2XP3A

Discovery of cell-active phenyl-imidazole pin1 inhibitors by structure-guided fragment evolution
Total Genus 46
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
46
sequence length
157
structure length
145
Chain Sequence
LPPGWEKAMSRSSGRVYYFNHITNASQWERPSEPARVRCSHLLVKHSQSRRPSSWRQEKITRTKEEALELINGYIQKIKSGEEDFESLASQFSDCSSAKARGDLGAFSRGQMQKPFEDASFALRTGEMSGPVFTDSGIHIILRTE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Isomerase
molecule keywords PEPTIDYL-PROLYL CIS-TRANS ISOMERASE NIMA-INTERACTING 1
publication title Discovery of Cell-Active Phenyl-Imidazole Pin1 Inhibitors by Structure-Guided Fragment Evolution.
pubmed doi rcsb
source organism Homo sapiens
total genus 46
structure length 145
sequence length 157
ec nomenclature ec 5.2.1.8: Peptidylprolyl isomerase.
pdb deposition date 2010-08-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00397 WW WW domain
A PF00639 Rotamase PPIC-type PPIASE domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.20.70.10 Mainly Beta Single Sheet Ubiquitin Ligase Nedd4; Chain: W; Ubiquitin Ligase Nedd4; Chain: W; 2xp3A01
3.10.50.40 Alpha Beta Roll Chitinase A; domain 3 Chitinase A; domain 3 2xp3A02
1U79A 5D75A 2MLXA 2XP6A 3M7NA 1D6OA 4DZ2A 4BF8A 2L2SA 4ODPA 4TX0A 3O5KA 3O5MA 1ZCNA 5HUAA 2ZQTA 2LAJA 2MLYA 2JV4A 2EZ5W 1W26A 1PBKA 4DROA 1QZ2A 4G2PA 1FKHA 4DRMA 2DG9A 1NMWA 3UI4A 5HKGA 1WMVA 1T11A 4DRHA 1B6CA 2JX8A 3O5JA 5HW8A 1WR7A 1ROTA 1KT0A 4GIVA 2UZ5A 4REXA 3IK8A 5HWCA 3VAWA 2ZQVA 2XP7A 1FKIA 3O5RA 4ODRA 3H9RB 1JVWA 1K9RA 3KAIA 1Q6IA 3CNGA 1J4RA 2RUQA 1FKTA 1QPFA 4DRPA 2MF9A 1BKFA 5BXJA 3UQIA 2ITKA 4DRJA 1BL4A 2K8IA 4O2TA 4ODLA 3FAPA 3PA7A 5GPGA 5HW7A 1FKJA 3IKGA 4JYSA 2L4JA 4LAXA 4DRIA 4W9QA 2Y78A 3EY6A 5HTGA 4E5RA 1KT1A 4QIBA 4LAWA 2MPHA 2XP4A 2ZR6A 3RGCA 2MDIA 4C02B 1J4HA 4IQ2A 3NTPA 2OFNA 4G50A 2JZVA 1Q6UA 4JFMA 2YSHA 3CGNA 2AWGA 1FKKA 1Q1CA 1FKSA 3WH0A 3O5FA 2LKNA 3NI6A 1Q6HA 4JFKA 4LAVA 2FKEA 3PRDA 5AHTA 2FAPA 2DK7A 2ZAJA 3JXVA 1K9QA 5I98A 1NSGA 2XP8A 4DZ3A 1M5YA 4TW6A 2PV2A 2RE3A 3O5DA 3B7XA 1J6YA 3RFWA 1FAPA 3TDBA 2D9FA 2PV1A 3O5GA 4TYOA 2RSEA 2XP5A 1N1AA 4U85A 4DH0A 4ITZA 4DRNA 3UQAA 4J4OA 1F40A 3UI6A 5CQ2A 1D7JA 2YSBA 1R9HA 3TC5A 3OOBA 4MSPA 2F21A 3LE4A 1JMQA 1P5QA 3KZ7A 1QPLA 2JMFA 1JNTA 1O6WA 3IHZA 2KR7A 1FD9A 4J4NA 2YSIA 2VN1A 3O5PA 3UI5A 2KFWA 3UF8A 4GGQA 1FKFA 4TW7A 4DIPA 2MNTA 1I5HW 4DT4A 1FKRA 2DG4A 1FJDA 3I6CA 2KO7A 2RUDA 4R0XA 2MLZA 2ZQSA 2KI3A 1F8AB 4JFLA 3JYJA 4TW8A 4N19A 1PINA 2RQSA 4ODOA 2PV3A 1ZK6A 1EQ3A 2XP3A 1FKDA 1L1PA 3O5EA 4QT2A 2BA1A 4QT3A 4TNSA 2JXWA 2XPBA 1D7IA 2M8IA 4NNRA 4ODKA 3IKDA 2PBCA 2DMVA 3UQBA 4IQCA 2ZQUA 2ZR5A 4MGVA 2KE0A 5HT1A 3O5QA 4ODQA 4U86A 4ODMA 1TK7A 2M3OW 3ODKA 2XP9A 3O5OA 2DWVA 3JYMA 2XPAA 2LJ4A 4JFJA 4W9OA 1A7XA 3NRKA 4DRKA 4FAPA 5DIUA 1NMVA 1FKBA 1J4IA 1YATA 3KADA 2YSGA 3KCEA 3GPKA 2Q5AA 3MDYB 2M08A 1HXVA 5HW6A 3M85A 2KGJA 4FN2A 2VCDA 4DRQA 2M1IA 2RUCA 3CGMA 1JNSA 3O5LA 3L4HA 2YSFA 1EYMA 3KABA 1FKLA 2LGOA 5DIVA 2F4EA 3O5IA 2PPPA 2M2AA 2N87A 2IF4A 3KAHA 1ROUA 2E45A 1TCOC 3KAFA 2M8JA 5DITA 2RURA 4LAYA 2DJYA 3LUOA 5J6EA 1FKGA 2DK1A 5B8IC 1YW5A 5HWBA 1C9HA 3PRBA 2ZR4A 1EG3A 4IPXA 2DG3A 2LPVA 2PPOA 3KACA 2PPNA 4W9PA 2KXQA 1Y0OA 3KAGA 4U84A 2F2DA 1D7HA 4ODNA 1EG4A 3TCZA 4JFIA
chains in the Genus database with same CATH superfamily
3LKXB 1U79A 5D75A 1LG2A 2MLXA 2XP6A 1E15A 3M7NA 1D6OA 5DF0A 4DZ2A 4BF8A 3EIPA 2B31A 2L2SA 4ODPA 4TX0A 3O5KA 4ZPTR 1HKJA 3O5MA 1ZCNA 5HUAA 2ZQTA 3FSBA 1H0IA 2LAJA 2A3CA 2MLYA 2JV4A 2EZ5W 1W26A 1PBKA 3ARUA 4DROA 1QZ2A 2WLYA 3ARRA 2YBUA 4G2PA 3MQGA 3CH9A 4S3JA 1FKHA 1WB0A 4DRMA 4Z2IA 2DG9A 1NMWA 3QOKA 4Z2KA 1W9UA 3UI4A 3B9EA 4S3KA 5HKGA 1WMVA 1T11A 4DRHA 3WD1A 1B6CA 1XHGA 2JX8A 3O5JA 5HW8A 1WR7A 1ROTA 1KT0A 4Z2HA 4GIVA 1FFQA 2UZ5A 4REXA 1TR8A 3IK8A 5HWCA 3VAWA 2ZQVA 1ZBWA 3AROA 2XP7A 3MCBA 1FKIA 3O5RA 1K9TA 1LL6A 4MTVA 3CZ8A 2WM0A 4ODRA 5E66A 4DWSD 3H9RB 1GOIA 1HKKA 1JVWA 1K9RA 3KAIA 1Q6IA 3CNGA 5U47A 5E65A 1J4RA 1H0GA 2A3EA 4WKFA 3WD4A 1LL7A 2RUQA 1FKTA 1QPFA 4DRPA 2MF9A 3ARYA 3BMBA 1BKFA 4P8WA 5BXJA 3UQIA 4MNLA 2ITKA 1E6RA 1RP5A 2F23A 4DRJA 1BL4A 2K8IA 4O2TA 3FXYA 1E6NA 4QZVB 4DWSC 4ODLA 1WAWA 3FAPA 2A3AA 3PA7A 5GPGA 4KR0B 5HW7A 1FKJA 4ZPWR 3IKGA 4JYSA 2L4JA 4LAXA 4DRIA 4W9QA 4R5EA 1ZB5A 1TFVA 2Y78A 3EY6A 1UR8A 5HTGA 1W1PA 4E5RA 1KT1A 4UDMA 4MPKA 4QIBA 2DSUA 4LAWA 2MPHA 2XP4A 2ZR6A 3RGCA 1EDQA 4L72B 4W5UA 2MDIA 3FSCA 1FFRA 1J4HA 4C02B 4IQ2A 3NTPA 4HARA 1E6ZA 2OFNA 4WKAA 4G50A 1W9VA 2JZVA 1Q6UA 4JFMA 3G6MA 2YSHA 3CGNA 2AWGA 1FKKA 1E44A 1Q1CA 4ML4A 1FKSA 3WH0A 4NZCA 1HJWA 1LQ0A 3O5FA 1JNEA 2LKNA 2WADA 1W1TA 1HJVA 3RMEA 3RM9A 3NI6A 1Q6HA 4JFKA 4LAVA 2FKEA 3PRDA 5AHTA 1W9PA 4DWSB 3ALFA 2FAPA 3CHCA 2DK7A 4HBEA 2ZAJA 3JXVA 1K9QA 5I98A 3GTYX 3WIJA 4Q7NA 1NSGA 2XP8A 4DZ3A 1M5YA 4TW6A 2PV2A 1FLCA 2RE3A 3O5DA 3B7XA 4WK9A 1J6YA 1GUVA 4XAKA 1ZBKA 3RFWA 4NSBA 4P8VA 4AY1A 1FAPA 3TDBA 3WD2A 2D9FA 2PV1A 3O5GA 1W1VA 1LJYA 1ZBVA 3PR9A 4TYOA 2O9OA 2RSEA 2DT1A 1RD6A 2XP5A 3LKXA 1N1AA 1JNDA 1D2KA 4P8XA 4U85A 4DH0A 2WK2A 4ITZA 4DRNA 3UQAA 3ARPA 4J4OA 3ARQA 1F40A 5CQ2A 3UI6A 1D7JA 4MNMA 1EHNA 2YSBA 1R9HA 4A0TA 4Q22A 3WL0A 3TC5A 3OOBA 4MSPA 2F21A 3LE4A 1JMQA 1P5QA 3KZ7A 1QPLA 3WL1A 2JMFA 2DSZA 1JNTA 1O6WA 1E6PA 4ZPVR 3IHZA 2KR7A 3WQWA 4ZS6A 3AQUA 3ARVA 3PQHA 1FD9A 4J4NA 2YSIA 1GPFA 2VN1A 3O5PA 1HKMA 3UI5A 2KFWA 3UF8A 4GGQA 1FKFA 4TW7A 4DIPA 3ARWA 4MNKA 3ARXA 2MNTA 1VF8A 2PN0A 5DEZA 3AS1A 3AS3A 3AS2A 5GQBA 1ITXA 1I5HW 1W1YA 4DT4A 1FKRA 2DG4A 1FJDA 3RM8A 2DT0A 3I6CA 2P4VA 2KO7A 4WIWA 2RUDA 3OA5A 4R0XA 2OLHA 5E62A 2MLZA 4Z2JA 2FDMA 2ZQSA 2KI3A 1F8AB 1ZBCA 4JFLA 5HBFA 1HJXA 1LL4A 3JYJA 4TW8A 3WD3A 1JCHB 4N19A 1PINA 2RQSA 4ODOA 3B8SA 2PV3A 1ZK6A 1EQ3A 4IT6A 2XP3A 2Y8NB 1NH6A 3WKZA 1FKDA 3ARSA 3BXWA 1L1PA 2G41A 3O5EA 4QT2A 2YAJB 1X6NA 2BA1A 3ARZA 4QT3A 2JXWA 1CTNA 4TNSA 2XPBA 1D7IA 1ZU8A 2M8IA 4NNRA 4ODKA 2DSWA 3IKDA 4Z2GA 1OGGA 1NWUA 1NWRA 4IT4A 2PBCA 2DMVA 2DT3A 3UQBA 2DSVA 4IQCA 2ZQUA 2ZR5A 4MGVA 2G8ZA 2KE0A 2ESCA 3MCBB 5HT1A 3O5QA 4ODQA 3AS0A 4U86A 4ODMA 3FS8A 1TK7A 1XRVA 2M3OW 3ODKA 2XP9A 3O5OA 2DWVA 3JYMA 3W4RA 2XPAA 2LJ4A 2B5UB 4JFJA 3CHFA 4W9OA 1A7XA 3NRKA 4DRKA 4FAPA 5DIUA 2DPEA 1NMVA 2WLZA 1FKBA 1J4IA 1YATA 3KADA 5GPRA 1OGBA 2YSGA 3ARTA 3KCEA 3GPKA 4P8UA 2Q5AA 5E5WA 3MDYB 2QRVA 3B9DA 2M08A 1HXVA 1IX5A 5HW6A 2OWOA 3M85A 1GRJA 2KGJA 4FN2A 4MNJA 4PTMA 1HKIA 2VCDA 4DRQA 2M1IA 2RUCA 3CGMA 2YBTA 1JNSA 5E64A 3O5LA 4WJXA 3FY1A 3L4HA 2YSFA 2DT2A 1NWSA 1EYMA 4URIA 3KABA 4KQZA 1FKLA 2LGOA 1LG1A 5DIVA 3RM4A 2F4EA 1E9LA 3O5IA 2O92A 2PPPA 2IUZA 2M2AA 2N87A 5DO2A 5JH8A 1UR9A 2IF4A 3KAHA 1ROUA 1SYTA 4DWSA 2E45A 1TCOC 3GU0A 4HBOA 3KAFA 2M8JA 1NWTA 5DITA 2WAEA 2RURA 4Z2LA 3MQHA 3CHDA 4LAYA 2DJYA 1WNOA 3LUOA 2A3BA 3B9AA 5J6EA 3G6LA 1FKGA 1ZL1A 2DK1A 4MAVA 5B8IC 1YW5A 4WKHA 5HWBA 1C9HA 3WD0A 3PRBA 4GLXA 2ZR4A 1EG3A 2ETNA 4IPXA 3PRAA 4LGXA 2DG3A 4L3NA 1X6LA 2LPVA 2PI6A 1SR0A 2PPOA 3ALGA 3KACA 4A0UA 3CHEA 2PPNA 4W9PA 2KXQA 1Y0OA 1O6IA 3KAGA 1OWQA 2EULA 2AOSA 1EIBA 4U84A 3WQVA 2F2DA 1D7HA 4ODNA 1EG4A 1KFWA 2QF8A 3TCZA 4JFIA
chains in the Genus database with same CATH topology
3LKXB 1U79A 5D75A 1LG2A 2MLXA 2XP6A 1E15A 3M7NA 1D6OA 5DF0A 4DZ2A 4BF8A 2B31A 2L2SA 4ODPA 4TX0A 3O5KA 4ZPTR 1HKJA 3O5MA 1ZCNA 5HUAA 2ZQTA 3FSBA 1H0IA 2LAJA 2A3CA 2MLYA 2JV4A 2EZ5W 1W26A 1PBKA 3ARUA 4DROA 1QZ2A 2WLYA 3ARRA 2YBUA 4G2PA 3MQGA 3CH9A 4S3JA 1FKHA 1WB0A 4DRMA 4Z2IA 2DG9A 1NMWA 3QOKA 4Z2KA 1W9UA 3UI4A 3B9EA 4S3KA 5HKGA 1WMVA 1T11A 4DRHA 3WD1A 1B6CA 1XHGA 2JX8A 3O5JA 5HW8A 1WR7A 1ROTA 1KT0A 4Z2HA 4GIVA 1FFQA 2UZ5A 4REXA 1TR8A 3IK8A 5HWCA 3VAWA 2ZQVA 1ZBWA 3AROA 2XP7A 3MCBA 1FKIA 3O5RA 1K9TA 1LL6A 4MTVA 3CZ8A 2WM0A 4ODRA 5E66A 4DWSD 3H9RB 1GOIA 1HKKA 1JVWA 1K9RA 3KAIA 1Q6IA 3CNGA 5U47A 5E65A 1J4RA 1H0GA 2A3EA 4WKFA 3WD4A 1LL7A 2RUQA 1FKTA 1QPFA 4DRPA 2MF9A 3ARYA 1BKFA 4P8WA 5BXJA 3UQIA 4MNLA 2ITKA 1E6RA 1RP5A 4DRJA 1BL4A 2K8IA 4O2TA 3FXYA 1E6NA 4QZVB 4DWSC 4ODLA 1WAWA 3FAPA 2A3AA 3PA7A 5GPGA 4KR0B 5HW7A 1FKJA 4ZPWR 3IKGA 4JYSA 2L4JA 4LAXA 4DRIA 4W9QA 4R5EA 1ZB5A 1TFVA 2Y78A 3EY6A 1UR8A 5HTGA 1W1PA 4E5RA 1KT1A 4MPKA 4QIBA 2DSUA 4LAWA 2MPHA 2XP4A 2ZR6A 3RGCA 1EDQA 4L72B 4W5UA 2MDIA 3FSCA 1FFRA 1J4HA 4C02B 4IQ2A 3NTPA 4HARA 1E6ZA 2OFNA 4WKAA 4G50A 1W9VA 2JZVA 1Q6UA 4JFMA 3G6MA 2YSHA 3CGNA 2AWGA 1FKKA 1Q1CA 4ML4A 1FKSA 3WH0A 4NZCA 1HJWA 1LQ0A 3O5FA 1JNEA 2LKNA 2WADA 1W1TA 1HJVA 3RMEA 3RM9A 3NI6A 1Q6HA 4JFKA 4LAVA 2FKEA 3PRDA 5AHTA 1W9PA 4DWSB 3ALFA 2FAPA 3CHCA 2DK7A 4HBEA 2ZAJA 3JXVA 1K9QA 5I98A 3WIJA 4Q7NA 1NSGA 2XP8A 4DZ3A 1M5YA 4TW6A 2PV2A 1FLCA 2RE3A 3O5DA 3B7XA 4WK9A 1J6YA 1GUVA 4XAKA 1ZBKA 3RFWA 4NSBA 4P8VA 4AY1A 1FAPA 3TDBA 3WD2A 2D9FA 2PV1A 3O5GA 1W1VA 1LJYA 1ZBVA 3PR9A 4TYOA 2O9OA 2RSEA 2DT1A 1RD6A 2XP5A 3LKXA 1N1AA 1JNDA 1D2KA 4P8XA 4U85A 4DH0A 2WK2A 4ITZA 4DRNA 3UQAA 3ARPA 4J4OA 3ARQA 1F40A 5CQ2A 3UI6A 1D7JA 4MNMA 1EHNA 2YSBA 1R9HA 4A0TA 4Q22A 3WL0A 3TC5A 3OOBA 4MSPA 2F21A 3LE4A 1JMQA 1P5QA 3KZ7A 1QPLA 3WL1A 2JMFA 2DSZA 1JNTA 1O6WA 1E6PA 4ZPVR 3IHZA 2KR7A 3WQWA 4ZS6A 3AQUA 3ARVA 3PQHA 1FD9A 4J4NA 2YSIA 1GPFA 2VN1A 3O5PA 1HKMA 3UI5A 2KFWA 3UF8A 4GGQA 1FKFA 4TW7A 4DIPA 3ARWA 4MNKA 3ARXA 2MNTA 1VF8A 5DEZA 3AS1A 3AS3A 3AS2A 5GQBA 1ITXA 1I5HW 1W1YA 4DT4A 1FKRA 2DG4A 1FJDA 3RM8A 2DT0A 3I6CA 4WIWA 2KO7A 2RUDA 3OA5A 4R0XA 2OLHA 5E62A 2MLZA 4Z2JA 2FDMA 2ZQSA 2KI3A 1F8AB 1ZBCA 4JFLA 5HBFA 1HJXA 1LL4A 3JYJA 4TW8A 3WD3A 4N19A 1PINA 2RQSA 4ODOA 3B8SA 2PV3A 1ZK6A 1EQ3A 4IT6A 2XP3A 2Y8NB 1NH6A 3WKZA 1FKDA 3ARSA 3BXWA 1L1PA 2G41A 3O5EA 4QT2A 2YAJB 1X6NA 2BA1A 3ARZA 4QT3A 2JXWA 1CTNA 4TNSA 2XPBA 1D7IA 1ZU8A 2M8IA 4NNRA 4ODKA 2DSWA 3IKDA 4Z2GA 1OGGA 1NWUA 1NWRA 4IT4A 2PBCA 2DMVA 2DT3A 3UQBA 2DSVA 4IQCA 2ZQUA 2ZR5A 4MGVA 2G8ZA 2KE0A 2ESCA 3MCBB 5HT1A 3O5QA 4ODQA 3AS0A 4U86A 4ODMA 3FS8A 1TK7A 1XRVA 2M3OW 3ODKA 2XP9A 3O5OA 2DWVA 3JYMA 3W4RA 2XPAA 2LJ4A 4JFJA 3CHFA 4W9OA 1A7XA 3NRKA 4DRKA 4FAPA 5DIUA 2DPEA 1NMVA 2WLZA 1FKBA 1J4IA 1YATA 3KADA 5GPRA 1OGBA 2YSGA 3ARTA 3KCEA 3GPKA 4P8UA 2Q5AA 5E5WA 3MDYB 2QRVA 3B9DA 2M08A 1HXVA 1IX5A 5HW6A 2OWOA 3M85A 2KGJA 4FN2A 4MNJA 4PTMA 1HKIA 2VCDA 4DRQA 2M1IA 2RUCA 3CGMA 2YBTA 1JNSA 5E64A 3O5LA 4WJXA 3FY1A 3L4HA 2YSFA 2DT2A 1NWSA 1EYMA 4URIA 3KABA 4KQZA 1FKLA 2LGOA 1LG1A 5DIVA 3RM4A 2F4EA 1E9LA 3O5IA 2O92A 2PPPA 2IUZA 2M2AA 2N87A 5DO2A 5JH8A 1UR9A 2IF4A 3KAHA 1ROUA 1SYTA 4DWSA 2E45A 1TCOC 4HBOA 3KAFA 2M8JA 1NWTA 5DITA 2WAEA 2RURA 4Z2LA 3MQHA 3CHDA 4LAYA 2DJYA 1WNOA 3LUOA 2A3BA 3B9AA 5J6EA 3G6LA 1FKGA 1ZL1A 2DK1A 4MAVA 5B8IC 1YW5A 4WKHA 5HWBA 1C9HA 3WD0A 3PRBA 4GLXA 2ZR4A 1EG3A 4IPXA 4LGXA 3PRAA 2DG3A 4L3NA 1X6LA 2LPVA 2PI6A 1SR0A 2PPOA 3ALGA 3KACA 4A0UA 3CHEA 2PPNA 4W9PA 2KXQA 1Y0OA 1O6IA 3KAGA 1OWQA 2AOSA 1EIBA 4U84A 3WQVA 2F2DA 1D7HA 4ODNA 1EG4A 1KFWA 2QF8A 3TCZA 4JFIA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1U79 A;  5D75 A;  2MLX A;  2XP6 A;  3M7N A;  1D6O A;  4DZ2 A;  4BF8 A;  2L2S A;  4ODP A;  4TX0 A;  3O5K A;  3O5M A;  1ZCN A;  5HUA A;  2ZQT A;  2LAJ A;  2MLY A;  2JV4 A;  2EZ5 W;  1W26 A;  1PBK A;  4DRO A;  1QZ2 A;  4G2P A;  1FKH A;  4DRM A;  2DG9 A;  1NMW A;  3UI4 A;  5HKG A;  1WMV A;  1T11 A;  4DRH A;  1B6C A;  2JX8 A;  3O5J A;  5HW8 A;  1WR7 A;  1ROT A;  1KT0 A;  4GIV A;  2UZ5 A;  4REX A;  3IK8 A;  5HWC A;  3VAW A;  2ZQV A;  2XP7 A;  1FKI A;  3O5R A;  4ODR A;  3H9R B;  1JVW A;  1K9R A;  3KAI A;  1Q6I A;  3CNG A;  1J4R A;  2RUQ A;  1FKT A;  1QPF A;  4DRP A;  2MF9 A;  1BKF A;  5BXJ A;  3UQI A;  2ITK A;  4DRJ A;  1BL4 A;  2K8I A;  4O2T A;  4ODL A;  3FAP A;  3PA7 A;  5GPG A;  5HW7 A;  1FKJ A;  3IKG A;  4JYS A;  2L4J A;  4LAX A;  4DRI A;  4W9Q A;  2Y78 A;  3EY6 A;  5HTG A;  4E5R A;  1KT1 A;  4QIB A;  4LAW A;  2MPH A;  2XP4 A;  2ZR6 A;  3RGC A;  2MDI A;  4C02 B;  1J4H A;  4IQ2 A;  3NTP A;  2OFN A;  4G50 A;  2JZV A;  1Q6U A;  4JFM A;  2YSH A;  3CGN A;  2AWG A;  1FKK A;  1Q1C A;  1FKS A;  3WH0 A;  3O5F A;  2LKN A;  3NI6 A;  1Q6H A;  4JFK A;  4LAV A;  2FKE A;  3PRD A;  5AHT A;  2FAP A;  2DK7 A;  2ZAJ A;  3JXV A;  1K9Q A;  5I98 A;  1NSG A;  2XP8 A;  4DZ3 A;  1M5Y A;  4TW6 A;  2PV2 A;  2RE3 A;  3O5D A;  3B7X A;  1J6Y A;  3RFW A;  1FAP A;  3TDB A;  2D9F A;  2PV1 A;  3O5G A;  4TYO A;  2RSE A;  2XP5 A;  1N1A A;  4U85 A;  4DH0 A;  4ITZ A;  4DRN A;  3UQA A;  4J4O A;  1F40 A;  3UI6 A;  5CQ2 A;  1D7J A;  2YSB A;  1R9H A;  3TC5 A;  3OOB A;  4MSP A;  2F21 A;  3LE4 A;  1JMQ A;  1P5Q A;  3KZ7 A;  1QPL A;  2JMF A;  1JNT A;  1O6W A;  3IHZ A;  2KR7 A;  1FD9 A;  4J4N A;  2YSI A;  2VN1 A;  3O5P A;  3UI5 A;  2KFW A;  3UF8 A;  4GGQ A;  1FKF A;  4TW7 A;  4DIP A;  2MNT A;  1I5H W;  4DT4 A;  1FKR A;  2DG4 A;  1FJD A;  3I6C A;  2KO7 A;  2RUD A;  4R0X A;  2MLZ A;  2ZQS A;  2KI3 A;  1F8A B;  4JFL A;  3JYJ A;  4TW8 A;  4N19 A;  1PIN A;  2RQS A;  4ODO A;  2PV3 A;  1ZK6 A;  1EQ3 A;  2XP3 A;  1FKD A;  1L1P A;  3O5E A;  4QT2 A;  2BA1 A;  4QT3 A;  4TNS A;  2JXW A;  2XPB A;  1D7I A;  2M8I A;  4NNR A;  4ODK A;  3IKD A;  2PBC A;  2DMV A;  3UQB A;  4IQC A;  2ZQU A;  2ZR5 A;  4MGV A;  2KE0 A;  5HT1 A;  3O5Q A;  4ODQ A;  4U86 A;  4ODM A;  1TK7 A;  2M3O W;  3ODK A;  2XP9 A;  3O5O A;  2DWV A;  3JYM A;  2XPA A;  2LJ4 A;  4JFJ A;  4W9O A;  1A7X A;  3NRK A;  4DRK A;  4FAP A;  5DIU A;  1NMV A;  1FKB A;  1J4I A;  1YAT A;  3KAD A;  2YSG A;  3KCE A;  3GPK A;  2Q5A A;  3MDY B;  2M08 A;  1HXV A;  5HW6 A;  3M85 A;  2KGJ A;  4FN2 A;  2VCD A;  4DRQ A;  2M1I A;  2RUC A;  3CGM A;  1JNS A;  3O5L A;  3L4H A;  2YSF A;  1EYM A;  3KAB A;  1FKL A;  2LGO A;  5DIV A;  2F4E A;  3O5I A;  2PPP A;  2M2A A;  2N87 A;  2IF4 A;  3KAH A;  1ROU A;  2E45 A;  1TCO C;  3KAF A;  2M8J A;  5DIT A;  2RUR A;  4LAY A;  2DJY A;  3LUO A;  5J6E A;  1FKG A;  2DK1 A;  5B8I C;  1YW5 A;  5HWB A;  1C9H A;  3PRB A;  2ZR4 A;  1EG3 A;  4IPX A;  2DG3 A;  2LPV A;  2PPO A;  3KAC A;  2PPN A;  4W9P A;  2KXQ A;  1Y0O A;  3KAG A;  4U84 A;  2F2D A;  1D7H A;  4ODN A;  1EG4 A;  3TCZ A;  4JFI A; 
#chains in the Genus database with same CATH topology
 3LKX B;  1U79 A;  5D75 A;  1LG2 A;  2MLX A;  2XP6 A;  1E15 A;  3M7N A;  1D6O A;  5DF0 A;  4DZ2 A;  4BF8 A;  3EIP A;  2B31 A;  2L2S A;  4ODP A;  4TX0 A;  3O5K A;  4ZPT R;  1HKJ A;  3O5M A;  1ZCN A;  5HUA A;  2ZQT A;  3FSB A;  1H0I A;  2LAJ A;  2A3C A;  2MLY A;  2JV4 A;  2EZ5 W;  1W26 A;  1PBK A;  3ARU A;  4DRO A;  1QZ2 A;  2WLY A;  3ARR A;  2YBU A;  4G2P A;  3MQG A;  3CH9 A;  4S3J A;  1FKH A;  1WB0 A;  4DRM A;  4Z2I A;  2DG9 A;  1NMW A;  3QOK A;  4Z2K A;  1W9U A;  3UI4 A;  3B9E A;  4S3K A;  5HKG A;  1WMV A;  1T11 A;  4DRH A;  3WD1 A;  1B6C A;  1XHG A;  2JX8 A;  3O5J A;  5HW8 A;  1WR7 A;  1ROT A;  1KT0 A;  4Z2H A;  4GIV A;  1FFQ A;  2UZ5 A;  4REX A;  1TR8 A;  3IK8 A;  5HWC A;  3VAW A;  2ZQV A;  1ZBW A;  3ARO A;  2XP7 A;  3MCB A;  1FKI A;  3O5R A;  1K9T A;  1LL6 A;  4MTV A;  3CZ8 A;  2WM0 A;  4ODR A;  5E66 A;  4DWS D;  3H9R B;  1GOI A;  1HKK A;  1JVW A;  1K9R A;  3KAI A;  1Q6I A;  3CNG A;  5U47 A;  5E65 A;  1J4R A;  1H0G A;  2A3E A;  4WKF A;  3WD4 A;  1LL7 A;  2RUQ A;  1FKT A;  1QPF A;  4DRP A;  2MF9 A;  3ARY A;  3BMB A;  1BKF A;  4P8W A;  5BXJ A;  3UQI A;  4MNL A;  2ITK A;  1E6R A;  1RP5 A;  2F23 A;  4DRJ A;  1BL4 A;  2K8I A;  4O2T A;  3FXY A;  1E6N A;  4QZV B;  4DWS C;  4ODL A;  1WAW A;  3FAP A;  2A3A A;  3PA7 A;  5GPG A;  4KR0 B;  5HW7 A;  1FKJ A;  4ZPW R;  3IKG A;  4JYS A;  2L4J A;  4LAX A;  4DRI A;  4W9Q A;  4R5E A;  1ZB5 A;  1TFV A;  2Y78 A;  3EY6 A;  1UR8 A;  5HTG A;  1W1P A;  4E5R A;  1KT1 A;  4UDM A;  4MPK A;  4QIB A;  2DSU A;  4LAW A;  2MPH A;  2XP4 A;  2ZR6 A;  3RGC A;  1EDQ A;  4L72 B;  4W5U A;  2MDI A;  3FSC A;  1FFR A;  1J4H A;  4C02 B;  4IQ2 A;  3NTP A;  4HAR A;  1E6Z A;  2OFN A;  4WKA A;  4G50 A;  1W9V A;  2JZV A;  1Q6U A;  4JFM A;  3G6M A;  2YSH A;  3CGN A;  2AWG A;  1FKK A;  1E44 A;  1Q1C A;  4ML4 A;  1FKS A;  3WH0 A;  4NZC A;  1HJW A;  1LQ0 A;  3O5F A;  1JNE A;  2LKN A;  2WAD A;  1W1T A;  1HJV A;  3RME A;  3RM9 A;  3NI6 A;  1Q6H A;  4JFK A;  4LAV A;  2FKE A;  3PRD A;  5AHT A;  1W9P A;  4DWS B;  3ALF A;  2FAP A;  3CHC A;  2DK7 A;  4HBE A;  2ZAJ A;  3JXV A;  1K9Q A;  5I98 A;  3GTY X;  3WIJ A;  4Q7N A;  1NSG A;  2XP8 A;  4DZ3 A;  1M5Y A;  4TW6 A;  2PV2 A;  1FLC A;  2RE3 A;  3O5D A;  3B7X A;  4WK9 A;  1J6Y A;  1GUV A;  4XAK A;  1ZBK A;  3RFW A;  4NSB A;  4P8V A;  4AY1 A;  1FAP A;  3TDB A;  3WD2 A;  2D9F A;  2PV1 A;  3O5G A;  1W1V A;  1LJY A;  1ZBV A;  3PR9 A;  4TYO A;  2O9O A;  2RSE A;  2DT1 A;  1RD6 A;  2XP5 A;  3LKX A;  1N1A A;  1JND A;  1D2K A;  4P8X A;  4U85 A;  4DH0 A;  2WK2 A;  4ITZ A;  4DRN A;  3UQA A;  3ARP A;  4J4O A;  3ARQ A;  1F40 A;  5CQ2 A;  3UI6 A;  1D7J A;  4MNM A;  1EHN A;  2YSB A;  1R9H A;  4A0T A;  4Q22 A;  3WL0 A;  3TC5 A;  3OOB A;  4MSP A;  2F21 A;  3LE4 A;  1JMQ A;  1P5Q A;  3KZ7 A;  1QPL A;  3WL1 A;  2JMF A;  2DSZ A;  1JNT A;  1O6W A;  1E6P A;  4ZPV R;  3IHZ A;  2KR7 A;  3WQW A;  4ZS6 A;  3AQU A;  3ARV A;  3PQH A;  1FD9 A;  4J4N A;  2YSI A;  1GPF A;  2VN1 A;  3O5P A;  1HKM A;  3UI5 A;  2KFW A;  3UF8 A;  4GGQ A;  1FKF A;  4TW7 A;  4DIP A;  3ARW A;  4MNK A;  3ARX A;  2MNT A;  1VF8 A;  2PN0 A;  5DEZ A;  3AS1 A;  3AS3 A;  3AS2 A;  5GQB A;  1ITX A;  1I5H W;  1W1Y A;  4DT4 A;  1FKR A;  2DG4 A;  1FJD A;  3RM8 A;  2DT0 A;  3I6C A;  2P4V A;  2KO7 A;  4WIW A;  2RUD A;  3OA5 A;  4R0X A;  2OLH A;  5E62 A;  2MLZ A;  4Z2J A;  2FDM A;  2ZQS A;  2KI3 A;  1F8A B;  1ZBC A;  4JFL A;  5HBF A;  1HJX A;  1LL4 A;  3JYJ A;  4TW8 A;  3WD3 A;  1JCH B;  4N19 A;  1PIN A;  2RQS A;  4ODO A;  3B8S A;  2PV3 A;  1ZK6 A;  1EQ3 A;  4IT6 A;  2XP3 A;  2Y8N B;  1NH6 A;  3WKZ A;  1FKD A;  3ARS A;  3BXW A;  1L1P A;  2G41 A;  3O5E A;  4QT2 A;  2YAJ B;  1X6N A;  2BA1 A;  3ARZ A;  4QT3 A;  2JXW A;  1CTN A;  4TNS A;  2XPB A;  1D7I A;  1ZU8 A;  2M8I A;  4NNR A;  4ODK A;  2DSW A;  3IKD A;  4Z2G A;  1OGG A;  1NWU A;  1NWR A;  4IT4 A;  2PBC A;  2DMV A;  2DT3 A;  3UQB A;  2DSV A;  4IQC A;  2ZQU A;  2ZR5 A;  4MGV A;  2G8Z A;  2KE0 A;  2ESC A;  3MCB B;  5HT1 A;  3O5Q A;  4ODQ A;  3AS0 A;  4U86 A;  4ODM A;  3FS8 A;  1TK7 A;  1XRV A;  2M3O W;  3ODK A;  2XP9 A;  3O5O A;  2DWV A;  3JYM A;  3W4R A;  2XPA A;  2LJ4 A;  2B5U B;  4JFJ A;  3CHF A;  4W9O A;  1A7X A;  3NRK A;  4DRK A;  4FAP A;  5DIU A;  2DPE A;  1NMV A;  2WLZ A;  1FKB A;  1J4I A;  1YAT A;  3KAD A;  5GPR A;  1OGB A;  2YSG A;  3ART A;  3KCE A;  3GPK A;  4P8U A;  2Q5A A;  5E5W A;  3MDY B;  2QRV A;  3B9D A;  2M08 A;  1HXV A;  1IX5 A;  5HW6 A;  2OWO A;  3M85 A;  1GRJ A;  2KGJ A;  4FN2 A;  4MNJ A;  4PTM A;  1HKI A;  2VCD A;  4DRQ A;  2M1I A;  2RUC A;  3CGM A;  2YBT A;  1JNS A;  5E64 A;  3O5L A;  4WJX A;  3FY1 A;  3L4H A;  2YSF A;  2DT2 A;  1NWS A;  1EYM A;  4URI A;  3KAB A;  4KQZ A;  1FKL A;  2LGO A;  1LG1 A;  5DIV A;  3RM4 A;  2F4E A;  1E9L A;  3O5I A;  2O92 A;  2PPP A;  2IUZ A;  2M2A A;  2N87 A;  5DO2 A;  5JH8 A;  1UR9 A;  2IF4 A;  3KAH A;  1ROU A;  1SYT A;  4DWS A;  2E45 A;  1TCO C;  3GU0 A;  4HBO A;  3KAF A;  2M8J A;  1NWT A;  5DIT A;  2WAE A;  2RUR A;  4Z2L A;  3MQH A;  3CHD A;  4LAY A;  2DJY A;  1WNO A;  3LUO A;  2A3B A;  3B9A A;  5J6E A;  3G6L A;  1FKG A;  1ZL1 A;  2DK1 A;  4MAV A;  5B8I C;  1YW5 A;  4WKH A;  5HWB A;  1C9H A;  3WD0 A;  3PRB A;  4GLX A;  2ZR4 A;  1EG3 A;  2ETN A;  4IPX A;  3PRA A;  4LGX A;  2DG3 A;  4L3N A;  1X6L A;  2LPV A;  2PI6 A;  1SR0 A;  2PPO A;  3ALG A;  3KAC A;  4A0U A;  3CHE A;  2PPN A;  4W9P A;  2KXQ A;  1Y0O A;  1O6I A;  3KAG A;  1OWQ A;  2EUL A;  2AOS A;  1EIB A;  4U84 A;  3WQV A;  2F2D A;  1D7H A;  4ODN A;  1EG4 A;  1KFW A;  2QF8 A;  3TCZ A;  4JFI A; 
#chains in the Genus database with same CATH homology
 3LKX B;  1U79 A;  5D75 A;  1LG2 A;  2MLX A;  2XP6 A;  1E15 A;  3M7N A;  1D6O A;  5DF0 A;  4DZ2 A;  4BF8 A;  2B31 A;  2L2S A;  4ODP A;  4TX0 A;  3O5K A;  4ZPT R;  1HKJ A;  3O5M A;  1ZCN A;  5HUA A;  2ZQT A;  3FSB A;  1H0I A;  2LAJ A;  2A3C A;  2MLY A;  2JV4 A;  2EZ5 W;  1W26 A;  1PBK A;  3ARU A;  4DRO A;  1QZ2 A;  2WLY A;  3ARR A;  2YBU A;  4G2P A;  3MQG A;  3CH9 A;  4S3J A;  1FKH A;  1WB0 A;  4DRM A;  4Z2I A;  2DG9 A;  1NMW A;  3QOK A;  4Z2K A;  1W9U A;  3UI4 A;  3B9E A;  4S3K A;  5HKG A;  1WMV A;  1T11 A;  4DRH A;  3WD1 A;  1B6C A;  1XHG A;  2JX8 A;  3O5J A;  5HW8 A;  1WR7 A;  1ROT A;  1KT0 A;  4Z2H A;  4GIV A;  1FFQ A;  2UZ5 A;  4REX A;  1TR8 A;  3IK8 A;  5HWC A;  3VAW A;  2ZQV A;  1ZBW A;  3ARO A;  2XP7 A;  3MCB A;  1FKI A;  3O5R A;  1K9T A;  1LL6 A;  4MTV A;  3CZ8 A;  2WM0 A;  4ODR A;  5E66 A;  4DWS D;  3H9R B;  1GOI A;  1HKK A;  1JVW A;  1K9R A;  3KAI A;  1Q6I A;  3CNG A;  5U47 A;  5E65 A;  1J4R A;  1H0G A;  2A3E A;  4WKF A;  3WD4 A;  1LL7 A;  2RUQ A;  1FKT A;  1QPF A;  4DRP A;  2MF9 A;  3ARY A;  1BKF A;  4P8W A;  5BXJ A;  3UQI A;  4MNL A;  2ITK A;  1E6R A;  1RP5 A;  4DRJ A;  1BL4 A;  2K8I A;  4O2T A;  3FXY A;  1E6N A;  4QZV B;  4DWS C;  4ODL A;  1WAW A;  3FAP A;  2A3A A;  3PA7 A;  5GPG A;  4KR0 B;  5HW7 A;  1FKJ A;  4ZPW R;  3IKG A;  4JYS A;  2L4J A;  4LAX A;  4DRI A;  4W9Q A;  4R5E A;  1ZB5 A;  1TFV A;  2Y78 A;  3EY6 A;  1UR8 A;  5HTG A;  1W1P A;  4E5R A;  1KT1 A;  4MPK A;  4QIB A;  2DSU A;  4LAW A;  2MPH A;  2XP4 A;  2ZR6 A;  3RGC A;  1EDQ A;  4L72 B;  4W5U A;  2MDI A;  3FSC A;  1FFR A;  1J4H A;  4C02 B;  4IQ2 A;  3NTP A;  4HAR A;  1E6Z A;  2OFN A;  4WKA A;  4G50 A;  1W9V A;  2JZV A;  1Q6U A;  4JFM A;  3G6M A;  2YSH A;  3CGN A;  2AWG A;  1FKK A;  1Q1C A;  4ML4 A;  1FKS A;  3WH0 A;  4NZC A;  1HJW A;  1LQ0 A;  3O5F A;  1JNE A;  2LKN A;  2WAD A;  1W1T A;  1HJV A;  3RME A;  3RM9 A;  3NI6 A;  1Q6H A;  4JFK A;  4LAV A;  2FKE A;  3PRD A;  5AHT A;  1W9P A;  4DWS B;  3ALF A;  2FAP A;  3CHC A;  2DK7 A;  4HBE A;  2ZAJ A;  3JXV A;  1K9Q A;  5I98 A;  3WIJ A;  4Q7N A;  1NSG A;  2XP8 A;  4DZ3 A;  1M5Y A;  4TW6 A;  2PV2 A;  1FLC A;  2RE3 A;  3O5D A;  3B7X A;  4WK9 A;  1J6Y A;  1GUV A;  4XAK A;  1ZBK A;  3RFW A;  4NSB A;  4P8V A;  4AY1 A;  1FAP A;  3TDB A;  3WD2 A;  2D9F A;  2PV1 A;  3O5G A;  1W1V A;  1LJY A;  1ZBV A;  3PR9 A;  4TYO A;  2O9O A;  2RSE A;  2DT1 A;  1RD6 A;  2XP5 A;  3LKX A;  1N1A A;  1JND A;  1D2K A;  4P8X A;  4U85 A;  4DH0 A;  2WK2 A;  4ITZ A;  4DRN A;  3UQA A;  3ARP A;  4J4O A;  3ARQ A;  1F40 A;  5CQ2 A;  3UI6 A;  1D7J A;  4MNM A;  1EHN A;  2YSB A;  1R9H A;  4A0T A;  4Q22 A;  3WL0 A;  3TC5 A;  3OOB A;  4MSP A;  2F21 A;  3LE4 A;  1JMQ A;  1P5Q A;  3KZ7 A;  1QPL A;  3WL1 A;  2JMF A;  2DSZ A;  1JNT A;  1O6W A;  1E6P A;  4ZPV R;  3IHZ A;  2KR7 A;  3WQW A;  4ZS6 A;  3AQU A;  3ARV A;  3PQH A;  1FD9 A;  4J4N A;  2YSI A;  1GPF A;  2VN1 A;  3O5P A;  1HKM A;  3UI5 A;  2KFW A;  3UF8 A;  4GGQ A;  1FKF A;  4TW7 A;  4DIP A;  3ARW A;  4MNK A;  3ARX A;  2MNT A;  1VF8 A;  5DEZ A;  3AS1 A;  3AS3 A;  3AS2 A;  5GQB A;  1ITX A;  1I5H W;  1W1Y A;  4DT4 A;  1FKR A;  2DG4 A;  1FJD A;  3RM8 A;  2DT0 A;  3I6C A;  4WIW A;  2KO7 A;  2RUD A;  3OA5 A;  4R0X A;  2OLH A;  5E62 A;  2MLZ A;  4Z2J A;  2FDM A;  2ZQS A;  2KI3 A;  1F8A B;  1ZBC A;  4JFL A;  5HBF A;  1HJX A;  1LL4 A;  3JYJ A;  4TW8 A;  3WD3 A;  4N19 A;  1PIN A;  2RQS A;  4ODO A;  3B8S A;  2PV3 A;  1ZK6 A;  1EQ3 A;  4IT6 A;  2XP3 A;  2Y8N B;  1NH6 A;  3WKZ A;  1FKD A;  3ARS A;  3BXW A;  1L1P A;  2G41 A;  3O5E A;  4QT2 A;  2YAJ B;  1X6N A;  2BA1 A;  3ARZ A;  4QT3 A;  2JXW A;  1CTN A;  4TNS A;  2XPB A;  1D7I A;  1ZU8 A;  2M8I A;  4NNR A;  4ODK A;  2DSW A;  3IKD A;  4Z2G A;  1OGG A;  1NWU A;  1NWR A;  4IT4 A;  2PBC A;  2DMV A;  2DT3 A;  3UQB A;  2DSV A;  4IQC A;  2ZQU A;  2ZR5 A;  4MGV A;  2G8Z A;  2KE0 A;  2ESC A;  3MCB B;  5HT1 A;  3O5Q A;  4ODQ A;  3AS0 A;  4U86 A;  4ODM A;  3FS8 A;  1TK7 A;  1XRV A;  2M3O W;  3ODK A;  2XP9 A;  3O5O A;  2DWV A;  3JYM A;  3W4R A;  2XPA A;  2LJ4 A;  4JFJ A;  3CHF A;  4W9O A;  1A7X A;  3NRK A;  4DRK A;  4FAP A;  5DIU A;  2DPE A;  1NMV A;  2WLZ A;  1FKB A;  1J4I A;  1YAT A;  3KAD A;  5GPR A;  1OGB A;  2YSG A;  3ART A;  3KCE A;  3GPK A;  4P8U A;  2Q5A A;  5E5W A;  3MDY B;  2QRV A;  3B9D A;  2M08 A;  1HXV A;  1IX5 A;  5HW6 A;  2OWO A;  3M85 A;  2KGJ A;  4FN2 A;  4MNJ A;  4PTM A;  1HKI A;  2VCD A;  4DRQ A;  2M1I A;  2RUC A;  3CGM A;  2YBT A;  1JNS A;  5E64 A;  3O5L A;  4WJX A;  3FY1 A;  3L4H A;  2YSF A;  2DT2 A;  1NWS A;  1EYM A;  4URI A;  3KAB A;  4KQZ A;  1FKL A;  2LGO A;  1LG1 A;  5DIV A;  3RM4 A;  2F4E A;  1E9L A;  3O5I A;  2O92 A;  2PPP A;  2IUZ A;  2M2A A;  2N87 A;  5DO2 A;  5JH8 A;  1UR9 A;  2IF4 A;  3KAH A;  1ROU A;  1SYT A;  4DWS A;  2E45 A;  1TCO C;  4HBO A;  3KAF A;  2M8J A;  1NWT A;  5DIT A;  2WAE A;  2RUR A;  4Z2L A;  3MQH A;  3CHD A;  4LAY A;  2DJY A;  1WNO A;  3LUO A;  2A3B A;  3B9A A;  5J6E A;  3G6L A;  1FKG A;  1ZL1 A;  2DK1 A;  4MAV A;  5B8I C;  1YW5 A;  4WKH A;  5HWB A;  1C9H A;  3WD0 A;  3PRB A;  4GLX A;  2ZR4 A;  1EG3 A;  4IPX A;  4LGX A;  3PRA A;  2DG3 A;  4L3N A;  1X6L A;  2LPV A;  2PI6 A;  1SR0 A;  2PPO A;  3ALG A;  3KAC A;  4A0U A;  3CHE A;  2PPN A;  4W9P A;  2KXQ A;  1Y0O A;  1O6I A;  3KAG A;  1OWQ A;  2AOS A;  1EIB A;  4U84 A;  3WQV A;  2F2D A;  1D7H A;  4ODN A;  1EG4 A;  1KFW A;  2QF8 A;  3TCZ A;  4JFI A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...