4U86A

Human pin1 with cysteine sulfonic acid 113
Total Genus 44
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
44
sequence length
158
structure length
144
Chain Sequence
KLPPGWEKAMSRSSGRVYYFNHITNASQWERPEPARVRCSHLLVKHSQSRRPSSWRQEKITRTKEEALELINGYIQKIKSGEEDFESLASQFSDSSAKARGDLGAFSRGQMQKPFEDASFALRTGEMSGPVFTDSGIHIILRTE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Isomerase
molecule keywords Peptidyl-prolyl cis-trans isomerase NIMA-interacting 1
publication title Pin1 cysteine-113 oxidation inhibits its catalytic activity and cellular function in Alzheimer's disease.
pubmed doi rcsb
source organism Homo sapiens
total genus 44
structure length 144
sequence length 158
ec nomenclature ec 5.2.1.8: Peptidylprolyl isomerase.
pdb deposition date 2014-08-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00397 WW WW domain
A PF00639 Rotamase PPIC-type PPIASE domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.20.70.10 Mainly Beta Single Sheet Ubiquitin Ligase Nedd4; Chain: W; Ubiquitin Ligase Nedd4; Chain: W; 4u86A01
3.10.50.40 Alpha Beta Roll Chitinase A; domain 3 Chitinase A; domain 3 4u86A02
1YW5A 3ODKA 1FKFA 3O5KA 2RSEA 4J4NA 2PBCA 1EG3A 2XP9A 5BXJA 4IPXA 2MLYA 5CQ2A 2RUDA 1Q6UA 3NTPA 3TC5A 4MGVA 1QZ2A 2DMVA 1FAPA 4G50A 4TW8A 3TDBA 5I98A 1Q1CA 2ZR5A 1JNTA 3UI4A 2DK7A 1JVWA 4ITZA 4ODQA 2UZ5A 3UI6A 3KACA 4E5RA 5AHTA 2XP5A 1Q6IA 3B7XA 2N87A 3O5OA 3KZ7A 4MSPA 4TNSA 4TX0A 3O5GA 4TW6A 3UQBA 2D9FA 1QPFA 4FAPA 1EYMA 2JX8A 1R9HA 2IF4A 4BF8A 2RUQA 1M5YA 1KT1A 2L2SA 1EG4A 2MF9A 2Y78A 2DG4A 4DH0A 2MDIA 3KAGA 2KGJA 1NMWA 3RGCA 4DRJA 3O5LA 2YSGA 3IK8A 1I5HW 1J4HA 4LAYA 2M2AA 5J6EA 1FD9A 2RQSA 3LE4A 3KAHA 1D6OA 4J4OA 2RUCA 4DRNA 3UF8A 2L4JA 2VCDA 3KCEA 1FKGA 4DIPA 2JV4A 1D7IA 1J4RA 5HWBA 1ZK6A 4ODMA 1Y0OA 2M8JA 4NNRA 4QIBA 2KR7A 1WR7A 2AWGA 2XPBA 2DG9A 4LAVA 2JZVA 1N1AA 4LAXA 2PV1A 5HW6A 2DJYA 1KT0A 4JFMA 4TW7A 2BA1A 1ROUA 1PBKA 1O6WA 4W9PA 5DITA 4ODRA 1FKJA 2ZR4A 3GPKA 2XP3A 5HW8A 1U79A 3JXVA 4TYOA 2PPPA 4REXA 3KAFA 3VAWA 2VN1A 2KO7A 3KABA 4QT3A 3M7NA 2KE0A 5DIUA 1K9RA 2XP6A 2XP8A 2ZR6A 4U84A 2ZQUA 4DROA 1Q6HA 2YSFA 5HT1A 4GGQA 2RE3A 1BL4A 3O5FA 2YSBA 2XP7A 3O5RA 4U86A 3O5PA 4GIVA 2DG3A 4W9OA 1TCOC 2YSIA 3UQAA 3H9RB 3WH0A 4DZ3A 3JYJA 2LJ4A 1FKSA 1FJDA 3O5IA 4JYSA 2EZ5W 2DWVA 5DIVA 2KXQA 3RFWA 1EQ3A 4C02B 4DRMA 2YSHA 3JYMA 1P5QA 2RURA 3FAPA 1C9HA 5B8IC 2E45A 2M08A 4DRHA 2DK1A 4ODPA 1A7XA 1L1PA 2MPHA 2LAJA 1J6YA 4DT4A 4FN2A 4ODNA 1TK7A 2PPOA 4LAWA 1BKFA 2XP4A 4IQCA 2PPNA 1JNSA 2M3OW 2M1IA 2ZQTA 3PA7A 2F21A 2LPVA 2KFWA 1NSGA 4DRIA 1NMVA 3PRDA 1FKHA 2LGOA 4DRPA 1D7JA 2PV2A 4DRQA 3CNGA 4QT2A 3KAIA 1F40A 1F8AB 4N19A 1FKKA 3KADA 2JMFA 4R0XA 3EY6A 3O5JA 3MDYB 2FKEA 1FKRA 5GPGA 1PINA 3L4HA 5HKGA 4ODOA 2ZQSA 1K9QA 1JMQA 4G2PA 3PRBA 1FKLA 2ITKA 3IKGA 3NI6A 4IQ2A 5D75A 3O5DA 1ZCNA 1T11A 2XPAA 1FKIA 2MNTA 1W26A 3O5MA 3CGMA 3CGNA 2OFNA 1YATA 2Q5AA 1FKBA 4DRKA 4JFKA 2KI3A 4DZ2A 4JFIA 4W9QA 1J4IA 2F4EA 1ROTA 3TCZA 3LUOA 2ZQVA 2K8IA 2MLXA 4U85A 3I6CA 1B6CA 4JFLA 3UQIA 3IHZA 4JFJA 3UI5A 5HWCA 3NRKA 2ZAJA 4ODKA 3IKDA 2LKNA 5HTGA 2JXWA 5HW7A 2F2DA 2PV3A 3M85A 1QPLA 1HXVA 4ODLA 2MLZA 5HUAA 4O2TA 3OOBA 1FKDA 3O5EA 2M8IA 2FAPA 1FKTA 3O5QA 1D7HA 1WMVA
chains in the Genus database with same CATH superfamily
4WKAA 1IX5A 1YW5A 3ODKA 1FKFA 3O5KA 2RSEA 4J4NA 2PBCA 4DWSB 1EG3A 2XP9A 3B9DA 4KQZA 5BXJA 4IPXA 2MLYA 3WL0A 5CQ2A 3ARQA 4P8VA 2RUDA 1Q6UA 2G8ZA 3NTPA 3TC5A 3WD3A 2QF8A 1JNEA 4MGVA 1QZ2A 1W1VA 1HJXA 3ARYA 4ZS6A 3G6MA 2DMVA 1FAPA 3ARWA 4G50A 1HJVA 4TW8A 3TDBA 3BXWA 5I98A 3GU0A 1Q1CA 2ZR5A 1JNTA 4WK9A 2DSVA 1RP5A 2DK7A 3UI4A 1JVWA 4ITZA 2Y8NB 4XAKA 4ODQA 1OGBA 2UZ5A 3UI6A 3AS2A 1W1YA 3KACA 4E5RA 5AHTA 2XP5A 1Q6IA 5E62A 3B7XA 3FSCA 2N87A 3O5OA 1H0GA 4R5EA 3KZ7A 1NH6A 4MSPA 1O6IA 4TNSA 3O5GA 4TX0A 4TW6A 3AS3A 3UQBA 2D9FA 1W1TA 1QPFA 3WL1A 4FAPA 1E6NA 1EYMA 2JX8A 1R9HA 3CH9A 4AY1A 1X6NA 3EIPA 2IF4A 4BF8A 3ALGA 2RUQA 1M5YA 3WIJA 1KT1A 5U47A 2L2SA 1EG4A 1NWSA 2MF9A 1GRJA 2Y78A 2DG4A 4DH0A 2MDIA 1ITXA 3KAGA 1D2KA 2KGJA 3PR9A 3OA5A 5JH8A 1NMWA 3AQUA 3RGCA 1E9LA 4DRJA 3O5LA 4A0TA 2YSGA 3IK8A 1I5HW 1J4HA 4LAYA 2PN0A 1EDQA 1WAWA 2M2AA 2WM0A 1W9PA 3ARPA 1ZBWA 5J6EA 1FD9A 2A3CA 2RQSA 3LE4A 3KAHA 1HJWA 1LL7A 1D6OA 4J4OA 5E5WA 2RUCA 1GUVA 4PTMA 3UF8A 2L4JA 4DRNA 2VCDA 3MCBB 4IT6A 3KCEA 1FKGA 3B9AA 4DIPA 4ZPTR 2JV4A 3WD2A 1JNDA 1D7IA 1J4RA 5HWBA 1ZK6A 4ODMA 2ETNA 1Y0OA 3LKXB 2M8JA 3RM4A 4NNRA 4QIBA 1EIBA 2KR7A 1WR7A 1W9VA 2WLZA 2AWGA 2XPBA 2B31A 2DG9A 3QOKA 4LAVA 1CTNA 2JZVA 2O9OA 1E6PA 1N1AA 4LAXA 2PV1A 2YBUA 5HW6A 2DJYA 1KT0A 4JFMA 4MNMA 2DSWA 3WD1A 4TW7A 1OGGA 5DEZA 1E6RA 2BA1A 1ROUA 1PBKA 1O6WA 4A0UA 4W9PA 5DITA 4ODRA 1FKJA 4HBEA 2ZR4A 4HARA 4DWSC 3GPKA 1E44A 2XP3A 2WAEA 5HW8A 1U79A 3JXVA 4TYOA 2PPPA 2G41A 4REXA 3BMBA 3KAFA 3ARZA 2VN1A 2KO7A 3VAWA 3KABA 1ZBCA 3M7NA 1LG2A 4QT3A 2KE0A 2WLYA 5DIUA 1K9RA 1HKMA 2XP6A 4UDMA 2A3EA 1X6LA 3PQHA 1ZBVA 2XP8A 2ZR6A 4U84A 2ZQUA 4DROA 1Q6HA 1TFVA 2YSFA 4Z2GA 5HT1A 4GGQA 4Q7NA 2RE3A 1BL4A 3CHFA 2YSBA 3O5FA 4URIA 2A3BA 1NWRA 3FSBA 1FFRA 4L3NA 2XP7A 1XHGA 3AS0A 3O5RA 4U86A 3O5PA 4GIVA 2DG3A 1TCOC 4W9OA 2YSIA 3UQAA 2F23A 3H9RB 3WH0A 4DZ3A 3CZ8A 3ALFA 3JYJA 1FFQA 2LJ4A 1FKSA 4Z2HA 4HBOA 1FJDA 3O5IA 4JYSA 2EZ5W 2FDMA 1LQ0A 2DWVA 2A3AA 5DIVA 4NSBA 2KXQA 3RFWA 1EQ3A 4C02B 3ARSA 4DRMA 2YSHA 4MNLA 3JYMA 3FXYA 4Z2JA 4ML4A 2WADA 1P5QA 1ZB5A 4P8WA 1HKKA 1FLCA 5E65A 1H0IA 4P8XA 1HKIA 2RURA 5DF0A 2O92A 4MNJA 3FAPA 1C9HA 5B8IC 2E45A 5GQBA 1NWTA 2M08A 4W5UA 4DRHA 2B5UB 2DK1A 4ODPA 3W4RA 2DPEA 1A7XA 1LJYA 3GTYX 1L1PA 3ARRA 2DSZA 4MPKA 3WQVA 2MPHA 3CHCA 1UR9A 2LAJA 4S3KA 1WNOA 1J6YA 2DT3A 3FY1A 4FN2A 4DT4A 3ARVA 4ODNA 1TK7A 2QRVA 2PPOA 4LAWA 3RM9A 2AOSA 2OWOA 3MQGA 1BKFA 2XP4A 3ARTA 4IQCA 2PPNA 1JNSA 2M3OW 1ZBKA 2M1IA 2DT2A 2ZQTA 3PA7A 2F21A 2LPVA 2KFWA 1NSGA 5E66A 4DRIA 1NMVA 3PRDA 1OWQA 1FKHA 4DWSA 2LGOA 2EULA 4DRPA 1D7JA 2P4VA 2PV2A 1W1PA 4MTVA 3WD0A 4DRQA 1E15A 4P8UA 3CNGA 4QT2A 4Z2KA 3KAIA 1F40A 1F8AB 4N19A 3ARUA 1FKKA 1LG1A 3KADA 2JMFA 1GPFA 3EY6A 3O5JA 4R0XA 3MDYB 4MAVA 4WJXA 2FKEA 1ZL1A 1WB0A 1FKRA 5GPGA 1PINA 3L4HA 3AROA 4WKFA 2ESCA 5HKGA 4ODOA 2ZQSA 1K9QA 1JMQA 4ZPWR 1W9UA 3B9EA 1GOIA 1LL4A 2YBTA 4G2PA 3PRBA 1FKLA 2ITKA 1HKJA 3IKGA 4WIWA 4GLXA 1EHNA 3NI6A 4IQ2A 5D75A 3O5DA 1ZCNA 1T11A 2XPAA 1VF8A 1FKIA 2MNTA 2DT0A 4QZVB 2IUZA 2WK2A 1W26A 1SR0A 4L72B 1E6ZA 1KFWA 1LL6A 3O5MA 3CGMA 3CGNA 2OFNA 1YATA 3MQHA 1JCHB 2DT1A 2Q5AA 1FKBA 4KR0B 3RMEA 4DRKA 4WKHA 4JFKA 2KI3A 4DZ2A 4JFIA 1K9TA 4W9QA 3FS8A 1J4IA 2F4EA 3ARXA 1ROTA 3TCZA 3LUOA 4IT4A 2ZQVA 2K8IA 2MLXA 1TR8A 4U85A 3I6CA 3WD4A 1B6CA 1NWUA 4JFLA 2PI6A 5E64A 4LGXA 3UQIA 4S3JA 4Z2LA 1SYTA 3IHZA 4JFJA 5GPRA 3UI5A 5HWCA 3NRKA 5DO2A 1ZU8A 2ZAJA 4NZCA 2YAJB 4MNKA 4ODKA 1XRVA 3IKDA 2LKNA 3G6LA 4Z2IA 3RM8A 5HTGA 2JXWA 5HW7A 2F2DA 2PV3A 4Q22A 2OLHA 3MCBA 4DWSD 3WKZA 3M85A 3B8SA 3WQWA 1UR8A 1QPLA 4ZPVR 3PRAA 1HXVA 4ODLA 2MLZA 2DSUA 5HBFA 5HUAA 3AS1A 3LKXA 3CHEA 4O2TA 3OOBA 1FKDA 3O5EA 2M8IA 2FAPA 1RD6A 1FKTA 3O5QA 3CHDA 1D7HA 1WMVA
chains in the Genus database with same CATH topology
4WKAA 1IX5A 1YW5A 3ODKA 1FKFA 3O5KA 2RSEA 4J4NA 2PBCA 4DWSB 1EG3A 2XP9A 3B9DA 4KQZA 5BXJA 4IPXA 2MLYA 3WL0A 5CQ2A 3ARQA 4P8VA 2RUDA 1Q6UA 2G8ZA 3NTPA 3TC5A 3WD3A 2QF8A 1JNEA 4MGVA 1QZ2A 1W1VA 1HJXA 3ARYA 4ZS6A 3G6MA 2DMVA 1FAPA 3ARWA 4G50A 1HJVA 4TW8A 3TDBA 3BXWA 5I98A 1Q1CA 2ZR5A 1JNTA 4WK9A 2DSVA 1RP5A 2DK7A 3UI4A 1JVWA 4ITZA 2Y8NB 4XAKA 4ODQA 1OGBA 2UZ5A 3UI6A 3AS2A 1W1YA 3KACA 4E5RA 5AHTA 2XP5A 1Q6IA 5E62A 3B7XA 3FSCA 2N87A 3O5OA 1H0GA 4R5EA 3KZ7A 1NH6A 4MSPA 1O6IA 4TNSA 3O5GA 4TX0A 4TW6A 3AS3A 3UQBA 2D9FA 1W1TA 1QPFA 3WL1A 4FAPA 1E6NA 1EYMA 2JX8A 1R9HA 3CH9A 4AY1A 1X6NA 2IF4A 4BF8A 3ALGA 2RUQA 1M5YA 3WIJA 1KT1A 5U47A 2L2SA 1EG4A 1NWSA 2MF9A 2Y78A 2DG4A 4DH0A 2MDIA 1ITXA 3KAGA 1D2KA 2KGJA 3PR9A 3OA5A 5JH8A 1NMWA 3AQUA 3RGCA 1E9LA 4DRJA 3O5LA 4A0TA 2YSGA 3IK8A 1I5HW 1J4HA 4LAYA 1EDQA 1WAWA 2M2AA 2WM0A 1W9PA 3ARPA 1ZBWA 5J6EA 1FD9A 2A3CA 2RQSA 3LE4A 3KAHA 1HJWA 1LL7A 1D6OA 4J4OA 5E5WA 2RUCA 1GUVA 4PTMA 3UF8A 2L4JA 4DRNA 2VCDA 3MCBB 4IT6A 3KCEA 1FKGA 3B9AA 4DIPA 4ZPTR 2JV4A 3WD2A 1JNDA 1D7IA 1J4RA 5HWBA 1ZK6A 4ODMA 1Y0OA 3LKXB 2M8JA 3RM4A 4NNRA 4QIBA 1EIBA 2KR7A 1WR7A 1W9VA 2WLZA 2AWGA 2XPBA 2B31A 2DG9A 3QOKA 4LAVA 1CTNA 2JZVA 2O9OA 1E6PA 1N1AA 4LAXA 2PV1A 2YBUA 5HW6A 2DJYA 1KT0A 4JFMA 4MNMA 2DSWA 3WD1A 4TW7A 1OGGA 5DEZA 1E6RA 2BA1A 1ROUA 1PBKA 1O6WA 4A0UA 4W9PA 5DITA 4ODRA 1FKJA 4HBEA 2ZR4A 4HARA 4DWSC 3GPKA 2XP3A 2WAEA 5HW8A 1U79A 3JXVA 4TYOA 2PPPA 2G41A 4REXA 3KAFA 3ARZA 2VN1A 2KO7A 3VAWA 3KABA 1ZBCA 3M7NA 1LG2A 4QT3A 2KE0A 2WLYA 5DIUA 1K9RA 1HKMA 2XP6A 2A3EA 1X6LA 3PQHA 1ZBVA 2XP8A 2ZR6A 4U84A 2ZQUA 4DROA 1Q6HA 1TFVA 2YSFA 4Z2GA 5HT1A 4GGQA 4Q7NA 2RE3A 1BL4A 3CHFA 2YSBA 3O5FA 4URIA 2A3BA 1NWRA 3FSBA 1FFRA 4L3NA 2XP7A 1XHGA 3AS0A 3O5RA 4U86A 3O5PA 4GIVA 2DG3A 1TCOC 4W9OA 2YSIA 3UQAA 3H9RB 3WH0A 4DZ3A 3CZ8A 3ALFA 3JYJA 1FFQA 2LJ4A 1FKSA 4Z2HA 4HBOA 1FJDA 3O5IA 4JYSA 2EZ5W 2FDMA 1LQ0A 2DWVA 2A3AA 5DIVA 4NSBA 2KXQA 3RFWA 1EQ3A 4C02B 3ARSA 4DRMA 2YSHA 4MNLA 3JYMA 3FXYA 4Z2JA 4ML4A 2WADA 1P5QA 1ZB5A 4P8WA 1HKKA 1FLCA 5E65A 1H0IA 4P8XA 1HKIA 2RURA 5DF0A 2O92A 4MNJA 3FAPA 1C9HA 5B8IC 2E45A 5GQBA 1NWTA 2M08A 4W5UA 4DRHA 2DK1A 4ODPA 3W4RA 2DPEA 1A7XA 1LJYA 1L1PA 3ARRA 2DSZA 4MPKA 3WQVA 2MPHA 3CHCA 1UR9A 2LAJA 4S3KA 1WNOA 1J6YA 2DT3A 3FY1A 4FN2A 4DT4A 3ARVA 4ODNA 1TK7A 2QRVA 2PPOA 4LAWA 3RM9A 2AOSA 2OWOA 3MQGA 1BKFA 2XP4A 3ARTA 4IQCA 2PPNA 1JNSA 2M3OW 1ZBKA 2M1IA 2DT2A 2ZQTA 3PA7A 2F21A 2LPVA 2KFWA 1NSGA 5E66A 4DRIA 1NMVA 3PRDA 1OWQA 1FKHA 4DWSA 2LGOA 4DRPA 1D7JA 2PV2A 1W1PA 4MTVA 3WD0A 4DRQA 1E15A 4P8UA 3CNGA 4QT2A 4Z2KA 3KAIA 1F40A 1F8AB 4N19A 3ARUA 1FKKA 1LG1A 3KADA 2JMFA 1GPFA 3EY6A 3O5JA 4R0XA 3MDYB 4MAVA 4WJXA 2FKEA 1ZL1A 1WB0A 1FKRA 5GPGA 1PINA 3L4HA 3AROA 4WKFA 2ESCA 5HKGA 4ODOA 2ZQSA 1K9QA 1JMQA 4ZPWR 1W9UA 3B9EA 1GOIA 1LL4A 2YBTA 4G2PA 3PRBA 1FKLA 2ITKA 1HKJA 3IKGA 4WIWA 4GLXA 1EHNA 3NI6A 4IQ2A 5D75A 3O5DA 1ZCNA 1T11A 2XPAA 1VF8A 1FKIA 2MNTA 2DT0A 4QZVB 2IUZA 2WK2A 1W26A 1SR0A 4L72B 1E6ZA 1KFWA 1LL6A 3O5MA 3CGMA 3CGNA 2OFNA 1YATA 3MQHA 2DT1A 2Q5AA 1FKBA 4KR0B 3RMEA 4DRKA 4WKHA 4JFKA 2KI3A 4DZ2A 4JFIA 1K9TA 4W9QA 3FS8A 1J4IA 2F4EA 3ARXA 1ROTA 3TCZA 3LUOA 4IT4A 2ZQVA 2K8IA 2MLXA 1TR8A 4U85A 3I6CA 3WD4A 1B6CA 1NWUA 4JFLA 2PI6A 5E64A 4LGXA 3UQIA 4S3JA 4Z2LA 1SYTA 3IHZA 4JFJA 5GPRA 3UI5A 5HWCA 3NRKA 5DO2A 1ZU8A 2ZAJA 4NZCA 2YAJB 4MNKA 4ODKA 1XRVA 3IKDA 2LKNA 3G6LA 4Z2IA 3RM8A 5HTGA 2JXWA 5HW7A 2F2DA 2PV3A 4Q22A 2OLHA 3MCBA 4DWSD 3WKZA 3M85A 3B8SA 3WQWA 1UR8A 1QPLA 4ZPVR 3PRAA 1HXVA 4ODLA 2MLZA 2DSUA 5HBFA 5HUAA 3AS1A 3LKXA 3CHEA 4O2TA 3OOBA 1FKDA 3O5EA 2M8IA 2FAPA 1RD6A 1FKTA 3O5QA 3CHDA 1D7HA 1WMVA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1YW5 A;  3ODK A;  1FKF A;  3O5K A;  2RSE A;  4J4N A;  2PBC A;  1EG3 A;  2XP9 A;  5BXJ A;  4IPX A;  2MLY A;  5CQ2 A;  2RUD A;  1Q6U A;  3NTP A;  3TC5 A;  4MGV A;  1QZ2 A;  2DMV A;  1FAP A;  4G50 A;  4TW8 A;  3TDB A;  5I98 A;  1Q1C A;  2ZR5 A;  1JNT A;  3UI4 A;  2DK7 A;  1JVW A;  4ITZ A;  4ODQ A;  2UZ5 A;  3UI6 A;  3KAC A;  4E5R A;  5AHT A;  2XP5 A;  1Q6I A;  3B7X A;  2N87 A;  3O5O A;  3KZ7 A;  4MSP A;  4TNS A;  4TX0 A;  3O5G A;  4TW6 A;  3UQB A;  2D9F A;  1QPF A;  4FAP A;  1EYM A;  2JX8 A;  1R9H A;  2IF4 A;  4BF8 A;  2RUQ A;  1M5Y A;  1KT1 A;  2L2S A;  1EG4 A;  2MF9 A;  2Y78 A;  2DG4 A;  4DH0 A;  2MDI A;  3KAG A;  2KGJ A;  1NMW A;  3RGC A;  4DRJ A;  3O5L A;  2YSG A;  3IK8 A;  1I5H W;  1J4H A;  4LAY A;  2M2A A;  5J6E A;  1FD9 A;  2RQS A;  3LE4 A;  3KAH A;  1D6O A;  4J4O A;  2RUC A;  4DRN A;  3UF8 A;  2L4J A;  2VCD A;  3KCE A;  1FKG A;  4DIP A;  2JV4 A;  1D7I A;  1J4R A;  5HWB A;  1ZK6 A;  4ODM A;  1Y0O A;  2M8J A;  4NNR A;  4QIB A;  2KR7 A;  1WR7 A;  2AWG A;  2XPB A;  2DG9 A;  4LAV A;  2JZV A;  1N1A A;  4LAX A;  2PV1 A;  5HW6 A;  2DJY A;  1KT0 A;  4JFM A;  4TW7 A;  2BA1 A;  1ROU A;  1PBK A;  1O6W A;  4W9P A;  5DIT A;  4ODR A;  1FKJ A;  2ZR4 A;  3GPK A;  2XP3 A;  5HW8 A;  1U79 A;  3JXV A;  4TYO A;  2PPP A;  4REX A;  3KAF A;  3VAW A;  2VN1 A;  2KO7 A;  3KAB A;  4QT3 A;  3M7N A;  2KE0 A;  5DIU A;  1K9R A;  2XP6 A;  2XP8 A;  2ZR6 A;  4U84 A;  2ZQU A;  4DRO A;  1Q6H A;  2YSF A;  5HT1 A;  4GGQ A;  2RE3 A;  1BL4 A;  3O5F A;  2YSB A;  2XP7 A;  3O5R A;  4U86 A;  3O5P A;  4GIV A;  2DG3 A;  4W9O A;  1TCO C;  2YSI A;  3UQA A;  3H9R B;  3WH0 A;  4DZ3 A;  3JYJ A;  2LJ4 A;  1FKS A;  1FJD A;  3O5I A;  4JYS A;  2EZ5 W;  2DWV A;  5DIV A;  2KXQ A;  3RFW A;  1EQ3 A;  4C02 B;  4DRM A;  2YSH A;  3JYM A;  1P5Q A;  2RUR A;  3FAP A;  1C9H A;  5B8I C;  2E45 A;  2M08 A;  4DRH A;  2DK1 A;  4ODP A;  1A7X A;  1L1P A;  2MPH A;  2LAJ A;  1J6Y A;  4DT4 A;  4FN2 A;  4ODN A;  1TK7 A;  2PPO A;  4LAW A;  1BKF A;  2XP4 A;  4IQC A;  2PPN A;  1JNS A;  2M3O W;  2M1I A;  2ZQT A;  3PA7 A;  2F21 A;  2LPV A;  2KFW A;  1NSG A;  4DRI A;  1NMV A;  3PRD A;  1FKH A;  2LGO A;  4DRP A;  1D7J A;  2PV2 A;  4DRQ A;  3CNG A;  4QT2 A;  3KAI A;  1F40 A;  1F8A B;  4N19 A;  1FKK A;  3KAD A;  2JMF A;  4R0X A;  3EY6 A;  3O5J A;  3MDY B;  2FKE A;  1FKR A;  5GPG A;  1PIN A;  3L4H A;  5HKG A;  4ODO A;  2ZQS A;  1K9Q A;  1JMQ A;  4G2P A;  3PRB A;  1FKL A;  2ITK A;  3IKG A;  3NI6 A;  4IQ2 A;  5D75 A;  3O5D A;  1ZCN A;  1T11 A;  2XPA A;  1FKI A;  2MNT A;  1W26 A;  3O5M A;  3CGM A;  3CGN A;  2OFN A;  1YAT A;  2Q5A A;  1FKB A;  4DRK A;  4JFK A;  2KI3 A;  4DZ2 A;  4JFI A;  4W9Q A;  1J4I A;  2F4E A;  1ROT A;  3TCZ A;  3LUO A;  2ZQV A;  2K8I A;  2MLX A;  4U85 A;  3I6C A;  1B6C A;  4JFL A;  3UQI A;  3IHZ A;  4JFJ A;  3UI5 A;  5HWC A;  3NRK A;  2ZAJ A;  4ODK A;  3IKD A;  2LKN A;  5HTG A;  2JXW A;  5HW7 A;  2F2D A;  2PV3 A;  3M85 A;  1QPL A;  1HXV A;  4ODL A;  2MLZ A;  5HUA A;  4O2T A;  3OOB A;  1FKD A;  3O5E A;  2M8I A;  2FAP A;  1FKT A;  3O5Q A;  1D7H A;  1WMV A; 
#chains in the Genus database with same CATH topology
 4WKA A;  1IX5 A;  1YW5 A;  3ODK A;  1FKF A;  3O5K A;  2RSE A;  4J4N A;  2PBC A;  4DWS B;  1EG3 A;  2XP9 A;  3B9D A;  4KQZ A;  5BXJ A;  4IPX A;  2MLY A;  3WL0 A;  5CQ2 A;  3ARQ A;  4P8V A;  2RUD A;  1Q6U A;  2G8Z A;  3NTP A;  3TC5 A;  3WD3 A;  2QF8 A;  1JNE A;  4MGV A;  1QZ2 A;  1W1V A;  1HJX A;  3ARY A;  4ZS6 A;  3G6M A;  2DMV A;  1FAP A;  3ARW A;  4G50 A;  1HJV A;  4TW8 A;  3TDB A;  3BXW A;  5I98 A;  3GU0 A;  1Q1C A;  2ZR5 A;  1JNT A;  4WK9 A;  2DSV A;  1RP5 A;  2DK7 A;  3UI4 A;  1JVW A;  4ITZ A;  2Y8N B;  4XAK A;  4ODQ A;  1OGB A;  2UZ5 A;  3UI6 A;  3AS2 A;  1W1Y A;  3KAC A;  4E5R A;  5AHT A;  2XP5 A;  1Q6I A;  5E62 A;  3B7X A;  3FSC A;  2N87 A;  3O5O A;  1H0G A;  4R5E A;  3KZ7 A;  1NH6 A;  4MSP A;  1O6I A;  4TNS A;  3O5G A;  4TX0 A;  4TW6 A;  3AS3 A;  3UQB A;  2D9F A;  1W1T A;  1QPF A;  3WL1 A;  4FAP A;  1E6N A;  1EYM A;  2JX8 A;  1R9H A;  3CH9 A;  4AY1 A;  1X6N A;  3EIP A;  2IF4 A;  4BF8 A;  3ALG A;  2RUQ A;  1M5Y A;  3WIJ A;  1KT1 A;  5U47 A;  2L2S A;  1EG4 A;  1NWS A;  2MF9 A;  1GRJ A;  2Y78 A;  2DG4 A;  4DH0 A;  2MDI A;  1ITX A;  3KAG A;  1D2K A;  2KGJ A;  3PR9 A;  3OA5 A;  5JH8 A;  1NMW A;  3AQU A;  3RGC A;  1E9L A;  4DRJ A;  3O5L A;  4A0T A;  2YSG A;  3IK8 A;  1I5H W;  1J4H A;  4LAY A;  2PN0 A;  1EDQ A;  1WAW A;  2M2A A;  2WM0 A;  1W9P A;  3ARP A;  1ZBW A;  5J6E A;  1FD9 A;  2A3C A;  2RQS A;  3LE4 A;  3KAH A;  1HJW A;  1LL7 A;  1D6O A;  4J4O A;  5E5W A;  2RUC A;  1GUV A;  4PTM A;  3UF8 A;  2L4J A;  4DRN A;  2VCD A;  3MCB B;  4IT6 A;  3KCE A;  1FKG A;  3B9A A;  4DIP A;  4ZPT R;  2JV4 A;  3WD2 A;  1JND A;  1D7I A;  1J4R A;  5HWB A;  1ZK6 A;  4ODM A;  2ETN A;  1Y0O A;  3LKX B;  2M8J A;  3RM4 A;  4NNR A;  4QIB A;  1EIB A;  2KR7 A;  1WR7 A;  1W9V A;  2WLZ A;  2AWG A;  2XPB A;  2B31 A;  2DG9 A;  3QOK A;  4LAV A;  1CTN A;  2JZV A;  2O9O A;  1E6P A;  1N1A A;  4LAX A;  2PV1 A;  2YBU A;  5HW6 A;  2DJY A;  1KT0 A;  4JFM A;  4MNM A;  2DSW A;  3WD1 A;  4TW7 A;  1OGG A;  5DEZ A;  1E6R A;  2BA1 A;  1ROU A;  1PBK A;  1O6W A;  4A0U A;  4W9P A;  5DIT A;  4ODR A;  1FKJ A;  4HBE A;  2ZR4 A;  4HAR A;  4DWS C;  3GPK A;  1E44 A;  2XP3 A;  2WAE A;  5HW8 A;  1U79 A;  3JXV A;  4TYO A;  2PPP A;  2G41 A;  4REX A;  3BMB A;  3KAF A;  3ARZ A;  2VN1 A;  2KO7 A;  3VAW A;  3KAB A;  1ZBC A;  3M7N A;  1LG2 A;  4QT3 A;  2KE0 A;  2WLY A;  5DIU A;  1K9R A;  1HKM A;  2XP6 A;  4UDM A;  2A3E A;  1X6L A;  3PQH A;  1ZBV A;  2XP8 A;  2ZR6 A;  4U84 A;  2ZQU A;  4DRO A;  1Q6H A;  1TFV A;  2YSF A;  4Z2G A;  5HT1 A;  4GGQ A;  4Q7N A;  2RE3 A;  1BL4 A;  3CHF A;  2YSB A;  3O5F A;  4URI A;  2A3B A;  1NWR A;  3FSB A;  1FFR A;  4L3N A;  2XP7 A;  1XHG A;  3AS0 A;  3O5R A;  4U86 A;  3O5P A;  4GIV A;  2DG3 A;  1TCO C;  4W9O A;  2YSI A;  3UQA A;  2F23 A;  3H9R B;  3WH0 A;  4DZ3 A;  3CZ8 A;  3ALF A;  3JYJ A;  1FFQ A;  2LJ4 A;  1FKS A;  4Z2H A;  4HBO A;  1FJD A;  3O5I A;  4JYS A;  2EZ5 W;  2FDM A;  1LQ0 A;  2DWV A;  2A3A A;  5DIV A;  4NSB A;  2KXQ A;  3RFW A;  1EQ3 A;  4C02 B;  3ARS A;  4DRM A;  2YSH A;  4MNL A;  3JYM A;  3FXY A;  4Z2J A;  4ML4 A;  2WAD A;  1P5Q A;  1ZB5 A;  4P8W A;  1HKK A;  1FLC A;  5E65 A;  1H0I A;  4P8X A;  1HKI A;  2RUR A;  5DF0 A;  2O92 A;  4MNJ A;  3FAP A;  1C9H A;  5B8I C;  2E45 A;  5GQB A;  1NWT A;  2M08 A;  4W5U A;  4DRH A;  2B5U B;  2DK1 A;  4ODP A;  3W4R A;  2DPE A;  1A7X A;  1LJY A;  3GTY X;  1L1P A;  3ARR A;  2DSZ A;  4MPK A;  3WQV A;  2MPH A;  3CHC A;  1UR9 A;  2LAJ A;  4S3K A;  1WNO A;  1J6Y A;  2DT3 A;  3FY1 A;  4FN2 A;  4DT4 A;  3ARV A;  4ODN A;  1TK7 A;  2QRV A;  2PPO A;  4LAW A;  3RM9 A;  2AOS A;  2OWO A;  3MQG A;  1BKF A;  2XP4 A;  3ART A;  4IQC A;  2PPN A;  1JNS A;  2M3O W;  1ZBK A;  2M1I A;  2DT2 A;  2ZQT A;  3PA7 A;  2F21 A;  2LPV A;  2KFW A;  1NSG A;  5E66 A;  4DRI A;  1NMV A;  3PRD A;  1OWQ A;  1FKH A;  4DWS A;  2LGO A;  2EUL A;  4DRP A;  1D7J A;  2P4V A;  2PV2 A;  1W1P A;  4MTV A;  3WD0 A;  4DRQ A;  1E15 A;  4P8U A;  3CNG A;  4QT2 A;  4Z2K A;  3KAI A;  1F40 A;  1F8A B;  4N19 A;  3ARU A;  1FKK A;  1LG1 A;  3KAD A;  2JMF A;  1GPF A;  3EY6 A;  3O5J A;  4R0X A;  3MDY B;  4MAV A;  4WJX A;  2FKE A;  1ZL1 A;  1WB0 A;  1FKR A;  5GPG A;  1PIN A;  3L4H A;  3ARO A;  4WKF A;  2ESC A;  5HKG A;  4ODO A;  2ZQS A;  1K9Q A;  1JMQ A;  4ZPW R;  1W9U A;  3B9E A;  1GOI A;  1LL4 A;  2YBT A;  4G2P A;  3PRB A;  1FKL A;  2ITK A;  1HKJ A;  3IKG A;  4WIW A;  4GLX A;  1EHN A;  3NI6 A;  4IQ2 A;  5D75 A;  3O5D A;  1ZCN A;  1T11 A;  2XPA A;  1VF8 A;  1FKI A;  2MNT A;  2DT0 A;  4QZV B;  2IUZ A;  2WK2 A;  1W26 A;  1SR0 A;  4L72 B;  1E6Z A;  1KFW A;  1LL6 A;  3O5M A;  3CGM A;  3CGN A;  2OFN A;  1YAT A;  3MQH A;  1JCH B;  2DT1 A;  2Q5A A;  1FKB A;  4KR0 B;  3RME A;  4DRK A;  4WKH A;  4JFK A;  2KI3 A;  4DZ2 A;  4JFI A;  1K9T A;  4W9Q A;  3FS8 A;  1J4I A;  2F4E A;  3ARX A;  1ROT A;  3TCZ A;  3LUO A;  4IT4 A;  2ZQV A;  2K8I A;  2MLX A;  1TR8 A;  4U85 A;  3I6C A;  3WD4 A;  1B6C A;  1NWU A;  4JFL A;  2PI6 A;  5E64 A;  4LGX A;  3UQI A;  4S3J A;  4Z2L A;  1SYT A;  3IHZ A;  4JFJ A;  5GPR A;  3UI5 A;  5HWC A;  3NRK A;  5DO2 A;  1ZU8 A;  2ZAJ A;  4NZC A;  2YAJ B;  4MNK A;  4ODK A;  1XRV A;  3IKD A;  2LKN A;  3G6L A;  4Z2I A;  3RM8 A;  5HTG A;  2JXW A;  5HW7 A;  2F2D A;  2PV3 A;  4Q22 A;  2OLH A;  3MCB A;  4DWS D;  3WKZ A;  3M85 A;  3B8S A;  3WQW A;  1UR8 A;  1QPL A;  4ZPV R;  3PRA A;  1HXV A;  4ODL A;  2MLZ A;  2DSU A;  5HBF A;  5HUA A;  3AS1 A;  3LKX A;  3CHE A;  4O2T A;  3OOB A;  1FKD A;  3O5E A;  2M8I A;  2FAP A;  1RD6 A;  1FKT A;  3O5Q A;  3CHD A;  1D7H A;  1WMV A; 
#chains in the Genus database with same CATH homology
 4WKA A;  1IX5 A;  1YW5 A;  3ODK A;  1FKF A;  3O5K A;  2RSE A;  4J4N A;  2PBC A;  4DWS B;  1EG3 A;  2XP9 A;  3B9D A;  4KQZ A;  5BXJ A;  4IPX A;  2MLY A;  3WL0 A;  5CQ2 A;  3ARQ A;  4P8V A;  2RUD A;  1Q6U A;  2G8Z A;  3NTP A;  3TC5 A;  3WD3 A;  2QF8 A;  1JNE A;  4MGV A;  1QZ2 A;  1W1V A;  1HJX A;  3ARY A;  4ZS6 A;  3G6M A;  2DMV A;  1FAP A;  3ARW A;  4G50 A;  1HJV A;  4TW8 A;  3TDB A;  3BXW A;  5I98 A;  1Q1C A;  2ZR5 A;  1JNT A;  4WK9 A;  2DSV A;  1RP5 A;  2DK7 A;  3UI4 A;  1JVW A;  4ITZ A;  2Y8N B;  4XAK A;  4ODQ A;  1OGB A;  2UZ5 A;  3UI6 A;  3AS2 A;  1W1Y A;  3KAC A;  4E5R A;  5AHT A;  2XP5 A;  1Q6I A;  5E62 A;  3B7X A;  3FSC A;  2N87 A;  3O5O A;  1H0G A;  4R5E A;  3KZ7 A;  1NH6 A;  4MSP A;  1O6I A;  4TNS A;  3O5G A;  4TX0 A;  4TW6 A;  3AS3 A;  3UQB A;  2D9F A;  1W1T A;  1QPF A;  3WL1 A;  4FAP A;  1E6N A;  1EYM A;  2JX8 A;  1R9H A;  3CH9 A;  4AY1 A;  1X6N A;  2IF4 A;  4BF8 A;  3ALG A;  2RUQ A;  1M5Y A;  3WIJ A;  1KT1 A;  5U47 A;  2L2S A;  1EG4 A;  1NWS A;  2MF9 A;  2Y78 A;  2DG4 A;  4DH0 A;  2MDI A;  1ITX A;  3KAG A;  1D2K A;  2KGJ A;  3PR9 A;  3OA5 A;  5JH8 A;  1NMW A;  3AQU A;  3RGC A;  1E9L A;  4DRJ A;  3O5L A;  4A0T A;  2YSG A;  3IK8 A;  1I5H W;  1J4H A;  4LAY A;  1EDQ A;  1WAW A;  2M2A A;  2WM0 A;  1W9P A;  3ARP A;  1ZBW A;  5J6E A;  1FD9 A;  2A3C A;  2RQS A;  3LE4 A;  3KAH A;  1HJW A;  1LL7 A;  1D6O A;  4J4O A;  5E5W A;  2RUC A;  1GUV A;  4PTM A;  3UF8 A;  2L4J A;  4DRN A;  2VCD A;  3MCB B;  4IT6 A;  3KCE A;  1FKG A;  3B9A A;  4DIP A;  4ZPT R;  2JV4 A;  3WD2 A;  1JND A;  1D7I A;  1J4R A;  5HWB A;  1ZK6 A;  4ODM A;  1Y0O A;  3LKX B;  2M8J A;  3RM4 A;  4NNR A;  4QIB A;  1EIB A;  2KR7 A;  1WR7 A;  1W9V A;  2WLZ A;  2AWG A;  2XPB A;  2B31 A;  2DG9 A;  3QOK A;  4LAV A;  1CTN A;  2JZV A;  2O9O A;  1E6P A;  1N1A A;  4LAX A;  2PV1 A;  2YBU A;  5HW6 A;  2DJY A;  1KT0 A;  4JFM A;  4MNM A;  2DSW A;  3WD1 A;  4TW7 A;  1OGG A;  5DEZ A;  1E6R A;  2BA1 A;  1ROU A;  1PBK A;  1O6W A;  4A0U A;  4W9P A;  5DIT A;  4ODR A;  1FKJ A;  4HBE A;  2ZR4 A;  4HAR A;  4DWS C;  3GPK A;  2XP3 A;  2WAE A;  5HW8 A;  1U79 A;  3JXV A;  4TYO A;  2PPP A;  2G41 A;  4REX A;  3KAF A;  3ARZ A;  2VN1 A;  2KO7 A;  3VAW A;  3KAB A;  1ZBC A;  3M7N A;  1LG2 A;  4QT3 A;  2KE0 A;  2WLY A;  5DIU A;  1K9R A;  1HKM A;  2XP6 A;  2A3E A;  1X6L A;  3PQH A;  1ZBV A;  2XP8 A;  2ZR6 A;  4U84 A;  2ZQU A;  4DRO A;  1Q6H A;  1TFV A;  2YSF A;  4Z2G A;  5HT1 A;  4GGQ A;  4Q7N A;  2RE3 A;  1BL4 A;  3CHF A;  2YSB A;  3O5F A;  4URI A;  2A3B A;  1NWR A;  3FSB A;  1FFR A;  4L3N A;  2XP7 A;  1XHG A;  3AS0 A;  3O5R A;  4U86 A;  3O5P A;  4GIV A;  2DG3 A;  1TCO C;  4W9O A;  2YSI A;  3UQA A;  3H9R B;  3WH0 A;  4DZ3 A;  3CZ8 A;  3ALF A;  3JYJ A;  1FFQ A;  2LJ4 A;  1FKS A;  4Z2H A;  4HBO A;  1FJD A;  3O5I A;  4JYS A;  2EZ5 W;  2FDM A;  1LQ0 A;  2DWV A;  2A3A A;  5DIV A;  4NSB A;  2KXQ A;  3RFW A;  1EQ3 A;  4C02 B;  3ARS A;  4DRM A;  2YSH A;  4MNL A;  3JYM A;  3FXY A;  4Z2J A;  4ML4 A;  2WAD A;  1P5Q A;  1ZB5 A;  4P8W A;  1HKK A;  1FLC A;  5E65 A;  1H0I A;  4P8X A;  1HKI A;  2RUR A;  5DF0 A;  2O92 A;  4MNJ A;  3FAP A;  1C9H A;  5B8I C;  2E45 A;  5GQB A;  1NWT A;  2M08 A;  4W5U A;  4DRH A;  2DK1 A;  4ODP A;  3W4R A;  2DPE A;  1A7X A;  1LJY A;  1L1P A;  3ARR A;  2DSZ A;  4MPK A;  3WQV A;  2MPH A;  3CHC A;  1UR9 A;  2LAJ A;  4S3K A;  1WNO A;  1J6Y A;  2DT3 A;  3FY1 A;  4FN2 A;  4DT4 A;  3ARV A;  4ODN A;  1TK7 A;  2QRV A;  2PPO A;  4LAW A;  3RM9 A;  2AOS A;  2OWO A;  3MQG A;  1BKF A;  2XP4 A;  3ART A;  4IQC A;  2PPN A;  1JNS A;  2M3O W;  1ZBK A;  2M1I A;  2DT2 A;  2ZQT A;  3PA7 A;  2F21 A;  2LPV A;  2KFW A;  1NSG A;  5E66 A;  4DRI A;  1NMV A;  3PRD A;  1OWQ A;  1FKH A;  4DWS A;  2LGO A;  4DRP A;  1D7J A;  2PV2 A;  1W1P A;  4MTV A;  3WD0 A;  4DRQ A;  1E15 A;  4P8U A;  3CNG A;  4QT2 A;  4Z2K A;  3KAI A;  1F40 A;  1F8A B;  4N19 A;  3ARU A;  1FKK A;  1LG1 A;  3KAD A;  2JMF A;  1GPF A;  3EY6 A;  3O5J A;  4R0X A;  3MDY B;  4MAV A;  4WJX A;  2FKE A;  1ZL1 A;  1WB0 A;  1FKR A;  5GPG A;  1PIN A;  3L4H A;  3ARO A;  4WKF A;  2ESC A;  5HKG A;  4ODO A;  2ZQS A;  1K9Q A;  1JMQ A;  4ZPW R;  1W9U A;  3B9E A;  1GOI A;  1LL4 A;  2YBT A;  4G2P A;  3PRB A;  1FKL A;  2ITK A;  1HKJ A;  3IKG A;  4WIW A;  4GLX A;  1EHN A;  3NI6 A;  4IQ2 A;  5D75 A;  3O5D A;  1ZCN A;  1T11 A;  2XPA A;  1VF8 A;  1FKI A;  2MNT A;  2DT0 A;  4QZV B;  2IUZ A;  2WK2 A;  1W26 A;  1SR0 A;  4L72 B;  1E6Z A;  1KFW A;  1LL6 A;  3O5M A;  3CGM A;  3CGN A;  2OFN A;  1YAT A;  3MQH A;  2DT1 A;  2Q5A A;  1FKB A;  4KR0 B;  3RME A;  4DRK A;  4WKH A;  4JFK A;  2KI3 A;  4DZ2 A;  4JFI A;  1K9T A;  4W9Q A;  3FS8 A;  1J4I A;  2F4E A;  3ARX A;  1ROT A;  3TCZ A;  3LUO A;  4IT4 A;  2ZQV A;  2K8I A;  2MLX A;  1TR8 A;  4U85 A;  3I6C A;  3WD4 A;  1B6C A;  1NWU A;  4JFL A;  2PI6 A;  5E64 A;  4LGX A;  3UQI A;  4S3J A;  4Z2L A;  1SYT A;  3IHZ A;  4JFJ A;  5GPR A;  3UI5 A;  5HWC A;  3NRK A;  5DO2 A;  1ZU8 A;  2ZAJ A;  4NZC A;  2YAJ B;  4MNK A;  4ODK A;  1XRV A;  3IKD A;  2LKN A;  3G6L A;  4Z2I A;  3RM8 A;  5HTG A;  2JXW A;  5HW7 A;  2F2D A;  2PV3 A;  4Q22 A;  2OLH A;  3MCB A;  4DWS D;  3WKZ A;  3M85 A;  3B8S A;  3WQW A;  1UR8 A;  1QPL A;  4ZPV R;  3PRA A;  1HXV A;  4ODL A;  2MLZ A;  2DSU A;  5HBF A;  5HUA A;  3AS1 A;  3LKX A;  3CHE A;  4O2T A;  3OOB A;  1FKD A;  3O5E A;  2M8I A;  2FAP A;  1RD6 A;  1FKT A;  3O5Q A;  3CHD A;  1D7H A;  1WMV A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...