4U86A

Human pin1 with cysteine sulfonic acid 113
Total Genus 44
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
44
sequence length
158
structure length
144
Chain Sequence
KLPPGWEKAMSRSSGRVYYFNHITNASQWERPEPARVRCSHLLVKHSQSRRPSSWRQEKITRTKEEALELINGYIQKIKSGEEDFESLASQFSDSSAKARGDLGAFSRGQMQKPFEDASFALRTGEMSGPVFTDSGIHIILRTE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Peptidyl-prolyl cis-trans isomerase NIMA-interacting 1
publication title Pin1 cysteine-113 oxidation inhibits its catalytic activity and cellular function in Alzheimer's disease.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Isomerase
total genus 44
structure length 144
sequence length 158
ec nomenclature ec 5.2.1.8: Peptidylprolyl isomerase.
pdb deposition date 2014-08-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00397 WW WW domain
A PF00639 Rotamase PPIC-type PPIASE domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.20.70.10 Mainly Beta Single Sheet Ubiquitin Ligase Nedd4; Chain: W; Ubiquitin Ligase Nedd4; Chain: W; 4u86A01
3.10.50.40 Alpha Beta Roll Chitinase A; domain 3 Chitinase A; domain 3 4u86A02
2MLZA 1U79A 5HW6A 2PV2A 3O5MA 3JYJA 2UZ5A 4LAWA 3PRDA 2ZAJA 2JXWA 3O5FA 2VCDA 4O2TA 4J4NA 5HWBA 2K8IA 3O5LA 4LAVA 3I6CA 4IQ2A 4FN2A 1J4IA 1M5YA 4LAYA 2RURA 2OFNA 1KT1A 2L4JA 1WR7A 3O5KA 4JFKA 4GIVA 4DZ3A 1I5HW 1F8AB 3UQBA 4J4OA 2F21A 1ROUA 3GPKA 2DG9A 5DIVA 2XP4A 1Y0OA 2N87A 2LGOA 1O6WA 3O5RA 4G2PA 2DG4A 4DRKA 2IF4A 3RFWA 3UI4A 3H9RB 3UF8A 4TW7A 5HW7A 2M1IA 3UQAA 2XP5A 4N19A 2LJ4A 2PPPA 1D7IA 1ZCNA 4IPXA 2YSGA 2XP6A 1YW5A 2KFWA 2JZVA 2M08A 1EG3A 3L4HA 4ODLA 1QPFA 1TK7A 3IKDA 2M8JA 2E45A 4U84A 2ZR5A 3IKGA 3M7NA 5CQ2A 4MGVA 4TW6A 3PA7A 2VN1A 1T11A 4DH0A 1W26A 1FKGA 4REXA 3VAWA 2PV1A 3TDBA 2RUCA 2LAJA 1Q6UA 5GPGA 2ZQUA 3LE4A 2KE0A 1J6YA 5AHTA 4LAXA 2DJYA 1JVWA 2YSBA 3KACA 2M3OW 4ODMA 2XPBA 4JFLA 4DRJA 4E5RA 4DT4A 2MLYA 2MF9A 2JMFA 2JX8A 1JNTA 1EG4A 2PPNA 3OOBA 3KZ7A 2KXQA 4ODKA 2FAPA 3B7XA 2RUDA 4DRPA 2PBCA 2EZ5W 4U85A 3NRKA 3KAHA 4ODPA 1FD9A 3CGNA 1FKDA 4DRMA 3M85A 5HKGA 3O5OA 4W9PA 2RUQA 4G50A 3UQIA 3CNGA 2Q5AA 1N1AA 1TCOC 5HW8A 1QPLA 1Q1CA 1KT0A 1PBKA 4DRQA 4QT3A 4DIPA 2M2AA 1FKSA 4ODOA 1FKIA 3ODKA 5HWCA 4DRIA 2AWGA 4JYSA 1WMVA 1F40A 4IQCA 4W9OA 4JFMA 4W9QA 2JV4A 2DG3A 2MDIA 4TX0A 2RSEA 1Q6HA 5J6EA 4DZ2A 2YSIA 3TCZA 4ITZA 4ODNA 2ZQVA 2DWVA 3FAPA 2XP8A 3KADA 1BL4A 2MPHA 2KO7A 3KABA 3KCEA 4JFJA 1R9HA 2YSFA 3JXVA 1FJDA 4ODQA 1HXVA 1FKLA 2ZQTA 5B8IC 1EYMA 4MSPA 3WH0A 2KGJA 4QIBA 1P5QA 3IHZA 2BA1A 1FKBA 1PINA 1FKKA 2XP3A 2YSHA 4GGQA 3KAFA 5I98A 3NTPA 1BKFA 2RQSA 1YATA 2ZR4A 4FAPA 2ZR6A 1Q6IA 1B6CA 3O5IA 2PPOA 2KR7A 3O5EA 2XP7A 2DMVA 3RGCA 1C9HA 4NNRA 1D6OA 2DK7A 2FKEA 1K9QA 1FKFA 4C02B 3PRBA 3O5JA 1JMQA 2KI3A 3CGMA 1J4HA 2D9FA 2F4EA 1NMWA 3O5GA 3UI6A 3KAIA 4TW8A 3TC5A 2Y78A 4R0XA 1J4RA 4U86A 4DROA 3UI5A 2F2DA 1L1PA 1K9RA 1FKHA 2ITKA 1ZK6A 2DK1A 2M8IA 3O5DA 2XPAA 1D7HA 4DRNA 1NSGA 3IK8A 5HTGA 1JNSA 1QZ2A 4ODRA 2RE3A 3NI6A 1FKTA 5D75A 3O5PA 5DIUA 1ROTA 1FKJA 2LPVA 2XP9A 4DRHA 3LUOA 4JFIA 1FKRA 4TYOA 2PV3A 1A7XA 1EQ3A 2MLXA 5BXJA 2LKNA 5HUAA 3EY6A 3O5QA 3JYMA 1D7JA 3KAGA 4BF8A 5HT1A 2MNTA 2L2SA 4QT2A 2ZQSA 5DITA 1NMVA 4TNSA 1FAPA 3MDYB
chains in the Genus database with same CATH superfamily
2MLZA 5GQBA 1U79A 4S3JA 2PV2A 5HW6A 3O5MA 3JYJA 2UZ5A 4WKHA 4LAWA 4A0TA 3PRDA 3ARQA 2YBUA 4MAVA 2ZAJA 2JXWA 3O5FA 2VCDA 4O2TA 1SR0A 4J4NA 5HWBA 4WJXA 3ARUA 3WKZA 2DSUA 2K8IA 4W5UA 3O5LA 3QOKA 4HBOA 5JH8A 4P8WA 4LAVA 4MNLA 4WIWA 3I6CA 1ZL1A 5E62A 4IQ2A 1UR9A 4ZS6A 4FN2A 1J4IA 1M5YA 4LAYA 2RURA 4GLXA 2OFNA 3ARSA 1KT1A 1UR8A 5U47A 1HKIA 1LL4A 1HKKA 1X6LA 2L4JA 2DSWA 4Z2LA 1WR7A 3O5KA 2B31A 1E6NA 2DSZA 4JFKA 2DT0A 4GIVA 4DZ3A 1I5HW 1F8AB 3UQBA 1O6IA 1E6RA 4ML4A 2DT1A 1JCHB 4J4OA 4HBEA 2F21A 1ROUA 3CH9A 5DEZA 2WAEA 3GPKA 4L3NA 1ZU8A 2DG9A 2DT3A 5DIVA 2XP4A 1Y0OA 3PR9A 2N87A 4ZPWR 2LGOA 3RM8A 1O6WA 3O5RA 4G2PA 2DG4A 1W1VA 3RMEA 3FSBA 4DRKA 2IF4A 3RFWA 2Y8NB 3WQWA 3UI4A 3H9RB 3UF8A 4TW7A 5HW7A 2M1IA 3UQAA 3AS3A 2XP5A 2LJ4A 2PPPA 1D7IA 4N19A 1LQ0A 1GOIA 3ARZA 1ZCNA 4IPXA 1K9TA 3LKXB 3PQHA 2YSGA 1H0GA 1HJVA 1LJYA 5DF0A 2XP6A 1YW5A 4WK9A 1JNDA 2KFWA 2JZVA 2AOSA 3GU0A 2O92A 2M08A 1EG3A 3L4HA 3AROA 4UDMA 4ODLA 1QPFA 1TK7A 4XAKA 3WD0A 3IKDA 2M8JA 1HKMA 1KFWA 2E45A 3MCBB 1E44A 5GPRA 4WKAA 4U84A 2WM0A 2ZR5A 3IKGA 4P8XA 4P8UA 3M7NA 1E6ZA 5CQ2A 1ITXA 1NWSA 1WB0A 3PRAA 4ZPTR 4MGVA 4NSBA 3B9EA 4TW6A 1HKJA 3PA7A 3ARVA 2VN1A 1T11A 4DH0A 1NWTA 1W26A 2OWOA 1FKGA 1EIBA 1NWRA 2WADA 4REXA 3WIJA 3VAWA 3ALFA 2PV1A 3ARWA 3TDBA 4AY1A 2RUCA 1OWQA 2LAJA 1W9PA 3CHEA 1HJWA 1Q6UA 5GPGA 2ZQUA 3LE4A 1W1PA 4KQZA 1FFRA 2KE0A 1J6YA 5AHTA 4LAXA 4MPKA 2DJYA 1JVWA 2YSBA 1EHNA 1VF8A 1OGBA 2M3OW 3KACA 4ODMA 2XPBA 4JFLA 2ESCA 3WD1A 4DRJA 4URIA 4IT6A 2A3AA 4E5RA 3B8SA 3AS1A 4PTMA 4DT4A 1ZBCA 2MLYA 2MF9A 2JMFA 2JX8A 1E15A 3WQVA 1JNTA 1EG4A 2PPNA 3OOBA 3KZ7A 2KXQA 3WD4A 4ODKA 2FAPA 3B7XA 2RUDA 4DRPA 2PBCA 3G6LA 1JNEA 2EZ5W 4U85A 3NRKA 3KAHA 2F23A 4R5EA 1NH6A 1W1YA 4ODPA 1RP5A 3AQUA 1FFQA 2FDMA 3ARYA 4DWSB 1FD9A 4Z2JA 3CGNA 1FKDA 3LKXA 1W1TA 4DRMA 3M85A 3WD2A 5HKGA 3O5OA 2ETNA 4W9PA 2RUQA 2G8ZA 4G50A 2YAJB 3UQIA 3CNGA 2Q5AA 1N1AA 1TCOC 5HW8A 1QPLA 1Q1CA 1KT0A 1PBKA 3CHFA 4DRQA 3WL1A 4QT3A 2DT2A 4S3KA 4DIPA 2A3BA 3CHCA 2M2AA 3MCBA 4MTVA 1GRJA 1FKSA 2WLZA 4ODOA 1FKIA 3ODKA 5HWCA 4HARA 4DRIA 2AWGA 4JYSA 1WMVA 1F40A 2IUZA 4IQCA 4W9OA 4Z2GA 3B9AA 1XHGA 4A0UA 4JFMA 1FLCA 3ARPA 4W9QA 2QF8A 2JV4A 4DWSC 2DG3A 1NWUA 2MDIA 4TX0A 3BXWA 2RSEA 2WLYA 1ZBKA 1Q6HA 5J6EA 4DZ2A 2YSIA 3TCZA 4ITZA 3FS8A 4ODNA 2ZQVA 4Z2HA 2DWVA 3FAPA 2XP8A 3KADA 1LG2A 1BL4A 2MPHA 3BMBA 4NZCA 2KO7A 3GTYX 3KABA 1WNOA 3KCEA 3WL0A 4JFJA 4Q7NA 1R9HA 2YSFA 2EULA 5E65A 3JXVA 1FJDA 2A3CA 4ODQA 4WKFA 2B5UB 1HXVA 1FKLA 1LL6A 3WD3A 2QRVA 2ZQTA 3CZ8A 5B8IC 1LL7A 1EYMA 3B9DA 4MSPA 3W4RA 3WH0A 2KGJA 4QIBA 1E9LA 1P5QA 3IHZA 2BA1A 1FKBA 1PINA 1ZB5A 2WK2A 3EIPA 1FKKA 2XP3A 4DWSA 2YSHA 4GGQA 3KAFA 5I98A 5E66A 3NTPA 1BKFA 2RQSA 1GPFA 4IT4A 1YATA 2ZR4A 4Q22A 3ARTA 5E5WA 2ZR6A 5DO2A 4FAPA 1CTNA 1Q6IA 1B6CA 3O5IA 4MNKA 3FXYA 2A3EA 1WAWA 1LG1A 1SYTA 3FSCA 2PPOA 2KR7A 3ARRA 3O5EA 2DPEA 2XP7A 4MNMA 2G41A 2DMVA 1W9UA 3RGCA 4MNJA 1E6PA 1C9HA 1TFVA 2DSVA 4NNRA 4Z2IA 1GUVA 1D6OA 1OGGA 2DK7A 2FKEA 1K9QA 1FKFA 4C02B 3PRBA 3O5JA 1JMQA 1W9VA 2KI3A 3CGMA 1J4HA 2D9FA 2F4EA 1NMWA 1H0IA 3O5GA 3UI6A 3KAIA 4TW8A 3TC5A 2PI6A 3AS2A 2Y78A 4R0XA 1J4RA 4U86A 2OLHA 3CHDA 4DROA 3UI5A 2O9OA 2F2DA 1L1PA 1K9RA 1FKHA 2ITKA 2P4VA 1ZK6A 2DK1A 2M8IA 3O5DA 2XPAA 4DWSD 1D7HA 4DRNA 1NSGA 2PN0A 3IK8A 5HTGA 1JNSA 1QZ2A 4ODRA 2RE3A 3NI6A 1FKTA 5D75A 3O5PA 5DIUA 1EDQA 1ROTA 4Z2KA 1FKJA 2LPVA 1ZBWA 3ALGA 3OA5A 1TR8A 2XP9A 4DRHA 3LUOA 4P8VA 2YBTA 4L72B 4QZVB 4JFIA 1HJXA 1IX5A 4ZPVR 1FKRA 4TYOA 2PV3A 1A7XA 1EQ3A 2MLXA 5BXJA 1X6NA 2LKNA 5HUAA 3MQGA 3G6MA 3RM4A 1ZBVA 3EY6A 1RD6A 3O5QA 3AS0A 3JYMA 4KR0B 5E64A 3FY1A 1D7JA 4LGXA 3KAGA 4BF8A 5HT1A 2MNTA 1D2KA 2L2SA 4QT2A 2ZQSA 5DITA 1NMVA 1XRVA 3RM9A 4TNSA 5HBFA 3MQHA 1FAPA 3ARXA 3MDYB
chains in the Genus database with same CATH topology
2MLZA 5GQBA 1U79A 4S3JA 2PV2A 5HW6A 3O5MA 3JYJA 2UZ5A 4WKHA 4LAWA 4A0TA 3PRDA 3ARQA 2YBUA 4MAVA 2ZAJA 2JXWA 3O5FA 2VCDA 4O2TA 1SR0A 4J4NA 5HWBA 4WJXA 3ARUA 3WKZA 2DSUA 2K8IA 4W5UA 3O5LA 3QOKA 4HBOA 5JH8A 4P8WA 4LAVA 4MNLA 4WIWA 3I6CA 1ZL1A 5E62A 4IQ2A 1UR9A 4ZS6A 4FN2A 1J4IA 1M5YA 4LAYA 2RURA 4GLXA 2OFNA 3ARSA 1KT1A 1UR8A 5U47A 1HKIA 1LL4A 1HKKA 1X6LA 2L4JA 2DSWA 4Z2LA 1WR7A 3O5KA 2B31A 1E6NA 2DSZA 4JFKA 2DT0A 4GIVA 4DZ3A 1I5HW 1F8AB 3UQBA 1O6IA 1E6RA 4ML4A 2DT1A 4J4OA 4HBEA 2F21A 1ROUA 3CH9A 5DEZA 2WAEA 3GPKA 4L3NA 1ZU8A 2DG9A 2DT3A 5DIVA 2XP4A 1Y0OA 3PR9A 2N87A 4ZPWR 2LGOA 3RM8A 1O6WA 3O5RA 4G2PA 2DG4A 1W1VA 3RMEA 3FSBA 4DRKA 2IF4A 3RFWA 2Y8NB 3WQWA 3UI4A 3H9RB 3UF8A 4TW7A 5HW7A 2M1IA 3UQAA 3AS3A 2XP5A 2LJ4A 2PPPA 1D7IA 4N19A 1LQ0A 1GOIA 3ARZA 1ZCNA 4IPXA 1K9TA 3LKXB 3PQHA 2YSGA 1H0GA 1HJVA 1LJYA 5DF0A 2XP6A 1YW5A 4WK9A 1JNDA 2KFWA 2JZVA 2AOSA 2O92A 2M08A 1EG3A 3L4HA 3AROA 4ODLA 1QPFA 1TK7A 4XAKA 3WD0A 3IKDA 2M8JA 1HKMA 1KFWA 2E45A 3MCBB 5GPRA 4WKAA 4U84A 2WM0A 2ZR5A 3IKGA 4P8XA 4P8UA 3M7NA 1E6ZA 5CQ2A 1ITXA 1NWSA 1WB0A 3PRAA 4ZPTR 4MGVA 4NSBA 3B9EA 4TW6A 1HKJA 3PA7A 3ARVA 2VN1A 1T11A 4DH0A 1NWTA 1W26A 2OWOA 1FKGA 1EIBA 1NWRA 2WADA 4REXA 3WIJA 3VAWA 3ALFA 2PV1A 3ARWA 3TDBA 4AY1A 2RUCA 1OWQA 2LAJA 1W9PA 3CHEA 1HJWA 1Q6UA 5GPGA 2ZQUA 3LE4A 1W1PA 4KQZA 1FFRA 2KE0A 1J6YA 5AHTA 4LAXA 4MPKA 2DJYA 1JVWA 2YSBA 1EHNA 1VF8A 1OGBA 2M3OW 3KACA 4ODMA 2XPBA 4JFLA 2ESCA 3WD1A 4DRJA 4URIA 4IT6A 2A3AA 4E5RA 3B8SA 3AS1A 4PTMA 4DT4A 1ZBCA 2MLYA 2MF9A 2JMFA 2JX8A 1E15A 3WQVA 1JNTA 1EG4A 2PPNA 3OOBA 3KZ7A 2KXQA 3WD4A 4ODKA 2FAPA 3B7XA 2RUDA 4DRPA 2PBCA 3G6LA 1JNEA 2EZ5W 4U85A 3NRKA 3KAHA 4R5EA 1NH6A 1W1YA 4ODPA 1RP5A 3AQUA 1FFQA 2FDMA 3ARYA 4DWSB 1FD9A 4Z2JA 3CGNA 1FKDA 3LKXA 1W1TA 4DRMA 3M85A 3WD2A 5HKGA 3O5OA 4W9PA 2RUQA 2G8ZA 4G50A 2YAJB 3UQIA 3CNGA 2Q5AA 1N1AA 1TCOC 5HW8A 1QPLA 1Q1CA 1KT0A 1PBKA 3CHFA 4DRQA 3WL1A 4QT3A 2DT2A 4S3KA 4DIPA 2A3BA 3CHCA 2M2AA 3MCBA 4MTVA 1FKSA 2WLZA 4ODOA 1FKIA 3ODKA 5HWCA 4HARA 4DRIA 2AWGA 4JYSA 1WMVA 1F40A 2IUZA 4IQCA 4W9OA 4Z2GA 3B9AA 1XHGA 4A0UA 4JFMA 1FLCA 3ARPA 4W9QA 2QF8A 2JV4A 4DWSC 2DG3A 1NWUA 2MDIA 4TX0A 3BXWA 2RSEA 2WLYA 1ZBKA 1Q6HA 5J6EA 4DZ2A 2YSIA 3TCZA 4ITZA 3FS8A 4ODNA 2ZQVA 4Z2HA 2DWVA 3FAPA 2XP8A 3KADA 1LG2A 1BL4A 2MPHA 4NZCA 2KO7A 3KABA 1WNOA 3KCEA 3WL0A 4JFJA 4Q7NA 1R9HA 2YSFA 5E65A 3JXVA 1FJDA 2A3CA 4ODQA 4WKFA 1HXVA 1FKLA 1LL6A 3WD3A 2QRVA 2ZQTA 3CZ8A 5B8IC 1LL7A 1EYMA 3B9DA 4MSPA 3W4RA 3WH0A 2KGJA 4QIBA 1E9LA 1P5QA 3IHZA 2BA1A 1FKBA 1PINA 1ZB5A 2WK2A 4DWSA 1FKKA 2XP3A 2YSHA 4GGQA 3KAFA 5I98A 5E66A 3NTPA 1BKFA 2RQSA 1GPFA 4IT4A 1YATA 2ZR4A 4Q22A 3ARTA 5E5WA 2ZR6A 5DO2A 4FAPA 1CTNA 1Q6IA 1B6CA 3O5IA 4MNKA 3FXYA 2A3EA 1WAWA 1LG1A 1SYTA 3FSCA 2PPOA 2KR7A 3ARRA 3O5EA 2DPEA 2XP7A 4MNMA 2G41A 2DMVA 1W9UA 3RGCA 4MNJA 1E6PA 1C9HA 1TFVA 2DSVA 4NNRA 4Z2IA 1GUVA 1D6OA 1OGGA 2DK7A 2FKEA 1K9QA 1FKFA 4C02B 3PRBA 3O5JA 1JMQA 1W9VA 2KI3A 3CGMA 1J4HA 2D9FA 2F4EA 1NMWA 1H0IA 3O5GA 3UI6A 3KAIA 4TW8A 3TC5A 2PI6A 3AS2A 2Y78A 4R0XA 1J4RA 4U86A 2OLHA 3CHDA 4DROA 3UI5A 2O9OA 2F2DA 1L1PA 1K9RA 1FKHA 2ITKA 1ZK6A 2DK1A 2M8IA 3O5DA 2XPAA 4DWSD 1D7HA 4DRNA 1NSGA 3IK8A 5HTGA 1JNSA 1QZ2A 4ODRA 2RE3A 3NI6A 1FKTA 5D75A 3O5PA 5DIUA 1EDQA 1ROTA 4Z2KA 1FKJA 2LPVA 1ZBWA 3ALGA 3OA5A 1TR8A 2XP9A 4DRHA 3LUOA 4P8VA 2YBTA 4L72B 4QZVB 4JFIA 1HJXA 1IX5A 4ZPVR 1FKRA 4TYOA 2PV3A 1A7XA 1EQ3A 2MLXA 5BXJA 1X6NA 2LKNA 5HUAA 3MQGA 3G6MA 3RM4A 1ZBVA 3EY6A 1RD6A 3O5QA 3AS0A 3JYMA 4KR0B 5E64A 3FY1A 1D7JA 4LGXA 3KAGA 4BF8A 5HT1A 2MNTA 1D2KA 2L2SA 4QT2A 2ZQSA 5DITA 1NMVA 1XRVA 3RM9A 4TNSA 5HBFA 3MQHA 1FAPA 3ARXA 3MDYB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2MLZ A;  1U79 A;  5HW6 A;  2PV2 A;  3O5M A;  3JYJ A;  2UZ5 A;  4LAW A;  3PRD A;  2ZAJ A;  2JXW A;  3O5F A;  2VCD A;  4O2T A;  4J4N A;  5HWB A;  2K8I A;  3O5L A;  4LAV A;  3I6C A;  4IQ2 A;  4FN2 A;  1J4I A;  1M5Y A;  4LAY A;  2RUR A;  2OFN A;  1KT1 A;  2L4J A;  1WR7 A;  3O5K A;  4JFK A;  4GIV A;  4DZ3 A;  1I5H W;  1F8A B;  3UQB A;  4J4O A;  2F21 A;  1ROU A;  3GPK A;  2DG9 A;  5DIV A;  2XP4 A;  1Y0O A;  2N87 A;  2LGO A;  1O6W A;  3O5R A;  4G2P A;  2DG4 A;  4DRK A;  2IF4 A;  3RFW A;  3UI4 A;  3H9R B;  3UF8 A;  4TW7 A;  5HW7 A;  2M1I A;  3UQA A;  2XP5 A;  4N19 A;  2LJ4 A;  2PPP A;  1D7I A;  1ZCN A;  4IPX A;  2YSG A;  2XP6 A;  1YW5 A;  2KFW A;  2JZV A;  2M08 A;  1EG3 A;  3L4H A;  4ODL A;  1QPF A;  1TK7 A;  3IKD A;  2M8J A;  2E45 A;  4U84 A;  2ZR5 A;  3IKG A;  3M7N A;  5CQ2 A;  4MGV A;  4TW6 A;  3PA7 A;  2VN1 A;  1T11 A;  4DH0 A;  1W26 A;  1FKG A;  4REX A;  3VAW A;  2PV1 A;  3TDB A;  2RUC A;  2LAJ A;  1Q6U A;  5GPG A;  2ZQU A;  3LE4 A;  2KE0 A;  1J6Y A;  5AHT A;  4LAX A;  2DJY A;  1JVW A;  2YSB A;  3KAC A;  2M3O W;  4ODM A;  2XPB A;  4JFL A;  4DRJ A;  4E5R A;  4DT4 A;  2MLY A;  2MF9 A;  2JMF A;  2JX8 A;  1JNT A;  1EG4 A;  2PPN A;  3OOB A;  3KZ7 A;  2KXQ A;  4ODK A;  2FAP A;  3B7X A;  2RUD A;  4DRP A;  2PBC A;  2EZ5 W;  4U85 A;  3NRK A;  3KAH A;  4ODP A;  1FD9 A;  3CGN A;  1FKD A;  4DRM A;  3M85 A;  5HKG A;  3O5O A;  4W9P A;  2RUQ A;  4G50 A;  3UQI A;  3CNG A;  2Q5A A;  1N1A A;  1TCO C;  5HW8 A;  1QPL A;  1Q1C A;  1KT0 A;  1PBK A;  4DRQ A;  4QT3 A;  4DIP A;  2M2A A;  1FKS A;  4ODO A;  1FKI A;  3ODK A;  5HWC A;  4DRI A;  2AWG A;  4JYS A;  1WMV A;  1F40 A;  4IQC A;  4W9O A;  4JFM A;  4W9Q A;  2JV4 A;  2DG3 A;  2MDI A;  4TX0 A;  2RSE A;  1Q6H A;  5J6E A;  4DZ2 A;  2YSI A;  3TCZ A;  4ITZ A;  4ODN A;  2ZQV A;  2DWV A;  3FAP A;  2XP8 A;  3KAD A;  1BL4 A;  2MPH A;  2KO7 A;  3KAB A;  3KCE A;  4JFJ A;  1R9H A;  2YSF A;  3JXV A;  1FJD A;  4ODQ A;  1HXV A;  1FKL A;  2ZQT A;  5B8I C;  1EYM A;  4MSP A;  3WH0 A;  2KGJ A;  4QIB A;  1P5Q A;  3IHZ A;  2BA1 A;  1FKB A;  1PIN A;  1FKK A;  2XP3 A;  2YSH A;  4GGQ A;  3KAF A;  5I98 A;  3NTP A;  1BKF A;  2RQS A;  1YAT A;  2ZR4 A;  4FAP A;  2ZR6 A;  1Q6I A;  1B6C A;  3O5I A;  2PPO A;  2KR7 A;  3O5E A;  2XP7 A;  2DMV A;  3RGC A;  1C9H A;  4NNR A;  1D6O A;  2DK7 A;  2FKE A;  1K9Q A;  1FKF A;  4C02 B;  3PRB A;  3O5J A;  1JMQ A;  2KI3 A;  3CGM A;  1J4H A;  2D9F A;  2F4E A;  1NMW A;  3O5G A;  3UI6 A;  3KAI A;  4TW8 A;  3TC5 A;  2Y78 A;  4R0X A;  1J4R A;  4U86 A;  4DRO A;  3UI5 A;  2F2D A;  1L1P A;  1K9R A;  1FKH A;  2ITK A;  1ZK6 A;  2DK1 A;  2M8I A;  3O5D A;  2XPA A;  1D7H A;  4DRN A;  1NSG A;  3IK8 A;  5HTG A;  1JNS A;  1QZ2 A;  4ODR A;  2RE3 A;  3NI6 A;  1FKT A;  5D75 A;  3O5P A;  5DIU A;  1ROT A;  1FKJ A;  2LPV A;  2XP9 A;  4DRH A;  3LUO A;  4JFI A;  1FKR A;  4TYO A;  2PV3 A;  1A7X A;  1EQ3 A;  2MLX A;  5BXJ A;  2LKN A;  5HUA A;  3EY6 A;  3O5Q A;  3JYM A;  1D7J A;  3KAG A;  4BF8 A;  5HT1 A;  2MNT A;  2L2S A;  4QT2 A;  2ZQS A;  5DIT A;  1NMV A;  4TNS A;  1FAP A;  3MDY B; 
#chains in the Genus database with same CATH topology
 2MLZ A;  5GQB A;  1U79 A;  4S3J A;  2PV2 A;  5HW6 A;  3O5M A;  3JYJ A;  2UZ5 A;  4WKH A;  4LAW A;  4A0T A;  3PRD A;  3ARQ A;  2YBU A;  4MAV A;  2ZAJ A;  2JXW A;  3O5F A;  2VCD A;  4O2T A;  1SR0 A;  4J4N A;  5HWB A;  4WJX A;  3ARU A;  3WKZ A;  2DSU A;  2K8I A;  4W5U A;  3O5L A;  3QOK A;  4HBO A;  5JH8 A;  4P8W A;  4LAV A;  4MNL A;  4WIW A;  3I6C A;  1ZL1 A;  5E62 A;  4IQ2 A;  1UR9 A;  4ZS6 A;  4FN2 A;  1J4I A;  1M5Y A;  4LAY A;  2RUR A;  4GLX A;  2OFN A;  3ARS A;  1KT1 A;  1UR8 A;  5U47 A;  1HKI A;  1LL4 A;  1HKK A;  1X6L A;  2L4J A;  2DSW A;  4Z2L A;  1WR7 A;  3O5K A;  2B31 A;  1E6N A;  2DSZ A;  4JFK A;  2DT0 A;  4GIV A;  4DZ3 A;  1I5H W;  1F8A B;  3UQB A;  1O6I A;  1E6R A;  4ML4 A;  2DT1 A;  1JCH B;  4J4O A;  4HBE A;  2F21 A;  1ROU A;  3CH9 A;  5DEZ A;  2WAE A;  3GPK A;  4L3N A;  1ZU8 A;  2DG9 A;  2DT3 A;  5DIV A;  2XP4 A;  1Y0O A;  3PR9 A;  2N87 A;  4ZPW R;  2LGO A;  3RM8 A;  1O6W A;  3O5R A;  4G2P A;  2DG4 A;  1W1V A;  3RME A;  3FSB A;  4DRK A;  2IF4 A;  3RFW A;  2Y8N B;  3WQW A;  3UI4 A;  3H9R B;  3UF8 A;  4TW7 A;  5HW7 A;  2M1I A;  3UQA A;  3AS3 A;  2XP5 A;  2LJ4 A;  2PPP A;  1D7I A;  4N19 A;  1LQ0 A;  1GOI A;  3ARZ A;  1ZCN A;  4IPX A;  1K9T A;  3LKX B;  3PQH A;  2YSG A;  1H0G A;  1HJV A;  1LJY A;  5DF0 A;  2XP6 A;  1YW5 A;  4WK9 A;  1JND A;  2KFW A;  2JZV A;  2AOS A;  3GU0 A;  2O92 A;  2M08 A;  1EG3 A;  3L4H A;  3ARO A;  4UDM A;  4ODL A;  1QPF A;  1TK7 A;  4XAK A;  3WD0 A;  3IKD A;  2M8J A;  1HKM A;  1KFW A;  2E45 A;  3MCB B;  1E44 A;  5GPR A;  4WKA A;  4U84 A;  2WM0 A;  2ZR5 A;  3IKG A;  4P8X A;  4P8U A;  3M7N A;  1E6Z A;  5CQ2 A;  1ITX A;  1NWS A;  1WB0 A;  3PRA A;  4ZPT R;  4MGV A;  4NSB A;  3B9E A;  4TW6 A;  1HKJ A;  3PA7 A;  3ARV A;  2VN1 A;  1T11 A;  4DH0 A;  1NWT A;  1W26 A;  2OWO A;  1FKG A;  1EIB A;  1NWR A;  2WAD A;  4REX A;  3WIJ A;  3VAW A;  3ALF A;  2PV1 A;  3ARW A;  3TDB A;  4AY1 A;  2RUC A;  1OWQ A;  2LAJ A;  1W9P A;  3CHE A;  1HJW A;  1Q6U A;  5GPG A;  2ZQU A;  3LE4 A;  1W1P A;  4KQZ A;  1FFR A;  2KE0 A;  1J6Y A;  5AHT A;  4LAX A;  4MPK A;  2DJY A;  1JVW A;  2YSB A;  1EHN A;  1VF8 A;  1OGB A;  2M3O W;  3KAC A;  4ODM A;  2XPB A;  4JFL A;  2ESC A;  3WD1 A;  4DRJ A;  4URI A;  4IT6 A;  2A3A A;  4E5R A;  3B8S A;  3AS1 A;  4PTM A;  4DT4 A;  1ZBC A;  2MLY A;  2MF9 A;  2JMF A;  2JX8 A;  1E15 A;  3WQV A;  1JNT A;  1EG4 A;  2PPN A;  3OOB A;  3KZ7 A;  2KXQ A;  3WD4 A;  4ODK A;  2FAP A;  3B7X A;  2RUD A;  4DRP A;  2PBC A;  3G6L A;  1JNE A;  2EZ5 W;  4U85 A;  3NRK A;  3KAH A;  2F23 A;  4R5E A;  1NH6 A;  1W1Y A;  4ODP A;  1RP5 A;  3AQU A;  1FFQ A;  2FDM A;  3ARY A;  4DWS B;  1FD9 A;  4Z2J A;  3CGN A;  1FKD A;  3LKX A;  1W1T A;  4DRM A;  3M85 A;  3WD2 A;  5HKG A;  3O5O A;  2ETN A;  4W9P A;  2RUQ A;  2G8Z A;  4G50 A;  2YAJ B;  3UQI A;  3CNG A;  2Q5A A;  1N1A A;  1TCO C;  5HW8 A;  1QPL A;  1Q1C A;  1KT0 A;  1PBK A;  3CHF A;  4DRQ A;  3WL1 A;  4QT3 A;  2DT2 A;  4S3K A;  4DIP A;  2A3B A;  3CHC A;  2M2A A;  3MCB A;  4MTV A;  1GRJ A;  1FKS A;  2WLZ A;  4ODO A;  1FKI A;  3ODK A;  5HWC A;  4HAR A;  4DRI A;  2AWG A;  4JYS A;  1WMV A;  1F40 A;  2IUZ A;  4IQC A;  4W9O A;  4Z2G A;  3B9A A;  1XHG A;  4A0U A;  4JFM A;  1FLC A;  3ARP A;  4W9Q A;  2QF8 A;  2JV4 A;  4DWS C;  2DG3 A;  1NWU A;  2MDI A;  4TX0 A;  3BXW A;  2RSE A;  2WLY A;  1ZBK A;  1Q6H A;  5J6E A;  4DZ2 A;  2YSI A;  3TCZ A;  4ITZ A;  3FS8 A;  4ODN A;  2ZQV A;  4Z2H A;  2DWV A;  3FAP A;  2XP8 A;  3KAD A;  1LG2 A;  1BL4 A;  2MPH A;  3BMB A;  4NZC A;  2KO7 A;  3GTY X;  3KAB A;  1WNO A;  3KCE A;  3WL0 A;  4JFJ A;  4Q7N A;  1R9H A;  2YSF A;  2EUL A;  5E65 A;  3JXV A;  1FJD A;  2A3C A;  4ODQ A;  4WKF A;  2B5U B;  1HXV A;  1FKL A;  1LL6 A;  3WD3 A;  2QRV A;  2ZQT A;  3CZ8 A;  5B8I C;  1LL7 A;  1EYM A;  3B9D A;  4MSP A;  3W4R A;  3WH0 A;  2KGJ A;  4QIB A;  1E9L A;  1P5Q A;  3IHZ A;  2BA1 A;  1FKB A;  1PIN A;  1ZB5 A;  2WK2 A;  3EIP A;  1FKK A;  2XP3 A;  4DWS A;  2YSH A;  4GGQ A;  3KAF A;  5I98 A;  5E66 A;  3NTP A;  1BKF A;  2RQS A;  1GPF A;  4IT4 A;  1YAT A;  2ZR4 A;  4Q22 A;  3ART A;  5E5W A;  2ZR6 A;  5DO2 A;  4FAP A;  1CTN A;  1Q6I A;  1B6C A;  3O5I A;  4MNK A;  3FXY A;  2A3E A;  1WAW A;  1LG1 A;  1SYT A;  3FSC A;  2PPO A;  2KR7 A;  3ARR A;  3O5E A;  2DPE A;  2XP7 A;  4MNM A;  2G41 A;  2DMV A;  1W9U A;  3RGC A;  4MNJ A;  1E6P A;  1C9H A;  1TFV A;  2DSV A;  4NNR A;  4Z2I A;  1GUV A;  1D6O A;  1OGG A;  2DK7 A;  2FKE A;  1K9Q A;  1FKF A;  4C02 B;  3PRB A;  3O5J A;  1JMQ A;  1W9V A;  2KI3 A;  3CGM A;  1J4H A;  2D9F A;  2F4E A;  1NMW A;  1H0I A;  3O5G A;  3UI6 A;  3KAI A;  4TW8 A;  3TC5 A;  2PI6 A;  3AS2 A;  2Y78 A;  4R0X A;  1J4R A;  4U86 A;  2OLH A;  3CHD A;  4DRO A;  3UI5 A;  2O9O A;  2F2D A;  1L1P A;  1K9R A;  1FKH A;  2ITK A;  2P4V A;  1ZK6 A;  2DK1 A;  2M8I A;  3O5D A;  2XPA A;  4DWS D;  1D7H A;  4DRN A;  1NSG A;  2PN0 A;  3IK8 A;  5HTG A;  1JNS A;  1QZ2 A;  4ODR A;  2RE3 A;  3NI6 A;  1FKT A;  5D75 A;  3O5P A;  5DIU A;  1EDQ A;  1ROT A;  4Z2K A;  1FKJ A;  2LPV A;  1ZBW A;  3ALG A;  3OA5 A;  1TR8 A;  2XP9 A;  4DRH A;  3LUO A;  4P8V A;  2YBT A;  4L72 B;  4QZV B;  4JFI A;  1HJX A;  1IX5 A;  4ZPV R;  1FKR A;  4TYO A;  2PV3 A;  1A7X A;  1EQ3 A;  2MLX A;  5BXJ A;  1X6N A;  2LKN A;  5HUA A;  3MQG A;  3G6M A;  3RM4 A;  1ZBV A;  3EY6 A;  1RD6 A;  3O5Q A;  3AS0 A;  3JYM A;  4KR0 B;  5E64 A;  3FY1 A;  1D7J A;  4LGX A;  3KAG A;  4BF8 A;  5HT1 A;  2MNT A;  1D2K A;  2L2S A;  4QT2 A;  2ZQS A;  5DIT A;  1NMV A;  1XRV A;  3RM9 A;  4TNS A;  5HBF A;  3MQH A;  1FAP A;  3ARX A;  3MDY B; 
#chains in the Genus database with same CATH homology
 2MLZ A;  5GQB A;  1U79 A;  4S3J A;  2PV2 A;  5HW6 A;  3O5M A;  3JYJ A;  2UZ5 A;  4WKH A;  4LAW A;  4A0T A;  3PRD A;  3ARQ A;  2YBU A;  4MAV A;  2ZAJ A;  2JXW A;  3O5F A;  2VCD A;  4O2T A;  1SR0 A;  4J4N A;  5HWB A;  4WJX A;  3ARU A;  3WKZ A;  2DSU A;  2K8I A;  4W5U A;  3O5L A;  3QOK A;  4HBO A;  5JH8 A;  4P8W A;  4LAV A;  4MNL A;  4WIW A;  3I6C A;  1ZL1 A;  5E62 A;  4IQ2 A;  1UR9 A;  4ZS6 A;  4FN2 A;  1J4I A;  1M5Y A;  4LAY A;  2RUR A;  4GLX A;  2OFN A;  3ARS A;  1KT1 A;  1UR8 A;  5U47 A;  1HKI A;  1LL4 A;  1HKK A;  1X6L A;  2L4J A;  2DSW A;  4Z2L A;  1WR7 A;  3O5K A;  2B31 A;  1E6N A;  2DSZ A;  4JFK A;  2DT0 A;  4GIV A;  4DZ3 A;  1I5H W;  1F8A B;  3UQB A;  1O6I A;  1E6R A;  4ML4 A;  2DT1 A;  4J4O A;  4HBE A;  2F21 A;  1ROU A;  3CH9 A;  5DEZ A;  2WAE A;  3GPK A;  4L3N A;  1ZU8 A;  2DG9 A;  2DT3 A;  5DIV A;  2XP4 A;  1Y0O A;  3PR9 A;  2N87 A;  4ZPW R;  2LGO A;  3RM8 A;  1O6W A;  3O5R A;  4G2P A;  2DG4 A;  1W1V A;  3RME A;  3FSB A;  4DRK A;  2IF4 A;  3RFW A;  2Y8N B;  3WQW A;  3UI4 A;  3H9R B;  3UF8 A;  4TW7 A;  5HW7 A;  2M1I A;  3UQA A;  3AS3 A;  2XP5 A;  2LJ4 A;  2PPP A;  1D7I A;  4N19 A;  1LQ0 A;  1GOI A;  3ARZ A;  1ZCN A;  4IPX A;  1K9T A;  3LKX B;  3PQH A;  2YSG A;  1H0G A;  1HJV A;  1LJY A;  5DF0 A;  2XP6 A;  1YW5 A;  4WK9 A;  1JND A;  2KFW A;  2JZV A;  2AOS A;  2O92 A;  2M08 A;  1EG3 A;  3L4H A;  3ARO A;  4ODL A;  1QPF A;  1TK7 A;  4XAK A;  3WD0 A;  3IKD A;  2M8J A;  1HKM A;  1KFW A;  2E45 A;  3MCB B;  5GPR A;  4WKA A;  4U84 A;  2WM0 A;  2ZR5 A;  3IKG A;  4P8X A;  4P8U A;  3M7N A;  1E6Z A;  5CQ2 A;  1ITX A;  1NWS A;  1WB0 A;  3PRA A;  4ZPT R;  4MGV A;  4NSB A;  3B9E A;  4TW6 A;  1HKJ A;  3PA7 A;  3ARV A;  2VN1 A;  1T11 A;  4DH0 A;  1NWT A;  1W26 A;  2OWO A;  1FKG A;  1EIB A;  1NWR A;  2WAD A;  4REX A;  3WIJ A;  3VAW A;  3ALF A;  2PV1 A;  3ARW A;  3TDB A;  4AY1 A;  2RUC A;  1OWQ A;  2LAJ A;  1W9P A;  3CHE A;  1HJW A;  1Q6U A;  5GPG A;  2ZQU A;  3LE4 A;  1W1P A;  4KQZ A;  1FFR A;  2KE0 A;  1J6Y A;  5AHT A;  4LAX A;  4MPK A;  2DJY A;  1JVW A;  2YSB A;  1EHN A;  1VF8 A;  1OGB A;  2M3O W;  3KAC A;  4ODM A;  2XPB A;  4JFL A;  2ESC A;  3WD1 A;  4DRJ A;  4URI A;  4IT6 A;  2A3A A;  4E5R A;  3B8S A;  3AS1 A;  4PTM A;  4DT4 A;  1ZBC A;  2MLY A;  2MF9 A;  2JMF A;  2JX8 A;  1E15 A;  3WQV A;  1JNT A;  1EG4 A;  2PPN A;  3OOB A;  3KZ7 A;  2KXQ A;  3WD4 A;  4ODK A;  2FAP A;  3B7X A;  2RUD A;  4DRP A;  2PBC A;  3G6L A;  1JNE A;  2EZ5 W;  4U85 A;  3NRK A;  3KAH A;  4R5E A;  1NH6 A;  1W1Y A;  4ODP A;  1RP5 A;  3AQU A;  1FFQ A;  2FDM A;  3ARY A;  4DWS B;  1FD9 A;  4Z2J A;  3CGN A;  1FKD A;  3LKX A;  1W1T A;  4DRM A;  3M85 A;  3WD2 A;  5HKG A;  3O5O A;  4W9P A;  2RUQ A;  2G8Z A;  4G50 A;  2YAJ B;  3UQI A;  3CNG A;  2Q5A A;  1N1A A;  1TCO C;  5HW8 A;  1QPL A;  1Q1C A;  1KT0 A;  1PBK A;  3CHF A;  4DRQ A;  3WL1 A;  4QT3 A;  2DT2 A;  4S3K A;  4DIP A;  2A3B A;  3CHC A;  2M2A A;  3MCB A;  4MTV A;  1FKS A;  2WLZ A;  4ODO A;  1FKI A;  3ODK A;  5HWC A;  4HAR A;  4DRI A;  2AWG A;  4JYS A;  1WMV A;  1F40 A;  2IUZ A;  4IQC A;  4W9O A;  4Z2G A;  3B9A A;  1XHG A;  4A0U A;  4JFM A;  1FLC A;  3ARP A;  4W9Q A;  2QF8 A;  2JV4 A;  4DWS C;  2DG3 A;  1NWU A;  2MDI A;  4TX0 A;  3BXW A;  2RSE A;  2WLY A;  1ZBK A;  1Q6H A;  5J6E A;  4DZ2 A;  2YSI A;  3TCZ A;  4ITZ A;  3FS8 A;  4ODN A;  2ZQV A;  4Z2H A;  2DWV A;  3FAP A;  2XP8 A;  3KAD A;  1LG2 A;  1BL4 A;  2MPH A;  4NZC A;  2KO7 A;  3KAB A;  1WNO A;  3KCE A;  3WL0 A;  4JFJ A;  4Q7N A;  1R9H A;  2YSF A;  5E65 A;  3JXV A;  1FJD A;  2A3C A;  4ODQ A;  4WKF A;  1HXV A;  1FKL A;  1LL6 A;  3WD3 A;  2QRV A;  2ZQT A;  3CZ8 A;  5B8I C;  1LL7 A;  1EYM A;  3B9D A;  4MSP A;  3W4R A;  3WH0 A;  2KGJ A;  4QIB A;  1E9L A;  1P5Q A;  3IHZ A;  2BA1 A;  1FKB A;  1PIN A;  1ZB5 A;  2WK2 A;  4DWS A;  1FKK A;  2XP3 A;  2YSH A;  4GGQ A;  3KAF A;  5I98 A;  5E66 A;  3NTP A;  1BKF A;  2RQS A;  1GPF A;  4IT4 A;  1YAT A;  2ZR4 A;  4Q22 A;  3ART A;  5E5W A;  2ZR6 A;  5DO2 A;  4FAP A;  1CTN A;  1Q6I A;  1B6C A;  3O5I A;  4MNK A;  3FXY A;  2A3E A;  1WAW A;  1LG1 A;  1SYT A;  3FSC A;  2PPO A;  2KR7 A;  3ARR A;  3O5E A;  2DPE A;  2XP7 A;  4MNM A;  2G41 A;  2DMV A;  1W9U A;  3RGC A;  4MNJ A;  1E6P A;  1C9H A;  1TFV A;  2DSV A;  4NNR A;  4Z2I A;  1GUV A;  1D6O A;  1OGG A;  2DK7 A;  2FKE A;  1K9Q A;  1FKF A;  4C02 B;  3PRB A;  3O5J A;  1JMQ A;  1W9V A;  2KI3 A;  3CGM A;  1J4H A;  2D9F A;  2F4E A;  1NMW A;  1H0I A;  3O5G A;  3UI6 A;  3KAI A;  4TW8 A;  3TC5 A;  2PI6 A;  3AS2 A;  2Y78 A;  4R0X A;  1J4R A;  4U86 A;  2OLH A;  3CHD A;  4DRO A;  3UI5 A;  2O9O A;  2F2D A;  1L1P A;  1K9R A;  1FKH A;  2ITK A;  1ZK6 A;  2DK1 A;  2M8I A;  3O5D A;  2XPA A;  4DWS D;  1D7H A;  4DRN A;  1NSG A;  3IK8 A;  5HTG A;  1JNS A;  1QZ2 A;  4ODR A;  2RE3 A;  3NI6 A;  1FKT A;  5D75 A;  3O5P A;  5DIU A;  1EDQ A;  1ROT A;  4Z2K A;  1FKJ A;  2LPV A;  1ZBW A;  3ALG A;  3OA5 A;  1TR8 A;  2XP9 A;  4DRH A;  3LUO A;  4P8V A;  2YBT A;  4L72 B;  4QZV B;  4JFI A;  1HJX A;  1IX5 A;  4ZPV R;  1FKR A;  4TYO A;  2PV3 A;  1A7X A;  1EQ3 A;  2MLX A;  5BXJ A;  1X6N A;  2LKN A;  5HUA A;  3MQG A;  3G6M A;  3RM4 A;  1ZBV A;  3EY6 A;  1RD6 A;  3O5Q A;  3AS0 A;  3JYM A;  4KR0 B;  5E64 A;  3FY1 A;  1D7J A;  4LGX A;  3KAG A;  4BF8 A;  5HT1 A;  2MNT A;  1D2K A;  2L2S A;  4QT2 A;  2ZQS A;  5DIT A;  1NMV A;  1XRV A;  3RM9 A;  4TNS A;  5HBF A;  3MQH A;  1FAP A;  3ARX A;  3MDY B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...