR7 A;  5E65 A;  1XHG A;  3RFW A;  2FDM A;  4BF8 A;  2KE0 A;  4TW7 A;  1ZBC A;  1LQ0 A;  2LJ4 A;  3O5R A;  1U79 A;  4NNR A;  3ARY A;  2DT0 A;  1WB0 A;  3VAW A;  1FKR A;  4MSP A;  4PTM A;  1K9Q A;  4DZ2 A;  1ZBK A;  1ZBW A;  1FKL A;  1HKJ A;  3IKG A;  1FKG A;  3ARX A;  4MPK A;  1JND A;  1E44 A;  1W1Y A;  4MNL A;  5DO2 A;  3O5J A;  3AS3 A;  2KFW A;  3JYJ A;  1FKJ A;  3O5L A;  2KI3 A;  4DWS B;  1SR0 A;  4DWS D;  2XP7 A;  1EDQ A;  4MTV A;  4TX0 A;  2UZ5 A;  3IKD A;  4R5E A;  4Q22 A;  1LL6 A;  4L3N A;  2L4J A;  3AS1 A;  1YAT A;  1XRV A;  2F4E A;  2DWV A;  4DWS A;  1FFQ A;  5HW6 A;  3UQB A;  2M2A A;  3KAI A;  3WQV A;  1TFV A;  2PI6 A;  2MPH A;  4DRO A;  1EG4 A;  2Q5A A;  5E62 A;  1BKF A;  3PRA A;  1CTN A;  4ML4 A;  4A0U A;  4A0T A;  2XP9 A;  2XP5 A;  2ZR5 A;  3JXV A;  4P8X A;  2ZQV A;  2ESC A;  5J6E A;  1D2K A;  2AOS A;  1FJD A;  2A3C A;  5HW8 A;  3FY1 A;  2DT2 A;  2DT1 A;  1QZ2 A;  1K9R A;  1W9U A;  2PN0 A;  3GTY X;  1QPF A;  1NWR A;  2DSW A;  2EZ5 W;  3AS0 A;  1EYM A;  2F21 A;  2AWG A;  3ARO A;  3PRD A;  1K9T A;  4DWS C;  2A3A A;  1E6P A;  1ZU8 A;  3O5G A;  4JYS A;  3KAF A;  1LG2 A;  2RUC A;  1FKK A;  3RM9 A;  3O5O A;  3CGN A;  4HBO A;  5HWB A;  2M3O W;  1GRJ A;  2MF9 A;  2PPP A;  3CHF A;  2YSG A;  2A3B A;  3EY6 A;  4DRN A;  2XP6 A;  4W5U A;  3UQI A;  1NMW A;  1Q6H A;  1HKK A;  1OGG A;  1Y0O A;  1ZBV A;  3IK8 A;  4IT4 A;  2VCD A;  2QF8 A;  4ODR A;  3G6M A;  2OWO A;  1ROT A;  3L4H A;  1UR8 A;  4TW8 A;  1KT0 A;  3CZ8 A;  4QT2 A;  3BMB A;  1X6L A;  3ARZ A;  4DRI A;  2JV4 A;  1JNS A;  1HKI A;  4AY1 A;  5I98 A;  2ITK A;  1JMQ A;  1JNE A;  4WIW A;  2E45 A;  4DRJ A;  4ODO A;  4U86 A;  3ARU A;  3MCB A;  3WL1 A;  3WKZ A;  3H9R B;  2Y8N B;  4G2P A;  4JFM A;  4ZS6 A;  2ZQT A;  3CHE A;  2JX8 A;  3IHZ A;  2LKN A;  1BL4 A;  1SYT A;  4WK9 A;  3O5F A;  3WD0 A;  4IQC A;  3FXY A;  3NTP A;  1KFW A;  4N19 A;  2PBC A;  2RUR A;  1GUV A;  2WAD A;  4J4O A;  2LGO A;  2ZAJ A;  1W9P A;  2Y78 A;  4IT6 A;  1UR9 A;  3ARW A;  1E6N A;  1J4R A;  1N1A A;  2DT3 A;  2WAE A;  3RM8 A;  5HT1 A;  3OA5 A;  2YSB A;  4ZPW R;  4Z2J A;  1HJX A;  2WLY A;  3LUO A;  2DSZ A;  1FKI A;  3TCZ A;  1W26 A;  4DRH A;  1FFR A;  3TC5 A;  1T11 A;  2ZR6 A;  1JNT A;  5DIT A;  3TDB A;  3FAP A;  2JZV A;  4URI A;  5JH8 A;  1P5Q A;  5DIV A;  3B8S A;  2YSH A;  1ITX A;  2DJY A;  1EG3 A;  3CH9 A;  4QZV B;  5D75 A;  1L1P A;  3WD2 A;  1KT1 A;  5GQB A;  4GGQ A;  2YAJ B;  4LAY A;  3CHC A;  2D9F A;  1NMV A;  4KR0 B;  3LKX B;  3AS2 A;  1X6N A;  4P8U A;  2IUZ A;  3KAB A;  2G41 A;  4ODP A;  1LG1 A;  2B31 A;  4MAV A;  4MNK A;  4S3K A;  4WJX A;  4DZ3 A;  2VN1 A;  3M85 A;  4Z2H A;  2YBT A;  4IPX A;  3O5K A;  1W1V A;  4S3J A;  1GOI A;  1M5Y A;  2RUD A;  2RQS A;  1PIN A;  2WLZ A;  2ZQS A;  5BXJ A;  3B9A A;  1JCH B;  4MGV A;  2ZQU A;  1FKH A;  1F40 A;  1ZK6 A;  2DG9 A;  1ZCN A;  1J4I A;  2DK7 A;  1NWU A;  3RGC A;  3EIP A;  4JFL A;  4DRP A;  1Q1C A;  4ODM A;  1D7H A;  3WQW A;  3AQU A;  4W9O A;  1TK7 A;  3MQG A;  2LPV A;  4E5R A;  2PV2 A;  3OOB A;  1ZB5 A;  3GPK A;  2B5U B;  1NH6 A;  3O5I A;  1HXV A;  2KXQ A;  2WM0 A;  3KAC A;  1QPL A;  2F2D A;  1H0G A;  4NSB A;  4Z2K A;  3B7X A;  1E15 A;  4ODQ A;  1D7J A;  4JFI A;  2OLH A;  1FAP A;  4ITZ A;  4JFK A;  1O6I A;  4L72 B;  4LAX A;  3FSC A;  3ARV A;  1J4H A;  1NWS A;  2RUQ A;  3ARR A;  1E6Z A;  3O5D A;  4LAW A;  4ZPT R;  3PRB A;  1RD6 A;  3O5M A;  3ARQ A;  4ODK A;  1IX5 A;  4QIB A;  3CNG A;  5E5W A;  2KO7 A;  2O9O A;  3GU0 A;  2BA1 A;  3PQH A;  2FAP A;  2M08 A;  4J4N A;  4JFJ A;  3KAG A;  5CQ2 A;  3WL0 A;  5HW7 A;  4G50 A;  1VF8 A;  2DSU A;  3ODK A;  3O5E A;  2WK2 A;  1LL4 A;  1ZL1 A;  5B8I C;  3B9D A;  4Z2I A;  4GIV A;  1Q6I A;  2L2S A;  1OWQ A;  4WKA A;  2MDI A;  1WMV A;  1B6C A;  2XP4 A;  1NWT A;  3RME A;  2YSF A;  3KAH A;  1FLC A;  1HJW A;  2O92 A;  1I5H W;  2XPA A;  3O5P A;  4W9P A;  1GPF A;  1FD9 A;  1WAW A;  5GPR A;  3G6L A;  2JMF A;  2M8I A;  2MLX A;  2PPN A;  5DF0 A;  1HJV A;  1PBK A;  1Q6U A;  2IF4 A;  5AHT A;  2DMV A;  4R0X A;  4P8W A;  4FAP A;  4DH0 A;  3NRK A;  4DRK A;  3LKX A;  2K8I A;  4O2T A;  2DSV A;  4HAR A;  3QOK A;  3KAD A;  2M1I A;  4HBE A;  2G8Z A;  4TYO A;  4NZC A;  2XP8 A;  4TW6 A;  2M8J A;  3ARP A;  1F8A B;  1O6W A;  3RM4 A;  2RSE A;  4DIP A;  1YW5 A;  4QT3 A;  2OFN A;  4LGX A;  4WKH A;  1ROU A;  4UDM A;  3W4R A;  5HTG A;  4TNS A;  1TR8 A;  2MLY A;  1W1T A;  4REX A;  4DRM A;  2FKE A;  3MCB B;  2XPB A;  4W9Q A;  1EQ3 A;  3WD4 A;  1EIB A;  3KCE A;  5HUA A;  4ODN A;  4U84 A;  5E64 A;  2QRV A;  1J6Y A;  2RE3 A;  3WD3 A;  5HKG A;  2KGJ A;  4FN2 A;  1JVW A;  4ODL A;  5HBF A;  2YSI A;  1C9H A;  2PPO A;  1WNO A;  5GPG A;  1LL7 A; 
#chains in the Genus database with same CATH homology
 3UI4 A;  1NSG A;  4KQZ A;  2JXW A;  3M7N A;  4Z2L A;  4Z2G A;  3JYM A;  3PR9 A;  5U47 A;  1FKB A;  1WR7 A;  4U85 A;  4LAV A;  3ALF A;  3UF8 A;  3BXW A;  3UI5 A;  3MDY B;  3B9E A;  4P8V A;  3KZ7 A;  3CHD A;  2MLZ A;  2DPE A;  3FS8 A;  5E66 A;  2DK1 A;  1FKF A;  3ART A;  4WKF A;  3UQA A;  1D7I A;  4MNM A;  4XAK A;  4ZPV R;  3UI6 A;  4IQ2 A;  2N87 A;  3LE4 A;  1FKT A;  5DEZ A;  3FSB A;  3I6C A;  1W9V A;  1LJY A;  2XP3 A;  4GLX A;  1RP5 A;  3WIJ A;  4C02 B;  2A3E A;  3WD1 A;  3O5Q A;  4DRQ A;  1R9H A;  2PV3 A;  2PV1 A;  1A7X A;  1H0I A;  2DG4 A;  1OGB A;  1D6O A;  1W1P A;  1FKS A;  3CGM A;  2ZR4 A;  2LAJ A;  4DT4 A;  2DG3 A;  3MQH A;  1E9L A;  4Q7N A;  5DIU A;  1EHN A;  5HWC A;  1E6R A;  2YBU A;  4MNJ A;  3ARS A;  2MNT A;  3WH0 A;  3ALG A;  1FKD A;  1TCO C;  1HKM A;  3NI6 A;  3PA7 A;  2KR7 A;  5E65 A;  1XHG A;  3RFW A;  2FDM A;  4BF8 A;  2KE0 A;  4TW7 A;  1ZBC A;  1LQ0 A;  2LJ4 A;  3O5R A;  1U79 A;  4NNR A;  3ARY A;  2DT0 A;  1WB0 A;  3VAW A;  1FKR A;  4MSP A;  4PTM A;  1K9Q A;  4DZ2 A;  1ZBK A;  1ZBW A;  1FKL A;  1HKJ A;  3IKG A;  1FKG A;  3ARX A;  4MPK A;  1JND A;  1W1Y A;  4MNL A;  5DO2 A;  3O5J A;  3AS3 A;  2KFW A;  3JYJ A;  1FKJ A;  3O5L A;  2KI3 A;  4DWS B;  1SR0 A;  4DWS D;  2XP7 A;  1EDQ A;  4MTV A;  4TX0 A;  2UZ5 A;  3IKD A;  4R5E A;  4Q22 A;  1LL6 A;  4L3N A;  2L4J A;  3AS1 A;  1YAT A;  1XRV A;  2F4E A;  2DWV A;  4DWS A;  1FFQ A;  5HW6 A;  3UQB A;  2M2A A;  3KAI A;  3WQV A;  1TFV A;  2PI6 A;  2MPH A;  4DRO A;  1EG4 A;  2Q5A A;  5E62 A;  1BKF A;  3PRA A;  1CTN A;  4ML4 A;  4A0U A;  4A0T A;  2XP9 A;  2XP5 A;  2ZR5 A;  3JXV A;  4P8X A;  2ZQV A;  2ESC A;  5J6E A;  1D2K A;  2AOS A;  1FJD A;  2A3C A;  5HW8 A;  3FY1 A;  2DT2 A;  2DT1 A;  1QZ2 A;  1K9R A;  1W9U A;  1QPF A;  1NWR A;  2DSW A;  2EZ5 W;  3AS0 A;  1EYM A;  2F21 A;  2AWG A;  3ARO A;  3PRD A;  1K9T A;  4DWS C;  2A3A A;  1E6P A;  1ZU8 A;  3O5G A;  4JYS A;  3KAF A;  1LG2 A;  2RUC A;  1FKK A;  3RM9 A;  3O5O A;  3CGN A;  4HBO A;  5HWB A;  2M3O W;  2MF9 A;  2PPP A;  3CHF A;  2YSG A;  2A3B A;  3EY6 A;  4DRN A;  2XP6 A;  4W5U A;  3UQI A;  1NMW A;  1Q6H A;  1HKK A;  1OGG A;  1Y0O A;  1ZBV A;  3IK8 A;  4IT4 A;  2VCD A;  2QF8 A;  4ODR A;  3G6M A;  2OWO A;  1ROT A;  3L4H A;  1UR8 A;  4TW8 A;  1KT0 A;  3CZ8 A;  4QT2 A;  4DRI A;  1X6L A;  3ARZ A;  2JV4 A;  1JNS A;  1HKI A;  4AY1 A;  5I98 A;  2ITK A;  1JMQ A;  1JNE A;  4WIW A;  2E45 A;  4DRJ A;  4ODO A;  4U86 A;  3ARU A;  3MCB A;  3WL1 A;  3WKZ A;  3H9R B;  2Y8N B;  4G2P A;  4JFM A;  4ZS6 A;  2ZQT A;  3CHE A;  2JX8 A;  3IHZ A;  2LKN A;  1BL4 A;  1SYT A;  4WK9 A;  3O5F A;  3WD0 A;  4IQC A;  3FXY A;  3NTP A;  1KFW A;  4N19 A;  2PBC A;  2RUR A;  1GUV A;  2WAD A;  4J4O A;  2LGO A;  2ZAJ A;  1W9P A;  2Y78 A;  4IT6 A;  1UR9 A;  3ARW A;  1E6N A;  1J4R A;  1N1A A;  2DT3 A;  2WAE A;  3RM8 A;  5HT1 A;  3OA5 A;  2YSB A;  4ZPW R;  4Z2J A;  1HJX A;  2WLY A;  3LUO A;  2DSZ A;  1FKI A;  3TCZ A;  1W26 A;  4DRH A;  1FFR A;  3TC5 A;  1T11 A;  2ZR6 A;  1JNT A;  5DIT A;  3TDB A;  3FAP A;  2JZV A;  4URI A;  5JH8 A;  1P5Q A;  5DIV A;  3B8S A;  2YSH A;  1ITX A;  2DJY A;  1EG3 A;  3CH9 A;  4QZV B;  5D75 A;  1L1P A;  3WD2 A;  1KT1 A;  5GQB A;  4GGQ A;  2YAJ B;  4LAY A;  3CHC A;  2D9F A;  1NMV A;  4KR0 B;  3LKX B;  3AS2 A;  1X6N A;  4P8U A;  2IUZ A;  3KAB A;  2G41 A;  4ODP A;  1LG1 A;  2B31 A;  4MAV A;  4MNK A;  4S3K A;  4WJX A;  4DZ3 A;  2VN1 A;  3M85 A;  4Z2H A;  2YBT A;  4IPX A;  3O5K A;  1W1V A;  4S3J A;  1GOI A;  1M5Y A;  2RUD A;  2RQS A;  1PIN A;  2WLZ A;  2ZQS A;  5BXJ A;  3B9A A;  4MGV A;  2ZQU A;  1FKH A;  1F40 A;  1ZK6 A;  2DG9 A;  1ZCN A;  1J4I A;  2DK7 A;  1NWU A;  3RGC A;  4JFL A;  4DRP A;  1Q1C A;  4ODM A;  1D7H A;  3WQW A;  3AQU A;  4W9O A;  1TK7 A;  3MQG A;  2LPV A;  4E5R A;  2PV2 A;  3OOB A;  1ZB5 A;  3GPK A;  1NH6 A;  3O5I A;  1HXV A;  2KXQ A;  2WM0 A;  3KAC A;  1QPL A;  2F2D A;  1H0G A;  4NSB A;  4Z2K A;  3B7X A;  1E15 A;  4ODQ A;  1D7J A;  4JFI A;  2OLH A;  1FAP A;  4ITZ A;  4JFK A;  1O6I A;  4L72 B;  4LAX A;  3FSC A;  3ARV A;  1J4H A;  1NWS A;  2RUQ A;  3ARR A;  1E6Z A;  3O5D A;  4LAW A;  4ZPT R;  3PRB A;  1RD6 A;  3O5M A;  3ARQ A;  4ODK A;  1IX5 A;  4QIB A;  3CNG A;  5E5W A;  2KO7 A;  2O9O A;  2BA1 A;  3PQH A;  2FAP A;  2M08 A;  4J4N A;  4JFJ A;  3KAG A;  5CQ2 A;  3WL0 A;  5HW7 A;  4G50 A;  1VF8 A;  2DSU A;  3ODK A;  3O5E A;  2WK2 A;  1LL4 A;  1ZL1 A;  5B8I C;  3B9D A;  4Z2I A;  4GIV A;  1Q6I A;  2L2S A;  1OWQ A;  4WKA A;  2MDI A;  1WMV A;  1B6C A;  2XP4 A;  1NWT A;  3RME A;  2YSF A;  3KAH A;  1FLC A;  1HJW A;  2O92 A;  1I5H W;  2XPA A;  3O5P A;  4W9P A;  1GPF A;  1FD9 A;  1WAW A;  5GPR A;  3G6L A;  2JMF A;  2M8I A;  2MLX A;  2PPN A;  5DF0 A;  1HJV A;  1PBK A;  1Q6U A;  2IF4 A;  5AHT A;  2DMV A;  4R0X A;  4P8W A;  4FAP A;  4DH0 A;  3NRK A;  4DRK A;  3LKX A;  2K8I A;  4O2T A;  2DSV A;  4HAR A;  3QOK A;  3KAD A;  2M1I A;  4HBE A;  2G8Z A;  4TYO A;  4NZC A;  2XP8 A;  4TW6 A;  2M8J A;  3ARP A;  1F8A B;  1O6W A;  3RM4 A;  2RSE A;  4DIP A;  1YW5 A;  4QT3 A;  2OFN A;  4LGX A;  4WKH A;  1ROU A;  3W4R A;  5HTG A;  4TNS A;  1TR8 A;  2MLY A;  1W1T A;  4REX A;  4DRM A;  2FKE A;  3MCB B;  2XPB A;  4W9Q A;  1EQ3 A;  3WD4 A;  1EIB A;  3KCE A;  5HUA A;  4ODN A;  4U84 A;  5E64 A;  2QRV A;  1J6Y A;  2RE3 A;  3WD3 A;  5HKG A;  2KGJ A;  4FN2 A;  1JVW A;  4ODL A;  5HBF A;  2YSI A;  1C9H A;  2PPO A;  1WNO A;  5GPG A;  1LL7 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...