4U86A

Human pin1 with cysteine sulfonic acid 113
Total Genus 44
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
44
sequence length
158
structure length
144
Chain Sequence
KLPPGWEKAMSRSSGRVYYFNHITNASQWERPEPARVRCSHLLVKHSQSRRPSSWRQEKITRTKEEALELINGYIQKIKSGEEDFESLASQFSDSSAKARGDLGAFSRGQMQKPFEDASFALRTGEMSGPVFTDSGIHIILRTE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Pin1 cysteine-113 oxidation inhibits its catalytic activity and cellular function in Alzheimer's disease.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Isomerase
molecule keywords Peptidyl-prolyl cis-trans isomerase NIMA-interacting 1
total genus 44
structure length 144
sequence length 158
ec nomenclature ec 5.2.1.8: Peptidylprolyl isomerase.
pdb deposition date 2014-08-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00397 WW WW domain
A PF00639 Rotamase PPIC-type PPIASE domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.20.70.10 Mainly Beta Single Sheet Ubiquitin Ligase Nedd4; Chain: W; Ubiquitin Ligase Nedd4; Chain: W; 4u86A01
3.10.50.40 Alpha Beta Roll Chitinase A; domain 3 Chitinase A; domain 3 4u86A02
3KAIA 3KAGA 2XP3A 4LAYA 1FKDA 2PPNA 4C02B 4DIPA 4QIBA 2ZQVA 2MLZA 3LUOA 2VN1A 1F8AB 1FKIA 5HWBA 2LAJA 3KABA 1EG3A 3KADA 2ZQUA 4ODKA 2VCDA 4TW7A 3O5OA 2XPBA 1YATA 3O5EA 4ODQA 4DH0A 1NMWA 5J6EA 1Q6HA 2XP6A 1FKLA 1JNSA 2XP4A 2XP8A 2DJYA 2ZR6A 1FAPA 2LGOA 2M1IA 2RUCA 4U85A 1D7HA 1QPFA 5D75A 3UQIA 1FJDA 3TDBA 2JMFA 4E5RA 3WH0A 1ROUA 3O5PA 3O5FA 4LAWA 1EQ3A 2MF9A 1QZ2A 1YW5A 4TX0A 1ZCNA 5B8IC 3UQBA 3O5QA 1N1AA 2M3OW 2RUQA 5HTGA 2F4EA 2KFWA 4QT3A 1TCOC 2F2DA 1FKKA 3O5DA 2DG4A 4DRNA 3UI5A 5I98A 4IQ2A 2ZQSA 2PV1A 2AWGA 3CGMA 4JFKA 5DITA 4DRMA 3KZ7A 4JFMA 4U84A 3KAFA 3UQAA 2DK1A 3O5MA 4ODRA 1TK7A 3TCZA 2KI3A 1NSGA 2KR7A 2PV3A 2UZ5A 5DIVA 3NI6A 5BXJA 3B7XA 2RE3A 3UI4A 1B6CA 2YSHA 1D7IA 2M2AA 4MGVA 2EZ5W 1J4HA 4DT4A 3UF8A 4GGQA 3GPKA 4ODPA 1Q1CA 5CQ2A 2L2SA 4TW6A 3O5RA 4DRQA 1EG4A 4TYOA 2XP5A 4LAXA 2DMVA 2Q5AA 2DWVA 5AHTA 2DG3A 1JMQA 2K8IA 2KGJA 2KO7A 3H9RB 3L4HA 1P5QA 3KACA 3PRBA 3O5GA 4JFLA 5HW7A 4ODNA 3JYMA 3M85A 1FKRA 2YSIA 2N87A 1BKFA 2XPAA 1WR7A 1W26A 4G2PA 3IK8A 2F21A 2D9FA 4LAVA 2IF4A 1FKBA 3FAPA 3NTPA 1D7JA 3MDYB 3JYJA 1K9QA 1JVWA 1FKJA 2BA1A 2PBCA 2Y78A 4DRIA 1J6YA 2JV4A 1QPLA 4G50A 4IPXA 2M8IA 3LE4A 1Q6UA 3IHZA 2JXWA 4FAPA 2RURA 3EY6A 3UI6A 3CNGA 2RQSA 1A7XA 4DZ3A 2MLYA 2LKNA 2LPVA 5HUAA 4IQCA 2OFNA 1O6WA 1FKTA 1FKSA 1R9HA 3IKGA 5HWCA 3NRKA 2ZR5A 1JNTA 4NNRA 4GIVA 4ODOA 3I6CA 1T11A 4DRKA 1NMVA 2E45A 3OOBA 4U86A 4QT2A 2XP9A 2M08A 1I5HW 2RSEA 3CGNA 3O5JA 3TC5A 1ZK6A 5GPGA 4DRPA 2ZAJA 1KT0A 1ROTA 4REXA 4JYSA 1EYMA 1U79A 3RFWA 4JFJA 5HKGA 1HXVA 1F40A 4TW8A 4ITZA 2YSFA 2PPPA 2RUDA 2MDIA 2YSBA 4DROA 2PV2A 5HW8A 2KXQA 2FAPA 2L4JA 4J4NA 4J4OA 4ODLA 4W9PA 1D6OA 4JFIA 2ITKA 5HT1A 1J4IA 4DZ2A 2M8JA 4FN2A 1M5YA 2FKEA 1C9HA 2LJ4A 1PBKA 5HW6A 3IKDA 3ODKA 3VAWA 3PA7A 4MSPA 2ZR4A 2MPHA 5DIUA 4O2TA 2PPOA 3JXVA 1FKFA 3M7NA 1Y0OA 1J4RA 2KE0A 3RGCA 1L1PA 1Q6IA 4DRJA 1K9RA 2DG9A 1WMVA 3O5LA 1KT1A 3O5KA 4R0XA 3PRDA 4W9OA 2JZVA 1BL4A 2ZQTA 3O5IA 4W9QA 1PINA 2XP7A 2DK7A 2MNTA 2MLXA 4TNSA 4ODMA 1FKGA 4BF8A 2JX8A 3KCEA 4DRHA 1FKHA 4N19A 1FD9A 2YSGA 3KAHA
chains in the Genus database with same CATH superfamily
4LAYA 2XP3A 1W9VA 4Z2IA 5HWCA 4QIBA 2MLZA 4R5EA 2DPEA 3O5OA 2YBUA 1YATA 1Q6HA 5E65A 1JNSA 2XP4A 2DJYA 3UQIA 5D75A 3TDBA 1X6LA 4LAWA 4L72B 1JNDA 2PN0A 3AS3A 2M3OW 2RUQA 2F4EA 2KFWA 1E6ZA 2F2DA 3O5DA 1FKKA 4XAKA 5I98A 4IQ2A 2PV1A 3CGMA 3KZ7A 1OWQA 4DWSA 3WD0A 3MCBA 2DK1A 2UZ5A 2KR7A 2PV3A 3B7XA 2IUZA 1GPFA 3MCBB 1D7IA 2EZ5W 1J4HA 3UF8A 3EIPA 2WLZA 1Q1CA 4TW6A 4MNKA 2DMVA 5AHTA 2DWVA 2KO7A 1P5QA 3PRBA 3AROA 1ZBCA 4ZPWR 3CHCA 1GOIA 1EIBA 3IK8A 2F21A 2D9FA 1D7JA 4WJXA 1FKJA 3PR9A 2A3BA 4DRIA 2WK2A 2JV4A 4G50A 2YAJB 3G6MA 2M8IA 3LE4A 4FAPA 1A7XA 1WB0A 5E62A 5HUAA 3ARZA 1EDQA 2OLHA 3IKGA 3NRKA 4ODOA 1K9TA 1NMVA 2O9OA 2E45A 4P8UA 3O5JA 1FFQA 3FS8A 1LL7A 1LG2A 1F40A 3CZ8A 1ZBKA 4W9PA 4J4OA 1ZBWA 1J4IA 4IT6A 3ARRA 3QOKA 1M5YA 4UDMA 5HW6A 3IKDA 3ODKA 3VAWA 4MSPA 4DWSC 3JXVA 1SYTA 2KE0A 3O5KA 3GTYX 2B5UB 4TNSA 2JX8A 2PI6A 1FD9A 5E64A 3KAHA 4DIPA 4Z2KA 2VN1A 1F8AB 5HWBA 4S3JA 1EG3A 1KFWA 3CHEA 3ARXA 4Z2JA 3MQHA 1NH6A 4ODQA 5J6EA 1LL4A 1E6PA 2M1IA 5U47A 3WD1A 4MNMA 4WIWA 1CTNA 1OGBA 2JMFA 3O5FA 1EQ3A 4Z2HA 1YW5A 1N1AA 1HJXA 1TCOC 2ZQSA 5DITA 4JFMA 3TCZA 1NSGA 4WK9A 4MNJA 5BXJA 3WD4A 4HBOA 1B6CA 3BMBA 4IT4A 2M2AA 2DT3A 2DT0A 4GGQA 1HKIA 4LAXA 4DZ3A 3O5LA 4O2TA 1JMQA 2DSVA 3O5GA 2QF8A 5HW7A 3AS1A 3M85A 2DSUA 2N87A 4NZCA 5GQBA 1WR7A 4P8XA 1RP5A 5DF0A 3ARYA 3FAPA 2F23A 2Y78A 5JH8A 1SR0A 4MNLA 4Q7NA 3ARSA 2RURA 1W1PA 3UI6A 2RQSA 3AS0A 3WL0A 4DRKA 2AOSA 2RSEA 2P4VA 1KT0A 1ROTA 3RM9A 4REXA 4JYSA 4HBEA 1FLCA 4DWSB 1HXVA 4TW8A 2WADA 2PPPA 4DROA 2MDIA 2YSBA 5HW8A 2FAPA 2L4JA 1TR8A 3RM8A 4FN2A 4A0TA 1C9HA 2LJ4A 1PBKA 3PA7A 5GPRA 2ZR4A 2MPHA 3RMEA 4HARA 3WKZA 3WD2A 1HJWA 1J4RA 3G6LA 1K9RA 1E9LA 1WMVA 2DG9A 1KT1A 3PRDA 4W9OA 1BL4A 4LGXA 2ETNA 4W9QA 2XP7A 2MNTA 2MLXA 4BF8A 3KCEA 4DRHA 3KAIA 1FKDA 2PPNA 4C02B 4P8VA 2ZQVA 1W1TA 1FKIA 2LAJA 3KABA 4MPKA 3KADA 2ZQUA 3WD3A 2VCDA 4DWSD 1JCHB 2XPBA 3O5EA 1ITXA 1FKLA 4QZVB 1XRVA 2XP8A 2RUCA 1FAPA 2LGOA 1D7HA 1QPFA 2OWOA 1H0IA 5DO2A 4E5RA 4TX0A 1ZCNA 3UQBA 2B31A 4L3NA 4QT3A 1W1YA 4JFKA 2AWGA 1UR9A 4WKFA 3KAFA 3UQAA 4Z2GA 5DIVA 3ARUA 1EHNA 2RE3A 3FXYA 2YSHA 4MGVA 1RD6A 1ZBVA 4DT4A 4ODPA 3MQGA 5CQ2A 4DRQA 3ARVA 4TYOA 2XP5A 2Q5AA 2KGJA 3H9RB 2DG3A 4JFLA 3L4HA 2WM0A 3KACA 1E6RA 2DT2A 2YSIA 2A3AA 1W26A 3AS2A 4LAVA 3NTPA 3JYJA 4MAVA 2PBCA 1QPLA 4Q22A 2EULA 3OA5A 1Q6UA 3IHZA 3EY6A 3CNGA 5HBFA 4GLXA 1H0GA 2LKNA 2LPVA 1ZU8A 2OFNA 1O6WA 1FKSA 1R9HA 4MTVA 1JNTA 3WIJA 4KQZA 2G8ZA 2G41A 3WQVA 3OOBA 4U86A 2M08A 5GPGA 4WKHA 3TC5A 3ARWA 3RFWA 2YSFA 2RUDA 2PV2A 4ODLA 1E44A 4J4NA 5HT1A 1D6OA 4JFIA 2ITKA 2M8JA 1LQ0A 2FKEA 3LKXB 1IX5A 2DSWA 1HKMA 2A3CA 1NWSA 5DIUA 3BXWA 3LKXA 1Y0OA 4DRJA 3CH9A 4P8WA 4PTMA 4S3KA 1HKKA 3O5IA 1PINA 1E6NA 5E5WA 1VF8A 2YSGA 4ODKA 1LL6A 3KAGA 1LG1A 3LUOA 2DT1A 3GU0A 3B8SA 1TFVA 4ML4A 1HKJA 1ZB5A 4TW7A 4DH0A 1NMWA 2XP6A 1UR8A 2ZR6A 2Y8NB 4U85A 1X6NA 1FJDA 1ROUA 3WH0A 3O5PA 1E15A 2MF9A 1QZ2A 5DEZA 5B8IC 3O5QA 2O92A 5HTGA 3CHDA 3ARTA 1WAWA 4DRNA 2DG4A 3UI5A 3W4RA 4ZS6A 4DRMA 1XHGA 4U84A 3CHFA 3O5MA 2ESCA 4ODRA 1TK7A 2KI3A 3PQHA 3NI6A 3UI4A 1W1VA 3GPKA 2L2SA 4URIA 3O5RA 4ZPVR 3RM4A 1EG4A 2K8IA 2A3EA 3ALFA 3PRAA 4ODNA 3JYMA 3WQWA 1OGGA 1FKRA 1BKFA 2XPAA 4G2PA 2IF4A 1FKBA 1LJYA 1W9PA 3MDYB 1D2KA 1K9QA 1JVWA 4AY1A 2BA1A 1GRJA 4W5UA 1J6YA 3AQUA 4Z2LA 4IPXA 2JXWA 1NWUA 3B9DA 3FSBA 1NWRA 2MLYA 1NWTA 4IQCA 1FKTA 3B9AA 4NNRA 2ZR5A 3FY1A 5E66A 4GIVA 1HJVA 4ZPTR 3I6CA 1T11A 3WL1A 2WLYA 4QT2A 2XP9A 3CGNA 1I5HW 1ZK6A 4DRPA 2ZAJA 2DSZA 3ARQA 1EYMA 1U79A 3B9EA 4JFJA 5HKGA 4A0UA 4ITZA 2QRVA 2KXQA 4DZ2A 1ZL1A 3ALGA 4WKAA 1JNEA 1W9UA 1O6IA 1WNOA 2YBTA 2PPOA 1FKFA 3M7NA 1GUVA 4NSBA 3RGCA 1Q6IA 4R0XA 2JZVA 3ARPA 2WAEA 1FFRA 2ZQTA 1L1PA 2DK7A 4KR0B 3FSCA 4ODMA 1FKGA 2FDMA 1FKHA 4N19A
chains in the Genus database with same CATH topology
4LAYA 2XP3A 1W9VA 4Z2IA 5HWCA 4QIBA 2MLZA 4R5EA 2DPEA 3O5OA 2YBUA 1YATA 1Q6HA 5E65A 1JNSA 2XP4A 2DJYA 3UQIA 5D75A 3TDBA 1X6LA 4LAWA 4L72B 1JNDA 3AS3A 2M3OW 2RUQA 2F4EA 2KFWA 1E6ZA 2F2DA 3O5DA 1FKKA 4XAKA 5I98A 4IQ2A 2PV1A 3CGMA 3KZ7A 1OWQA 4DWSA 3WD0A 3MCBA 2DK1A 2UZ5A 2KR7A 2PV3A 3B7XA 2IUZA 1GPFA 3MCBB 1D7IA 2EZ5W 1J4HA 3UF8A 2WLZA 1Q1CA 4TW6A 4MNKA 2DMVA 5AHTA 2DWVA 2KO7A 1P5QA 3PRBA 3AROA 1ZBCA 4ZPWR 3CHCA 1GOIA 1EIBA 3IK8A 2F21A 2D9FA 1D7JA 4WJXA 1FKJA 3PR9A 2A3BA 4DRIA 2WK2A 2JV4A 4G50A 2YAJB 3G6MA 2M8IA 3LE4A 4FAPA 1A7XA 1WB0A 5E62A 5HUAA 3ARZA 1EDQA 2OLHA 3IKGA 3NRKA 4ODOA 1K9TA 1NMVA 2O9OA 2E45A 4P8UA 3O5JA 1FFQA 3FS8A 1LL7A 1LG2A 1F40A 3CZ8A 1ZBKA 4W9PA 4J4OA 1ZBWA 1J4IA 4IT6A 3ARRA 3QOKA 1M5YA 5HW6A 3IKDA 3ODKA 3VAWA 4MSPA 4DWSC 3JXVA 1SYTA 2KE0A 3O5KA 4TNSA 2JX8A 2PI6A 1FD9A 5E64A 3KAHA 4DIPA 4Z2KA 2VN1A 1F8AB 5HWBA 4S3JA 1EG3A 1KFWA 3CHEA 3ARXA 4Z2JA 3MQHA 1NH6A 4ODQA 5J6EA 1LL4A 1E6PA 2M1IA 5U47A 3WD1A 4MNMA 4WIWA 1CTNA 1OGBA 2JMFA 3O5FA 1EQ3A 4Z2HA 1YW5A 1N1AA 1HJXA 1TCOC 2ZQSA 5DITA 4JFMA 3TCZA 1NSGA 4WK9A 4MNJA 5BXJA 3WD4A 4HBOA 1B6CA 4IT4A 2M2AA 2DT3A 2DT0A 4GGQA 1HKIA 4LAXA 4DZ3A 3O5LA 4O2TA 1JMQA 2DSVA 3O5GA 2QF8A 5HW7A 3AS1A 3M85A 2DSUA 2N87A 4NZCA 5GQBA 1WR7A 4P8XA 1RP5A 5DF0A 3ARYA 3FAPA 2Y78A 5JH8A 1SR0A 4MNLA 4Q7NA 3ARSA 2RURA 1W1PA 3UI6A 2RQSA 3AS0A 3WL0A 4DRKA 2AOSA 2RSEA 1KT0A 1ROTA 3RM9A 4REXA 4JYSA 4HBEA 1FLCA 4DWSB 1HXVA 4TW8A 2WADA 2PPPA 4DROA 2MDIA 2YSBA 5HW8A 2FAPA 2L4JA 1TR8A 3RM8A 4FN2A 4A0TA 1C9HA 2LJ4A 1PBKA 3PA7A 5GPRA 2ZR4A 2MPHA 3RMEA 4HARA 3WKZA 3WD2A 1HJWA 1J4RA 3G6LA 1K9RA 1E9LA 1WMVA 2DG9A 1KT1A 3PRDA 4W9OA 1BL4A 4LGXA 4W9QA 2XP7A 2MNTA 2MLXA 4BF8A 3KCEA 4DRHA 3KAIA 1FKDA 2PPNA 4C02B 4P8VA 2ZQVA 1W1TA 1FKIA 2LAJA 3KABA 4MPKA 3KADA 2ZQUA 3WD3A 2VCDA 4DWSD 2XPBA 3O5EA 1ITXA 1FKLA 4QZVB 1XRVA 2XP8A 2RUCA 1FAPA 2LGOA 1D7HA 1QPFA 2OWOA 1H0IA 5DO2A 4E5RA 4TX0A 1ZCNA 3UQBA 2B31A 4L3NA 4QT3A 1W1YA 4JFKA 2AWGA 1UR9A 4WKFA 3KAFA 3UQAA 4Z2GA 5DIVA 3ARUA 1EHNA 2RE3A 3FXYA 2YSHA 4MGVA 1RD6A 1ZBVA 4DT4A 4ODPA 3MQGA 5CQ2A 4DRQA 3ARVA 4TYOA 2XP5A 2Q5AA 2KGJA 3H9RB 2DG3A 4JFLA 3L4HA 2WM0A 3KACA 1E6RA 2DT2A 2YSIA 2A3AA 1W26A 3AS2A 4LAVA 3NTPA 3JYJA 4MAVA 2PBCA 1QPLA 4Q22A 3OA5A 1Q6UA 3IHZA 3EY6A 3CNGA 5HBFA 4GLXA 1H0GA 2LKNA 2LPVA 1ZU8A 2OFNA 1O6WA 1FKSA 1R9HA 4MTVA 1JNTA 3WIJA 4KQZA 2G8ZA 2G41A 3WQVA 3OOBA 4U86A 2M08A 5GPGA 4WKHA 3TC5A 3ARWA 3RFWA 2YSFA 2RUDA 2PV2A 4ODLA 4J4NA 5HT1A 1D6OA 4JFIA 2ITKA 2M8JA 1LQ0A 2FKEA 3LKXB 1IX5A 2DSWA 1HKMA 2A3CA 1NWSA 5DIUA 3BXWA 3LKXA 1Y0OA 4DRJA 3CH9A 4P8WA 4PTMA 4S3KA 1HKKA 3O5IA 1PINA 1E6NA 5E5WA 1VF8A 2YSGA 4ODKA 1LL6A 3KAGA 1LG1A 3LUOA 2DT1A 3B8SA 1TFVA 4ML4A 1HKJA 1ZB5A 4TW7A 4DH0A 1NMWA 2XP6A 1UR8A 2ZR6A 2Y8NB 4U85A 1X6NA 1FJDA 1ROUA 3WH0A 3O5PA 1E15A 2MF9A 1QZ2A 5DEZA 5B8IC 3O5QA 2O92A 5HTGA 3CHDA 3ARTA 1WAWA 4DRNA 2DG4A 3UI5A 3W4RA 4ZS6A 4DRMA 1XHGA 4U84A 3CHFA 3O5MA 2ESCA 4ODRA 1TK7A 2KI3A 3PQHA 3NI6A 3UI4A 1W1VA 3GPKA 2L2SA 4URIA 3O5RA 4ZPVR 3RM4A 1EG4A 2K8IA 2A3EA 3ALFA 3PRAA 4ODNA 3JYMA 3WQWA 1OGGA 1FKRA 1BKFA 2XPAA 4G2PA 2IF4A 1FKBA 1LJYA 1W9PA 3MDYB 1D2KA 1K9QA 1JVWA 4AY1A 2BA1A 4W5UA 1J6YA 3AQUA 4Z2LA 4IPXA 2JXWA 1NWUA 3B9DA 3FSBA 1NWRA 2MLYA 1NWTA 4IQCA 1FKTA 3B9AA 4NNRA 2ZR5A 3FY1A 5E66A 4GIVA 1HJVA 4ZPTR 3I6CA 1T11A 3WL1A 2WLYA 4QT2A 2XP9A 3CGNA 1I5HW 1ZK6A 4DRPA 2ZAJA 2DSZA 3ARQA 1EYMA 1U79A 3B9EA 4JFJA 5HKGA 4A0UA 4ITZA 2QRVA 2KXQA 4DZ2A 1ZL1A 3ALGA 4WKAA 1JNEA 1W9UA 1O6IA 1WNOA 2YBTA 2PPOA 1FKFA 3M7NA 1GUVA 4NSBA 3RGCA 1Q6IA 4R0XA 2JZVA 3ARPA 2WAEA 1FFRA 2ZQTA 1L1PA 2DK7A 4KR0B 3FSCA 4ODMA 1FKGA 2FDMA 1FKHA 4N19A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3KAI A;  3KAG A;  2XP3 A;  4LAY A;  1FKD A;  2PPN A;  4C02 B;  4DIP A;  4QIB A;  2ZQV A;  2MLZ A;  3LUO A;  2VN1 A;  1F8A B;  1FKI A;  5HWB A;  2LAJ A;  3KAB A;  1EG3 A;  3KAD A;  2ZQU A;  4ODK A;  2VCD A;  4TW7 A;  3O5O A;  2XPB A;  1YAT A;  3O5E A;  4ODQ A;  4DH0 A;  1NMW A;  5J6E A;  1Q6H A;  2XP6 A;  1FKL A;  1JNS A;  2XP4 A;  2XP8 A;  2DJY A;  2ZR6 A;  1FAP A;  2LGO A;  2M1I A;  2RUC A;  4U85 A;  1D7H A;  1QPF A;  5D75 A;  3UQI A;  1FJD A;  3TDB A;  2JMF A;  4E5R A;  3WH0 A;  1ROU A;  3O5P A;  3O5F A;  4LAW A;  1EQ3 A;  2MF9 A;  1QZ2 A;  1YW5 A;  4TX0 A;  1ZCN A;  5B8I C;  3UQB A;  3O5Q A;  1N1A A;  2M3O W;  2RUQ A;  5HTG A;  2F4E A;  2KFW A;  4QT3 A;  1TCO C;  2F2D A;  1FKK A;  3O5D A;  2DG4 A;  4DRN A;  3UI5 A;  5I98 A;  4IQ2 A;  2ZQS A;  2PV1 A;  2AWG A;  3CGM A;  4JFK A;  5DIT A;  4DRM A;  3KZ7 A;  4JFM A;  4U84 A;  3KAF A;  3UQA A;  2DK1 A;  3O5M A;  4ODR A;  1TK7 A;  3TCZ A;  2KI3 A;  1NSG A;  2KR7 A;  2PV3 A;  2UZ5 A;  5DIV A;  3NI6 A;  5BXJ A;  3B7X A;  2RE3 A;  3UI4 A;  1B6C A;  2YSH A;  1D7I A;  2M2A A;  4MGV A;  2EZ5 W;  1J4H A;  4DT4 A;  3UF8 A;  4GGQ A;  3GPK A;  4ODP A;  1Q1C A;  5CQ2 A;  2L2S A;  4TW6 A;  3O5R A;  4DRQ A;  1EG4 A;  4TYO A;  2XP5 A;  4LAX A;  2DMV A;  2Q5A A;  2DWV A;  5AHT A;  2DG3 A;  1JMQ A;  2K8I A;  2KGJ A;  2KO7 A;  3H9R B;  3L4H A;  1P5Q A;  3KAC A;  3PRB A;  3O5G A;  4JFL A;  5HW7 A;  4ODN A;  3JYM A;  3M85 A;  1FKR A;  2YSI A;  2N87 A;  1BKF A;  2XPA A;  1WR7 A;  1W26 A;  4G2P A;  3IK8 A;  2F21 A;  2D9F A;  4LAV A;  2IF4 A;  1FKB A;  3FAP A;  3NTP A;  1D7J A;  3MDY B;  3JYJ A;  1K9Q A;  1JVW A;  1FKJ A;  2BA1 A;  2PBC A;  2Y78 A;  4DRI A;  1J6Y A;  2JV4 A;  1QPL A;  4G50 A;  4IPX A;  2M8I A;  3LE4 A;  1Q6U A;  3IHZ A;  2JXW A;  4FAP A;  2RUR A;  3EY6 A;  3UI6 A;  3CNG A;  2RQS A;  1A7X A;  4DZ3 A;  2MLY A;  2LKN A;  2LPV A;  5HUA A;  4IQC A;  2OFN A;  1O6W A;  1FKT A;  1FKS A;  1R9H A;  3IKG A;  5HWC A;  3NRK A;  2ZR5 A;  1JNT A;  4NNR A;  4GIV A;  4ODO A;  3I6C A;  1T11 A;  4DRK A;  1NMV A;  2E45 A;  3OOB A;  4U86 A;  4QT2 A;  2XP9 A;  2M08 A;  1I5H W;  2RSE A;  3CGN A;  3O5J A;  3TC5 A;  1ZK6 A;  5GPG A;  4DRP A;  2ZAJ A;  1KT0 A;  1ROT A;  4REX A;  4JYS A;  1EYM A;  1U79 A;  3RFW A;  4JFJ A;  5HKG A;  1HXV A;  1F40 A;  4TW8 A;  4ITZ A;  2YSF A;  2PPP A;  2RUD A;  2MDI A;  2YSB A;  4DRO A;  2PV2 A;  5HW8 A;  2KXQ A;  2FAP A;  2L4J A;  4J4N A;  4J4O A;  4ODL A;  4W9P A;  1D6O A;  4JFI A;  2ITK A;  5HT1 A;  1J4I A;  4DZ2 A;  2M8J A;  4FN2 A;  1M5Y A;  2FKE A;  1C9H A;  2LJ4 A;  1PBK A;  5HW6 A;  3IKD A;  3ODK A;  3VAW A;  3PA7 A;  4MSP A;  2ZR4 A;  2MPH A;  5DIU A;  4O2T A;  2PPO A;  3JXV A;  1FKF A;  3M7N A;  1Y0O A;  1J4R A;  2KE0 A;  3RGC A;  1L1P A;  1Q6I A;  4DRJ A;  1K9R A;  2DG9 A;  1WMV A;  3O5L A;  1KT1 A;  3O5K A;  4R0X A;  3PRD A;  4W9O A;  2JZV A;  1BL4 A;  2ZQT A;  3O5I A;  4W9Q A;  1PIN A;  2XP7 A;  2DK7 A;  2MNT A;  2MLX A;  4TNS A;  4ODM A;  1FKG A;  4BF8 A;  2JX8 A;  3KCE A;  4DRH A;  1FKH A;  4N19 A;  1FD9 A;  2YSG A;  3KAH A; 
#chains in the Genus database with same CATH topology
 4LAY A;  2XP3 A;  1W9V A;  4Z2I A;  5HWC A;  4QIB A;  2MLZ A;  4R5E A;  2DPE A;  3O5O A;  2YBU A;  1YAT A;  1Q6H A;  5E65 A;  1JNS A;  2XP4 A;  2DJY A;  3UQI A;  5D75 A;  3TDB A;  1X6L A;  4LAW A;  4L72 B;  1JND A;  2PN0 A;  3AS3 A;  2M3O W;  2RUQ A;  2F4E A;  2KFW A;  1E6Z A;  2F2D A;  3O5D A;  1FKK A;  4XAK A;  5I98 A;  4IQ2 A;  2PV1 A;  3CGM A;  3KZ7 A;  1OWQ A;  4DWS A;  3WD0 A;  3MCB A;  2DK1 A;  2UZ5 A;  2KR7 A;  2PV3 A;  3B7X A;  2IUZ A;  1GPF A;  3MCB B;  1D7I A;  2EZ5 W;  1J4H A;  3UF8 A;  3EIP A;  2WLZ A;  1Q1C A;  4TW6 A;  4MNK A;  2DMV A;  5AHT A;  2DWV A;  2KO7 A;  1P5Q A;  3PRB A;  3ARO A;  1ZBC A;  4ZPW R;  3CHC A;  1GOI A;  1EIB A;  3IK8 A;  2F21 A;  2D9F A;  1D7J A;  4WJX A;  1FKJ A;  3PR9 A;  2A3B A;  4DRI A;  2WK2 A;  2JV4 A;  4G50 A;  2YAJ B;  3G6M A;  2M8I A;  3LE4 A;  4FAP A;  1A7X A;  1WB0 A;  5E62 A;  5HUA A;  3ARZ A;  1EDQ A;  2OLH A;  3IKG A;  3NRK A;  4ODO A;  1K9T A;  1NMV A;  2O9O A;  2E45 A;  4P8U A;  3O5J A;  1FFQ A;  3FS8 A;  1LL7 A;  1LG2 A;  1F40 A;  3CZ8 A;  1ZBK A;  4W9P A;  4J4O A;  1ZBW A;  1J4I A;  4IT6 A;  3ARR A;  3QOK A;  1M5Y A;  4UDM A;  5HW6 A;  3IKD A;  3ODK A;  3VAW A;  4MSP A;  4DWS C;  3JXV A;  1SYT A;  2KE0 A;  3O5K A;  3GTY X;  2B5U B;  4TNS A;  2JX8 A;  2PI6 A;  1FD9 A;  5E64 A;  3KAH A;  4DIP A;  4Z2K A;  2VN1 A;  1F8A B;  5HWB A;  4S3J A;  1EG3 A;  1KFW A;  3CHE A;  3ARX A;  4Z2J A;  3MQH A;  1NH6 A;  4ODQ A;  5J6E A;  1LL4 A;  1E6P A;  2M1I A;  5U47 A;  3WD1 A;  4MNM A;  4WIW A;  1CTN A;  1OGB A;  2JMF A;  3O5F A;  1EQ3 A;  4Z2H A;  1YW5 A;  1N1A A;  1HJX A;  1TCO C;  2ZQS A;  5DIT A;  4JFM A;  3TCZ A;  1NSG A;  4WK9 A;  4MNJ A;  5BXJ A;  3WD4 A;  4HBO A;  1B6C A;  3BMB A;  4IT4 A;  2M2A A;  2DT3 A;  2DT0 A;  4GGQ A;  1HKI A;  4LAX A;  4DZ3 A;  3O5L A;  4O2T A;  1JMQ A;  2DSV A;  3O5G A;  2QF8 A;  5HW7 A;  3AS1 A;  3M85 A;  2DSU A;  2N87 A;  4NZC A;  5GQB A;  1WR7 A;  4P8X A;  1RP5 A;  5DF0 A;  3ARY A;  3FAP A;  2F23 A;  2Y78 A;  5JH8 A;  1SR0 A;  4MNL A;  4Q7N A;  3ARS A;  2RUR A;  1W1P A;  3UI6 A;  2RQS A;  3AS0 A;  3WL0 A;  4DRK A;  2AOS A;  2RSE A;  2P4V A;  1KT0 A;  1ROT A;  3RM9 A;  4REX A;  4JYS A;  4HBE A;  1FLC A;  4DWS B;  1HXV A;  4TW8 A;  2WAD A;  2PPP A;  4DRO A;  2MDI A;  2YSB A;  5HW8 A;  2FAP A;  2L4J A;  1TR8 A;  3RM8 A;  4FN2 A;  4A0T A;  1C9H A;  2LJ4 A;  1PBK A;  3PA7 A;  5GPR A;  2ZR4 A;  2MPH A;  3RME A;  4HAR A;  3WKZ A;  3WD2 A;  1HJW A;  1J4R A;  3G6L A;  1K9R A;  1E9L A;  1WMV A;  2DG9 A;  1KT1 A;  3PRD A;  4W9O A;  1BL4 A;  4LGX A;  2ETN A;  4W9Q A;  2XP7 A;  2MNT A;  2MLX A;  4BF8 A;  3KCE A;  4DRH A;  3KAI A;  1FKD A;  2PPN A;  4C02 B;  4P8V A;  2ZQV A;  1W1T A;  1FKI A;  2LAJ A;  3KAB A;  4MPK A;  3KAD A;  2ZQU A;  3WD3 A;  2VCD A;  4DWS D;  1JCH B;  2XPB A;  3O5E A;  1ITX A;  1FKL A;  4QZV B;  1XRV A;  2XP8 A;  2RUC A;  1FAP A;  2LGO A;  1D7H A;  1QPF A;  2OWO A;  1H0I A;  5DO2 A;  4E5R A;  4TX0 A;  1ZCN A;  3UQB A;  2B31 A;  4L3N A;  4QT3 A;  1W1Y A;  4JFK A;  2AWG A;  1UR9 A;  4WKF A;  3KAF A;  3UQA A;  4Z2G A;  5DIV A;  3ARU A;  1EHN A;  2RE3 A;  3FXY A;  2YSH A;  4MGV A;  1RD6 A;  1ZBV A;  4DT4 A;  4ODP A;  3MQG A;  5CQ2 A;  4DRQ A;  3ARV A;  4TYO A;  2XP5 A;  2Q5A A;  2KGJ A;  3H9R B;  2DG3 A;  4JFL A;  3L4H A;  2WM0 A;  3KAC A;  1E6R A;  2DT2 A;  2YSI A;  2A3A A;  1W26 A;  3AS2 A;  4LAV A;  3NTP A;  3JYJ A;  4MAV A;  2PBC A;  1QPL A;  4Q22 A;  2EUL A;  3OA5 A;  1Q6U A;  3IHZ A;  3EY6 A;  3CNG A;  5HBF A;  4GLX A;  1H0G A;  2LKN A;  2LPV A;  1ZU8 A;  2OFN A;  1O6W A;  1FKS A;  1R9H A;  4MTV A;  1JNT A;  3WIJ A;  4KQZ A;  2G8Z A;  2G41 A;  3WQV A;  3OOB A;  4U86 A;  2M08 A;  5GPG A;  4WKH A;  3TC5 A;  3ARW A;  3RFW A;  2YSF A;  2RUD A;  2PV2 A;  4ODL A;  1E44 A;  4J4N A;  5HT1 A;  1D6O A;  4JFI A;  2ITK A;  2M8J A;  1LQ0 A;  2FKE A;  3LKX B;  1IX5 A;  2DSW A;  1HKM A;  2A3C A;  1NWS A;  5DIU A;  3BXW A;  3LKX A;  1Y0O A;  4DRJ A;  3CH9 A;  4P8W A;  4PTM A;  4S3K A;  1HKK A;  3O5I A;  1PIN A;  1E6N A;  5E5W A;  1VF8 A;  2YSG A;  4ODK A;  1LL6 A;  3KAG A;  1LG1 A;  3LUO A;  2DT1 A;  3GU0 A;  3B8S A;  1TFV A;  4ML4 A;  1HKJ A;  1ZB5 A;  4TW7 A;  4DH0 A;  1NMW A;  2XP6 A;  1UR8 A;  2ZR6 A;  2Y8N B;  4U85 A;  1X6N A;  1FJD A;  1ROU A;  3WH0 A;  3O5P A;  1E15 A;  2MF9 A;  1QZ2 A;  5DEZ A;  5B8I C;  3O5Q A;  2O92 A;  5HTG A;  3CHD A;  3ART A;  1WAW A;  4DRN A;  2DG4 A;  3UI5 A;  3W4R A;  4ZS6 A;  4DRM A;  1XHG A;  4U84 A;  3CHF A;  3O5M A;  2ESC A;  4ODR A;  1TK7 A;  2KI3 A;  3PQH A;  3NI6 A;  3UI4 A;  1W1V A;  3GPK A;  2L2S A;  4URI A;  3O5R A;  4ZPV R;  3RM4 A;  1EG4 A;  2K8I A;  2A3E A;  3ALF A;  3PRA A;  4ODN A;  3JYM A;  3WQW A;  1OGG A;  1FKR A;  1BKF A;  2XPA A;  4G2P A;  2IF4 A;  1FKB A;  1LJY A;  1W9P A;  3MDY B;  1D2K A;  1K9Q A;  1JVW A;  4AY1 A;  2BA1 A;  1GRJ A;  4W5U A;  1J6Y A;  3AQU A;  4Z2L A;  4IPX A;  2JXW A;  1NWU A;  3B9D A;  3FSB A;  1NWR A;  2MLY A;  1NWT A;  4IQC A;  1FKT A;  3B9A A;  4NNR A;  2ZR5 A;  3FY1 A;  5E66 A;  4GIV A;  1HJV A;  4ZPT R;  3I6C A;  1T11 A;  3WL1 A;  2WLY A;  4QT2 A;  2XP9 A;  3CGN A;  1I5H W;  1ZK6 A;  4DRP A;  2ZAJ A;  2DSZ A;  3ARQ A;  1EYM A;  1U79 A;  3B9E A;  4JFJ A;  5HKG A;  4A0U A;  4ITZ A;  2QRV A;  2KXQ A;  4DZ2 A;  1ZL1 A;  3ALG A;  4WKA A;  1JNE A;  1W9U A;  1O6I A;  1WNO A;  2YBT A;  2PPO A;  1FKF A;  3M7N A;  1GUV A;  4NSB A;  3RGC A;  1Q6I A;  4R0X A;  2JZV A;  3ARP A;  2WAE A;  1FFR A;  2ZQT A;  1L1P A;  2DK7 A;  4KR0 B;  3FSC A;  4ODM A;  1FKG A;  2FDM A;  1FKH A;  4N19 A; 
#chains in the Genus database with same CATH homology
 4LAY A;  2XP3 A;  1W9V A;  4Z2I A;  5HWC A;  4QIB A;  2MLZ A;  4R5E A;  2DPE A;  3O5O A;  2YBU A;  1YAT A;  1Q6H A;  5E65 A;  1JNS A;  2XP4 A;  2DJY A;  3UQI A;  5D75 A;  3TDB A;  1X6L A;  4LAW A;  4L72 B;  1JND A;  3AS3 A;  2M3O W;  2RUQ A;  2F4E A;  2KFW A;  1E6Z A;  2F2D A;  3O5D A;  1FKK A;  4XAK A;  5I98 A;  4IQ2 A;  2PV1 A;  3CGM A;  3KZ7 A;  1OWQ A;  4DWS A;  3WD0 A;  3MCB A;  2DK1 A;  2UZ5 A;  2KR7 A;  2PV3 A;  3B7X A;  2IUZ A;  1GPF A;  3MCB B;  1D7I A;  2EZ5 W;  1J4H A;  3UF8 A;  2WLZ A;  1Q1C A;  4TW6 A;  4MNK A;  2DMV A;  5AHT A;  2DWV A;  2KO7 A;  1P5Q A;  3PRB A;  3ARO A;  1ZBC A;  4ZPW R;  3CHC A;  1GOI A;  1EIB A;  3IK8 A;  2F21 A;  2D9F A;  1D7J A;  4WJX A;  1FKJ A;  3PR9 A;  2A3B A;  4DRI A;  2WK2 A;  2JV4 A;  4G50 A;  2YAJ B;  3G6M A;  2M8I A;  3LE4 A;  4FAP A;  1A7X A;  1WB0 A;  5E62 A;  5HUA A;  3ARZ A;  1EDQ A;  2OLH A;  3IKG A;  3NRK A;  4ODO A;  1K9T A;  1NMV A;  2O9O A;  2E45 A;  4P8U A;  3O5J A;  1FFQ A;  3FS8 A;  1LL7 A;  1LG2 A;  1F40 A;  3CZ8 A;  1ZBK A;  4W9P A;  4J4O A;  1ZBW A;  1J4I A;  4IT6 A;  3ARR A;  3QOK A;  1M5Y A;  5HW6 A;  3IKD A;  3ODK A;  3VAW A;  4MSP A;  4DWS C;  3JXV A;  1SYT A;  2KE0 A;  3O5K A;  4TNS A;  2JX8 A;  2PI6 A;  1FD9 A;  5E64 A;  3KAH A;  4DIP A;  4Z2K A;  2VN1 A;  1F8A B;  5HWB A;  4S3J A;  1EG3 A;  1KFW A;  3CHE A;  3ARX A;  4Z2J A;  3MQH A;  1NH6 A;  4ODQ A;  5J6E A;  1LL4 A;  1E6P A;  2M1I A;  5U47 A;  3WD1 A;  4MNM A;  4WIW A;  1CTN A;  1OGB A;  2JMF A;  3O5F A;  1EQ3 A;  4Z2H A;  1YW5 A;  1N1A A;  1HJX A;  1TCO C;  2ZQS A;  5DIT A;  4JFM A;  3TCZ A;  1NSG A;  4WK9 A;  4MNJ A;  5BXJ A;  3WD4 A;  4HBO A;  1B6C A;  4IT4 A;  2M2A A;  2DT3 A;  2DT0 A;  4GGQ A;  1HKI A;  4LAX A;  4DZ3 A;  3O5L A;  4O2T A;  1JMQ A;  2DSV A;  3O5G A;  2QF8 A;  5HW7 A;  3AS1 A;  3M85 A;  2DSU A;  2N87 A;  4NZC A;  5GQB A;  1WR7 A;  4P8X A;  1RP5 A;  5DF0 A;  3ARY A;  3FAP A;  2Y78 A;  5JH8 A;  1SR0 A;  4MNL A;  4Q7N A;  3ARS A;  2RUR A;  1W1P A;  3UI6 A;  2RQS A;  3AS0 A;  3WL0 A;  4DRK A;  2AOS A;  2RSE A;  1KT0 A;  1ROT A;  3RM9 A;  4REX A;  4JYS A;  4HBE A;  1FLC A;  4DWS B;  1HXV A;  4TW8 A;  2WAD A;  2PPP A;  4DRO A;  2MDI A;  2YSB A;  5HW8 A;  2FAP A;  2L4J A;  1TR8 A;  3RM8 A;  4FN2 A;  4A0T A;  1C9H A;  2LJ4 A;  1PBK A;  3PA7 A;  5GPR A;  2ZR4 A;  2MPH A;  3RME A;  4HAR A;  3WKZ A;  3WD2 A;  1HJW A;  1J4R A;  3G6L A;  1K9R A;  1E9L A;  1WMV A;  2DG9 A;  1KT1 A;  3PRD A;  4W9O A;  1BL4 A;  4LGX A;  4W9Q A;  2XP7 A;  2MNT A;  2MLX A;  4BF8 A;  3KCE A;  4DRH A;  3KAI A;  1FKD A;  2PPN A;  4C02 B;  4P8V A;  2ZQV A;  1W1T A;  1FKI A;  2LAJ A;  3KAB A;  4MPK A;  3KAD A;  2ZQU A;  3WD3 A;  2VCD A;  4DWS D;  2XPB A;  3O5E A;  1ITX A;  1FKL A;  4QZV B;  1XRV A;  2XP8 A;  2RUC A;  1FAP A;  2LGO A;  1D7H A;  1QPF A;  2OWO A;  1H0I A;  5DO2 A;  4E5R A;  4TX0 A;  1ZCN A;  3UQB A;  2B31 A;  4L3N A;  4QT3 A;  1W1Y A;  4JFK A;  2AWG A;  1UR9 A;  4WKF A;  3KAF A;  3UQA A;  4Z2G A;  5DIV A;  3ARU A;  1EHN A;  2RE3 A;  3FXY A;  2YSH A;  4MGV A;  1RD6 A;  1ZBV A;  4DT4 A;  4ODP A;  3MQG A;  5CQ2 A;  4DRQ A;  3ARV A;  4TYO A;  2XP5 A;  2Q5A A;  2KGJ A;  3H9R B;  2DG3 A;  4JFL A;  3L4H A;  2WM0 A;  3KAC A;  1E6R A;  2DT2 A;  2YSI A;  2A3A A;  1W26 A;  3AS2 A;  4LAV A;  3NTP A;  3JYJ A;  4MAV A;  2PBC A;  1QPL A;  4Q22 A;  3OA5 A;  1Q6U A;  3IHZ A;  3EY6 A;  3CNG A;  5HBF A;  4GLX A;  1H0G A;  2LKN A;  2LPV A;  1ZU8 A;  2OFN A;  1O6W A;  1FKS A;  1R9H A;  4MTV A;  1JNT A;  3WIJ A;  4KQZ A;  2G8Z A;  2G41 A;  3WQV A;  3OOB A;  4U86 A;  2M08 A;  5GPG A;  4WKH A;  3TC5 A;  3ARW A;  3RFW A;  2YSF A;  2RUD A;  2PV2 A;  4ODL A;  4J4N A;  5HT1 A;  1D6O A;  4JFI A;  2ITK A;  2M8J A;  1LQ0 A;  2FKE A;  3LKX B;  1IX5 A;  2DSW A;  1HKM A;  2A3C A;  1NWS A;  5DIU A;  3BXW A;  3LKX A;  1Y0O A;  4DRJ A;  3CH9 A;  4P8W A;  4PTM A;  4S3K A;  1HKK A;  3O5I A;  1PIN A;  1E6N A;  5E5W A;  1VF8 A;  2YSG A;  4ODK A;  1LL6 A;  3KAG A;  1LG1 A;  3LUO A;  2DT1 A;  3B8S A;  1TFV A;  4ML4 A;  1HKJ A;  1ZB5 A;  4TW7 A;  4DH0 A;  1NMW A;  2XP6 A;  1UR8 A;  2ZR6 A;  2Y8N B;  4U85 A;  1X6N A;  1FJD A;  1ROU A;  3WH0 A;  3O5P A;  1E15 A;  2MF9 A;  1QZ2 A;  5DEZ A;  5B8I C;  3O5Q A;  2O92 A;  5HTG A;  3CHD A;  3ART A;  1WAW A;  4DRN A;  2DG4 A;  3UI5 A;  3W4R A;  4ZS6 A;  4DRM A;  1XHG A;  4U84 A;  3CHF A;  3O5M A;  2ESC A;  4ODR A;  1TK7 A;  2KI3 A;  3PQH A;  3NI6 A;  3UI4 A;  1W1V A;  3GPK A;  2L2S A;  4URI A;  3O5R A;  4ZPV R;  3RM4 A;  1EG4 A;  2K8I A;  2A3E A;  3ALF A;  3PRA A;  4ODN A;  3JYM A;  3WQW A;  1OGG A;  1FKR A;  1BKF A;  2XPA A;  4G2P A;  2IF4 A;  1FKB A;  1LJY A;  1W9P A;  3MDY B;  1D2K A;  1K9Q A;  1JVW A;  4AY1 A;  2BA1 A;  4W5U A;  1J6Y A;  3AQU A;  4Z2L A;  4IPX A;  2JXW A;  1NWU A;  3B9D A;  3FSB A;  1NWR A;  2MLY A;  1NWT A;  4IQC A;  1FKT A;  3B9A A;  4NNR A;  2ZR5 A;  3FY1 A;  5E66 A;  4GIV A;  1HJV A;  4ZPT R;  3I6C A;  1T11 A;  3WL1 A;  2WLY A;  4QT2 A;  2XP9 A;  3CGN A;  1I5H W;  1ZK6 A;  4DRP A;  2ZAJ A;  2DSZ A;  3ARQ A;  1EYM A;  1U79 A;  3B9E A;  4JFJ A;  5HKG A;  4A0U A;  4ITZ A;  2QRV A;  2KXQ A;  4DZ2 A;  1ZL1 A;  3ALG A;  4WKA A;  1JNE A;  1W9U A;  1O6I A;  1WNO A;  2YBT A;  2PPO A;  1FKF A;  3M7N A;  1GUV A;  4NSB A;  3RGC A;  1Q6I A;  4R0X A;  2JZV A;  3ARP A;  2WAE A;  1FFR A;  2ZQT A;  1L1P A;  2DK7 A;  4KR0 B;  3FSC A;  4ODM A;  1FKG A;  2FDM A;  1FKH A;  4N19 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...