2XP3A

Discovery of cell-active phenyl-imidazole pin1 inhibitors by structure-guided fragment evolution
Total Genus 46
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
46
sequence length
157
structure length
145
Chain Sequence
LPPGWEKAMSRSSGRVYYFNHITNASQWERPSEPARVRCSHLLVKHSQSRRPSSWRQEKITRTKEEALELINGYIQKIKSGEEDFESLASQFSDCSSAKARGDLGAFSRGQMQKPFEDASFALRTGEMSGPVFTDSGIHIILRTE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PEPTIDYL-PROLYL CIS-TRANS ISOMERASE NIMA-INTERACTING 1
publication title Discovery of Cell-Active Phenyl-Imidazole Pin1 Inhibitors by Structure-Guided Fragment Evolution.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Isomerase
total genus 46
structure length 145
sequence length 157
ec nomenclature ec 5.2.1.8: Peptidylprolyl isomerase.
pdb deposition date 2010-08-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00397 WW WW domain
A PF00639 Rotamase PPIC-type PPIASE domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.20.70.10 Mainly Beta Single Sheet Ubiquitin Ligase Nedd4; Chain: W; Ubiquitin Ligase Nedd4; Chain: W; 2xp3A01
3.10.50.40 Alpha Beta Roll Chitinase A; domain 3 Chitinase A; domain 3 2xp3A02
3OOBA 1D7HA 4FN2A 2K8IA 3MDYB 3O5JA 1C9HA 4DRKA 2DG9A 4ODKA 2KE0A 3LE4A 5DITA 2N87A 4C02B 1JNTA 1EYMA 3CGNA 4ODPA 2F21A 3JXVA 1Y0OA 4MSPA 3IK8A 2DK1A 1FAPA 2ZQSA 4U86A 1Q6HA 2M08A 4DIPA 3RFWA 1BL4A 4DRNA 3O5IA 1TK7A 4DRIA 4JFIA 4N19A 2XP8A 3O5EA 4NNRA 2M3OW 1W26A 2KGJA 1F8AB 4U85A 3IKGA 2ZQVA 1B6CA 2L4JA 2MLYA 3O5PA 4W9QA 4IPXA 1TCOC 2PV1A 4DRMA 2VN1A 4GGQA 5D75A 5HWBA 2LJ4A 1N1AA 3KAFA 4G50A 4TW7A 4JFJA 2ZAJA 2PPPA 2XP5A 2JV4A 1FKDA 2KR7A 3KAHA 3NI6A 4QT3A 1Q6UA 3O5OA 4ODOA 2YSGA 1F40A 2MLXA 4ODRA 4R0XA 4LAWA 1NSGA 3RGCA 1QPLA 1QZ2A 4BF8A 1PINA 2IF4A 2AWGA 1WR7A 5I98A 4E5RA 1ZCNA 5J6EA 3UI6A 3KADA 3KACA 3KCEA 4TW8A 3IHZA 5BXJA 4G2PA 3TCZA 2DG3A 2MLZA 1FKTA 4DRJA 2F4EA 2XPBA 1FKRA 3O5RA 1QPFA 2PV3A 2DWVA 1BKFA 4TYOA 2E45A 3JYJA 2XP6A 3TC5A 2D9FA 1FKHA 5DIUA 3WH0A 4QT2A 4JFKA 2M8IA 2VCDA 2RSEA 4IQCA 2M8JA 5HW8A 3O5DA 2YSBA 2Q5AA 3L4HA 4O2TA 5AHTA 2KI3A 2PBCA 1FKSA 2XPAA 2PV2A 3PRBA 5HTGA 1D7JA 2RUQA 2ZR5A 3O5QA 2DMVA 1FKLA 3LUOA 4TX0A 2XP4A 2XP7A 2L2SA 4ODMA 1NMVA 3ODKA 1FD9A 2ZQUA 3UQAA 4DZ2A 5CQ2A 2YSFA 3KABA 2DJYA 1FKIA 2DK7A 4DROA 3O5FA 2FAPA 4MGVA 2DG4A 1HXVA 2KO7A 1FKFA 1O6WA 3KAIA 4W9OA 4DRHA 3UI4A 2LAJA 5HWCA 1JVWA 5HW7A 3PRDA 2PPOA 1P5QA 2M1IA 5HW6A 2XP3A 5DIVA 2PPNA 2KXQA 3UF8A 2ZR4A 4JFMA 5HT1A 3O5MA 2JZVA 1D6OA 1U79A 4GIVA 4DH0A 1ZK6A 1M5YA 2LPVA 3KZ7A 4IQ2A 2EZ5W 3UI5A 2UZ5A 2MDIA 4U84A 2ZQTA 4LAXA 4DRQA 2MNTA 3I6CA 1FKBA 3TDBA 1EG3A 1D7IA 1J4IA 2XP9A 5B8IC 3JYMA 1EQ3A 4JFLA 3O5GA 3UQIA 3CNGA 3CGMA 1R9HA 1K9RA 1KT1A 4DZ3A 1ROUA 2RUCA 3UQBA 2LKNA 2MPHA 5HKGA 5HUAA 2FKEA 1WMVA 2OFNA 3NRKA 2BA1A 1Q1CA 3NTPA 3O5KA 4LAYA 1K9QA 1A7XA 1ROTA 2RURA 1T11A 4ODQA 1J4RA 1FKJA 2RE3A 1FJDA 3O5LA 2JX8A 1I5HW 4ODNA 2ZR6A 4J4OA 2JMFA 2YSIA 4TNSA 4TW6A 3H9RB 3M7NA 3IKDA 4W9PA 4REXA 1NMWA 2MF9A 3EY6A 4LAVA 2JXWA 3FAPA 2F2DA 1JNSA 1YW5A 4JYSA 4DRPA 2ITKA 3GPKA 4DT4A 2RQSA 4FAPA 1JMQA 2RUDA 2YSHA 1YATA 1FKKA 4QIBA 4ODLA 1Q6IA 1FKGA 2Y78A 3PA7A 5GPGA 1J4HA 3VAWA 1L1PA 3KAGA 1PBKA 2KFWA 4J4NA 3M85A 2M2AA 1KT0A 1EG4A 2LGOA 4ITZA 1J6YA 3B7XA
chains in the Genus database with same CATH superfamily
3OOBA 1XRVA 1D7HA 4FN2A 2K8IA 1TFVA 1LJYA 5E66A 3MQHA 3MDYB 3O5JA 1C9HA 4DRKA 2P4VA 2DG9A 4ODKA 2KE0A 3LE4A 2F23A 5DITA 2N87A 4WKAA 4C02B 1H0GA 1JNTA 3QOKA 2PN0A 1W1PA 1TR8A 5E62A 1LG1A 4P8UA 1EYMA 3CGNA 4ODPA 2F21A 3JXVA 3CHDA 4DWSD 3BMBA 1UR9A 3CHFA 1Y0OA 4MSPA 3IK8A 2DK1A 1FAPA 3RM8A 1E15A 4W5UA 3CZ8A 2ZQSA 1LG2A 2YBTA 4U86A 1Q6HA 4ZPVR 2DT2A 2M08A 4DIPA 1JNDA 3RFWA 1BL4A 1OGGA 1ZL1A 4DRNA 1HJWA 5U47A 3O5IA 1TK7A 4DRIA 4JFIA 2OWOA 4N19A 2XP8A 3O5EA 4NNRA 2M3OW 3FXYA 1W26A 2B31A 2KGJA 4DWSA 2EULA 4HBOA 1F8AB 2G41A 3ARPA 4U85A 3IKGA 4WIWA 2ZQVA 1B6CA 3RMEA 2L4JA 2MLYA 3WD1A 3WQWA 3WQVA 3FSCA 1EDQA 3WD4A 4NZCA 1W1VA 1ZBWA 5GQBA 3O5PA 4W9QA 4IPXA 3B9EA 1TCOC 2PV1A 4DRMA 2VN1A 4GGQA 3WD2A 1W9PA 2WAEA 1LL7A 2DSVA 2B5UB 5D75A 5HWBA 2LJ4A 1N1AA 4P8XA 2QF8A 3KAFA 4G50A 4TW7A 4Z2HA 4JFJA 2ZAJA 2PPPA 2XP5A 1XHGA 1W9VA 2JV4A 1FKDA 4ML4A 2KR7A 3KAHA 4Q7NA 4P8VA 3CHCA 1LQ0A 1GRJA 2O9OA 1O6IA 1OGBA 3NI6A 3B8SA 4QT3A 1Q6UA 1HKKA 1ZB5A 3O5OA 4ODOA 2YSGA 4XAKA 1F40A 4S3JA 2MLXA 4ODRA 1HKJA 4R0XA 3MCBB 4LAWA 1WB0A 1NSGA 1X6NA 3RGCA 1QPLA 1QZ2A 4URIA 4BF8A 1PINA 3AQUA 3PQHA 2IF4A 2AWGA 4ZS6A 5DEZA 1WR7A 3ARSA 5I98A 4E5RA 1ZCNA 2DT1A 1E6ZA 3MCBA 5J6EA 3OA5A 3UI6A 3KADA 3KACA 2YAJB 4UDMA 1E6NA 3KCEA 4TW8A 2WLYA 3ALGA 3IHZA 5BXJA 4G2PA 2WLZA 3TCZA 2DG3A 2MLZA 1FKTA 2G8ZA 1D2KA 4DRJA 2F4EA 4MNKA 2XPBA 1FKRA 3O5RA 3B9DA 1QPFA 1W9UA 2PV3A 1E9LA 2DWVA 1BKFA 4TYOA 3RM4A 2E45A 1EHNA 3JYJA 2XP6A 3TC5A 2PI6A 2D9FA 4WKHA 1FKHA 1GUVA 2O92A 5DIUA 3WH0A 4QT2A 4P8WA 4JFKA 2Y8NB 2M8IA 2VCDA 2WM0A 4MNLA 2RSEA 1OWQA 4IQCA 2M8JA 1JNEA 5HW8A 3ARXA 3O5DA 2YSBA 2Q5AA 3L4HA 4O2TA 1ZBVA 5AHTA 2IUZA 2KI3A 2PBCA 4MPKA 1FKSA 4S3KA 2A3CA 1EIBA 2XPAA 3LKXB 2PV2A 3PRBA 1RP5A 5HTGA 1D7JA 2RUQA 2ZR5A 3O5QA 1VF8A 2DMVA 1FKLA 3LUOA 1X6LA 4Z2IA 1RD6A 1E44A 4TX0A 1H0IA 2XP4A 2DSZA 3ALFA 2XP7A 2L2SA 4ODMA 4MAVA 3MQGA 1NMVA 3ODKA 1FD9A 2ZQUA 3UQAA 4DZ2A 5CQ2A 1LL6A 2YSFA 4PTMA 3KABA 2A3EA 2DSUA 5DO2A 4MTVA 2DJYA 4AY1A 3GTYX 1FKIA 2DK7A 4DROA 3O5FA 2FAPA 4MGVA 2DG4A 1HXVA 2KO7A 1FKFA 3B9AA 1O6WA 3KAIA 4W9OA 4KR0B 4HARA 4MNJA 4DRHA 1UR8A 3UI4A 2LAJA 4HBEA 3WL0A 1ZBKA 5HWCA 1JVWA 4Z2JA 3AS1A 5HW7A 3PRDA 2PPOA 1P5QA 2M1IA 5HW6A 2XP3A 1FFRA 5DIVA 2PPNA 2KXQA 3UF8A 2ZR4A 4JFMA 4ZPWR 5HT1A 3O5MA 3AS2A 3AROA 2JZVA 3RM9A 4IT4A 1HJXA 1D6OA 2DSWA 1U79A 4GIVA 4DH0A 1ZK6A 1M5YA 2ESCA 3ARUA 2LPVA 3KZ7A 4IQ2A 2EZ5W 1HJVA 1W1YA 4R5EA 2UZ5A 4WKFA 2MDIA 3UI5A 4QZVB 4L3NA 4U84A 2ZQTA 3FSBA 4LAXA 3ARTA 4DRQA 4NSBA 3ARQA 2MNTA 3I6CA 1FKBA 4WK9A 3TDBA 1EG3A 4DWSC 1D7IA 1J4IA 3ARRA 2XP9A 1FFQA 3CH9A 2QRVA 5B8IC 3JYMA 3G6LA 1EQ3A 4GLXA 4A0UA 4JFLA 1NWSA 3O5GA 3UQIA 3CNGA 3CGMA 1R9HA 4Z2LA 5HBFA 1K9RA 1KT1A 4DZ3A 1ROUA 2RUCA 5E65A 3UQBA 1ITXA 1ZBCA 2LKNA 5GPRA 2MPHA 5DF0A 5HKGA 5HUAA 2FKEA 1WMVA 3WIJA 2OFNA 3WD0A 1SR0A 2BA1A 3NRKA 1HKMA 1Q1CA 3NTPA 3O5KA 4Z2GA 3ARYA 4LGXA 4LAYA 1K9QA 1A7XA 1ROTA 2RURA 4A0TA 1T11A 1NWUA 4ODQA 1J4RA 1FKJA 2RE3A 4DWSB 1FJDA 3O5LA 2JX8A 2A3AA 1I5HW 4ODNA 2ZR6A 4J4OA 1NWTA 4Z2KA 1HKIA 1FLCA 2JMFA 2YSIA 1GOIA 3AS0A 1NH6A 4TNSA 4TW6A 3W4RA 1GPFA 4ZPTR 3H9RB 5JH8A 3LKXA 2FDMA 3M7NA 3GU0A 1IX5A 3IKDA 4W9PA 5E5WA 2ETNA 1WNOA 4REXA 4L72B 3ARVA 3WKZA 1KFWA 1NMWA 2AOSA 2MF9A 3FS8A 2WADA 3EY6A 4MNMA 2DT3A 4LAVA 5E64A 2JXWA 3WD3A 1E6RA 3FAPA 3ARZA 2YBUA 3ARWA 2F2DA 1JNSA 1CTNA 4Q22A 1K9TA 1YW5A 4JYSA 3AS3A 3CHEA 2A3BA 4DRPA 1NWRA 3PR9A 2ITKA 3GPKA 4DT4A 2RQSA 4FAPA 1JMQA 2RUDA 2YSHA 2OLHA 1YATA 1ZU8A 1LL4A 3PRAA 1SYTA 3FY1A 1FKKA 4QIBA 1W1TA 1E6PA 1JCHB 4ODLA 2DPEA 1Q6IA 4KQZA 1FKGA 2Y78A 3PA7A 3EIPA 5GPGA 1J4HA 3VAWA 1L1PA 3KAGA 1PBKA 4IT6A 3BXWA 2KFWA 4J4NA 4WJXA 3M85A 3G6MA 2M2AA 3WL1A 1KT0A 1EG4A 1WAWA 2DT0A 2LGOA 4ITZA 1J6YA 2WK2A 3B7XA
chains in the Genus database with same CATH topology
3OOBA 1XRVA 1D7HA 4FN2A 2K8IA 1TFVA 1LJYA 5E66A 3MQHA 3MDYB 3O5JA 1C9HA 4DRKA 2DG9A 4ODKA 2KE0A 3LE4A 5DITA 2N87A 4WKAA 4C02B 1H0GA 1JNTA 3QOKA 1W1PA 1TR8A 5E62A 1LG1A 4P8UA 1EYMA 3CGNA 4ODPA 2F21A 3JXVA 3CHDA 4DWSD 1UR9A 3CHFA 1Y0OA 4MSPA 3IK8A 2DK1A 1FAPA 3RM8A 1E15A 4W5UA 3CZ8A 2ZQSA 1LG2A 2YBTA 4U86A 1Q6HA 4ZPVR 2DT2A 2M08A 4DIPA 1JNDA 3RFWA 1BL4A 1OGGA 1ZL1A 4DRNA 1HJWA 5U47A 3O5IA 1TK7A 4DRIA 4JFIA 2OWOA 4N19A 2XP8A 3O5EA 4NNRA 2M3OW 3FXYA 1W26A 2B31A 2KGJA 4DWSA 4HBOA 1F8AB 2G41A 3ARPA 4U85A 3IKGA 4WIWA 2ZQVA 1B6CA 3RMEA 2L4JA 2MLYA 3WD1A 3WQWA 3WQVA 3FSCA 1EDQA 3WD4A 4NZCA 1W1VA 1ZBWA 5GQBA 3O5PA 4W9QA 4IPXA 3B9EA 1TCOC 2PV1A 4DRMA 2VN1A 4GGQA 3WD2A 1W9PA 2WAEA 1LL7A 2DSVA 5D75A 5HWBA 2LJ4A 1N1AA 4P8XA 2QF8A 3KAFA 4G50A 4TW7A 4Z2HA 4JFJA 2ZAJA 2PPPA 2XP5A 1XHGA 1W9VA 2JV4A 1FKDA 4ML4A 2KR7A 3KAHA 4Q7NA 4P8VA 3CHCA 1LQ0A 2O9OA 1O6IA 1OGBA 3NI6A 3B8SA 4QT3A 1Q6UA 1HKKA 1ZB5A 3O5OA 4ODOA 2YSGA 4XAKA 1F40A 4S3JA 2MLXA 4ODRA 1HKJA 4R0XA 3MCBB 4LAWA 1WB0A 1NSGA 1X6NA 3RGCA 1QPLA 1QZ2A 4URIA 4BF8A 1PINA 3AQUA 3PQHA 2IF4A 2AWGA 4ZS6A 5DEZA 1WR7A 3ARSA 5I98A 4E5RA 1ZCNA 2DT1A 1E6ZA 3MCBA 5J6EA 3OA5A 3UI6A 3KADA 3KACA 2YAJB 1E6NA 3KCEA 4TW8A 2WLYA 3ALGA 3IHZA 5BXJA 4G2PA 2WLZA 3TCZA 2DG3A 2MLZA 1FKTA 2G8ZA 1D2KA 4DRJA 2F4EA 4MNKA 2XPBA 1FKRA 3O5RA 3B9DA 1QPFA 1W9UA 2PV3A 1E9LA 2DWVA 1BKFA 4TYOA 3RM4A 2E45A 1EHNA 3JYJA 2XP6A 3TC5A 2PI6A 2D9FA 4WKHA 1FKHA 1GUVA 2O92A 5DIUA 3WH0A 4QT2A 4P8WA 4JFKA 2Y8NB 2M8IA 2VCDA 2WM0A 4MNLA 2RSEA 1OWQA 4IQCA 2M8JA 1JNEA 5HW8A 3ARXA 3O5DA 2YSBA 2Q5AA 3L4HA 4O2TA 1ZBVA 5AHTA 2IUZA 2KI3A 2PBCA 4MPKA 1FKSA 4S3KA 2A3CA 1EIBA 2XPAA 3LKXB 2PV2A 3PRBA 1RP5A 5HTGA 1D7JA 2RUQA 2ZR5A 3O5QA 1VF8A 2DMVA 1FKLA 3LUOA 1X6LA 4Z2IA 1RD6A 4TX0A 1H0IA 2XP4A 2DSZA 3ALFA 2XP7A 2L2SA 4ODMA 4MAVA 3MQGA 1NMVA 3ODKA 1FD9A 2ZQUA 3UQAA 4DZ2A 5CQ2A 1LL6A 2YSFA 4PTMA 3KABA 2A3EA 2DSUA 5DO2A 4MTVA 2DJYA 4AY1A 1FKIA 2DK7A 4DROA 3O5FA 2FAPA 4MGVA 2DG4A 1HXVA 2KO7A 1FKFA 3B9AA 1O6WA 3KAIA 4W9OA 4KR0B 4HARA 4MNJA 4DRHA 1UR8A 3UI4A 2LAJA 4HBEA 3WL0A 1ZBKA 5HWCA 1JVWA 4Z2JA 3AS1A 5HW7A 3PRDA 2PPOA 1P5QA 2M1IA 5HW6A 2XP3A 1FFRA 5DIVA 2PPNA 2KXQA 3UF8A 2ZR4A 4JFMA 4ZPWR 5HT1A 3O5MA 3AS2A 3AROA 2JZVA 3RM9A 4IT4A 1HJXA 1D6OA 2DSWA 1U79A 4GIVA 4DH0A 1ZK6A 1M5YA 2ESCA 3ARUA 2LPVA 3KZ7A 4IQ2A 2EZ5W 1HJVA 1W1YA 4R5EA 2UZ5A 4WKFA 2MDIA 3UI5A 4QZVB 4L3NA 4U84A 2ZQTA 3FSBA 4LAXA 3ARTA 4DRQA 4NSBA 3ARQA 2MNTA 3I6CA 1FKBA 4WK9A 3TDBA 1EG3A 4DWSC 1D7IA 1J4IA 3ARRA 2XP9A 1FFQA 3CH9A 2QRVA 5B8IC 3JYMA 3G6LA 1EQ3A 4GLXA 4A0UA 4JFLA 1NWSA 3O5GA 3UQIA 3CNGA 3CGMA 1R9HA 4Z2LA 5HBFA 1K9RA 1KT1A 4DZ3A 1ROUA 2RUCA 5E65A 3UQBA 1ITXA 1ZBCA 2LKNA 5GPRA 2MPHA 5DF0A 5HKGA 5HUAA 2FKEA 1WMVA 3WIJA 2OFNA 3WD0A 1SR0A 2BA1A 3NRKA 1HKMA 1Q1CA 3NTPA 3O5KA 4Z2GA 3ARYA 4LGXA 4LAYA 1K9QA 1A7XA 1ROTA 2RURA 4A0TA 1T11A 1NWUA 4ODQA 1J4RA 1FKJA 2RE3A 4DWSB 1FJDA 3O5LA 2JX8A 2A3AA 1I5HW 4ODNA 2ZR6A 4J4OA 1NWTA 4Z2KA 1HKIA 1FLCA 2JMFA 2YSIA 1GOIA 3AS0A 1NH6A 4TNSA 4TW6A 3W4RA 1GPFA 4ZPTR 3H9RB 5JH8A 3LKXA 2FDMA 3M7NA 1IX5A 3IKDA 4W9PA 5E5WA 1WNOA 4REXA 4L72B 3ARVA 3WKZA 1KFWA 1NMWA 2AOSA 2MF9A 3FS8A 2WADA 3EY6A 4MNMA 2DT3A 4LAVA 5E64A 2JXWA 3WD3A 1E6RA 3FAPA 3ARZA 2YBUA 3ARWA 2F2DA 1JNSA 1CTNA 4Q22A 1K9TA 1YW5A 4JYSA 3AS3A 3CHEA 2A3BA 4DRPA 1NWRA 3PR9A 2ITKA 3GPKA 4DT4A 2RQSA 4FAPA 1JMQA 2RUDA 2YSHA 2OLHA 1YATA 1ZU8A 1LL4A 3PRAA 1SYTA 3FY1A 1FKKA 4QIBA 1W1TA 1E6PA 4ODLA 2DPEA 1Q6IA 4KQZA 1FKGA 2Y78A 3PA7A 5GPGA 1J4HA 3VAWA 1L1PA 3KAGA 1PBKA 4IT6A 3BXWA 2KFWA 4J4NA 4WJXA 3M85A 3G6MA 2M2AA 3WL1A 1KT0A 1EG4A 1WAWA 2DT0A 2LGOA 4ITZA 1J6YA 2WK2A 3B7XA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3OOB A;  1D7H A;  4FN2 A;  2K8I A;  3MDY B;  3O5J A;  1C9H A;  4DRK A;  2DG9 A;  4ODK A;  2KE0 A;  3LE4 A;  5DIT A;  2N87 A;  4C02 B;  1JNT A;  1EYM A;  3CGN A;  4ODP A;  2F21 A;  3JXV A;  1Y0O A;  4MSP A;  3IK8 A;  2DK1 A;  1FAP A;  2ZQS A;  4U86 A;  1Q6H A;  2M08 A;  4DIP A;  3RFW A;  1BL4 A;  4DRN A;  3O5I A;  1TK7 A;  4DRI A;  4JFI A;  4N19 A;  2XP8 A;  3O5E A;  4NNR A;  2M3O W;  1W26 A;  2KGJ A;  1F8A B;  4U85 A;  3IKG A;  2ZQV A;  1B6C A;  2L4J A;  2MLY A;  3O5P A;  4W9Q A;  4IPX A;  1TCO C;  2PV1 A;  4DRM A;  2VN1 A;  4GGQ A;  5D75 A;  5HWB A;  2LJ4 A;  1N1A A;  3KAF A;  4G50 A;  4TW7 A;  4JFJ A;  2ZAJ A;  2PPP A;  2XP5 A;  2JV4 A;  1FKD A;  2KR7 A;  3KAH A;  3NI6 A;  4QT3 A;  1Q6U A;  3O5O A;  4ODO A;  2YSG A;  1F40 A;  2MLX A;  4ODR A;  4R0X A;  4LAW A;  1NSG A;  3RGC A;  1QPL A;  1QZ2 A;  4BF8 A;  1PIN A;  2IF4 A;  2AWG A;  1WR7 A;  5I98 A;  4E5R A;  1ZCN A;  5J6E A;  3UI6 A;  3KAD A;  3KAC A;  3KCE A;  4TW8 A;  3IHZ A;  5BXJ A;  4G2P A;  3TCZ A;  2DG3 A;  2MLZ A;  1FKT A;  4DRJ A;  2F4E A;  2XPB A;  1FKR A;  3O5R A;  1QPF A;  2PV3 A;  2DWV A;  1BKF A;  4TYO A;  2E45 A;  3JYJ A;  2XP6 A;  3TC5 A;  2D9F A;  1FKH A;  5DIU A;  3WH0 A;  4QT2 A;  4JFK A;  2M8I A;  2VCD A;  2RSE A;  4IQC A;  2M8J A;  5HW8 A;  3O5D A;  2YSB A;  2Q5A A;  3L4H A;  4O2T A;  5AHT A;  2KI3 A;  2PBC A;  1FKS A;  2XPA A;  2PV2 A;  3PRB A;  5HTG A;  1D7J A;  2RUQ A;  2ZR5 A;  3O5Q A;  2DMV A;  1FKL A;  3LUO A;  4TX0 A;  2XP4 A;  2XP7 A;  2L2S A;  4ODM A;  1NMV A;  3ODK A;  1FD9 A;  2ZQU A;  3UQA A;  4DZ2 A;  5CQ2 A;  2YSF A;  3KAB A;  2DJY A;  1FKI A;  2DK7 A;  4DRO A;  3O5F A;  2FAP A;  4MGV A;  2DG4 A;  1HXV A;  2KO7 A;  1FKF A;  1O6W A;  3KAI A;  4W9O A;  4DRH A;  3UI4 A;  2LAJ A;  5HWC A;  1JVW A;  5HW7 A;  3PRD A;  2PPO A;  1P5Q A;  2M1I A;  5HW6 A;  2XP3 A;  5DIV A;  2PPN A;  2KXQ A;  3UF8 A;  2ZR4 A;  4JFM A;  5HT1 A;  3O5M A;  2JZV A;  1D6O A;  1U79 A;  4GIV A;  4DH0 A;  1ZK6 A;  1M5Y A;  2LPV A;  3KZ7 A;  4IQ2 A;  2EZ5 W;  3UI5 A;  2UZ5 A;  2MDI A;  4U84 A;  2ZQT A;  4LAX A;  4DRQ A;  2MNT A;  3I6C A;  1FKB A;  3TDB A;  1EG3 A;  1D7I A;  1J4I A;  2XP9 A;  5B8I C;  3JYM A;  1EQ3 A;  4JFL A;  3O5G A;  3UQI A;  3CNG A;  3CGM A;  1R9H A;  1K9R A;  1KT1 A;  4DZ3 A;  1ROU A;  2RUC A;  3UQB A;  2LKN A;  2MPH A;  5HKG A;  5HUA A;  2FKE A;  1WMV A;  2OFN A;  3NRK A;  2BA1 A;  1Q1C A;  3NTP A;  3O5K A;  4LAY A;  1K9Q A;  1A7X A;  1ROT A;  2RUR A;  1T11 A;  4ODQ A;  1J4R A;  1FKJ A;  2RE3 A;  1FJD A;  3O5L A;  2JX8 A;  1I5H W;  4ODN A;  2ZR6 A;  4J4O A;  2JMF A;  2YSI A;  4TNS A;  4TW6 A;  3H9R B;  3M7N A;  3IKD A;  4W9P A;  4REX A;  1NMW A;  2MF9 A;  3EY6 A;  4LAV A;  2JXW A;  3FAP A;  2F2D A;  1JNS A;  1YW5 A;  4JYS A;  4DRP A;  2ITK A;  3GPK A;  4DT4 A;  2RQS A;  4FAP A;  1JMQ A;  2RUD A;  2YSH A;  1YAT A;  1FKK A;  4QIB A;  4ODL A;  1Q6I A;  1FKG A;  2Y78 A;  3PA7 A;  5GPG A;  1J4H A;  3VAW A;  1L1P A;  3KAG A;  1PBK A;  2KFW A;  4J4N A;  3M85 A;  2M2A A;  1KT0 A;  1EG4 A;  2LGO A;  4ITZ A;  1J6Y A;  3B7X A; 
#chains in the Genus database with same CATH topology
 3OOB A;  1XRV A;  1D7H A;  4FN2 A;  2K8I A;  1TFV A;  1LJY A;  5E66 A;  3MQH A;  3MDY B;  3O5J A;  1C9H A;  4DRK A;  2P4V A;  2DG9 A;  4ODK A;  2KE0 A;  3LE4 A;  2F23 A;  5DIT A;  2N87 A;  4WKA A;  4C02 B;  1H0G A;  1JNT A;  3QOK A;  2PN0 A;  1W1P A;  1TR8 A;  5E62 A;  1LG1 A;  4P8U A;  1EYM A;  3CGN A;  4ODP A;  2F21 A;  3JXV A;  3CHD A;  4DWS D;  3BMB A;  1UR9 A;  3CHF A;  1Y0O A;  4MSP A;  3IK8 A;  2DK1 A;  1FAP A;  3RM8 A;  1E15 A;  4W5U A;  3CZ8 A;  2ZQS A;  1LG2 A;  2YBT A;  4U86 A;  1Q6H A;  4ZPV R;  2DT2 A;  2M08 A;  4DIP A;  1JND A;  3RFW A;  1BL4 A;  1OGG A;  1ZL1 A;  4DRN A;  1HJW A;  5U47 A;  3O5I A;  1TK7 A;  4DRI A;  4JFI A;  2OWO A;  4N19 A;  2XP8 A;  3O5E A;  4NNR A;  2M3O W;  3FXY A;  1W26 A;  2B31 A;  2KGJ A;  4DWS A;  2EUL A;  4HBO A;  1F8A B;  2G41 A;  3ARP A;  4U85 A;  3IKG A;  4WIW A;  2ZQV A;  1B6C A;  3RME A;  2L4J A;  2MLY A;  3WD1 A;  3WQW A;  3WQV A;  3FSC A;  1EDQ A;  3WD4 A;  4NZC A;  1W1V A;  1ZBW A;  5GQB A;  3O5P A;  4W9Q A;  4IPX A;  3B9E A;  1TCO C;  2PV1 A;  4DRM A;  2VN1 A;  4GGQ A;  3WD2 A;  1W9P A;  2WAE A;  1LL7 A;  2DSV A;  2B5U B;  5D75 A;  5HWB A;  2LJ4 A;  1N1A A;  4P8X A;  2QF8 A;  3KAF A;  4G50 A;  4TW7 A;  4Z2H A;  4JFJ A;  2ZAJ A;  2PPP A;  2XP5 A;  1XHG A;  1W9V A;  2JV4 A;  1FKD A;  4ML4 A;  2KR7 A;  3KAH A;  4Q7N A;  4P8V A;  3CHC A;  1LQ0 A;  1GRJ A;  2O9O A;  1O6I A;  1OGB A;  3NI6 A;  3B8S A;  4QT3 A;  1Q6U A;  1HKK A;  1ZB5 A;  3O5O A;  4ODO A;  2YSG A;  4XAK A;  1F40 A;  4S3J A;  2MLX A;  4ODR A;  1HKJ A;  4R0X A;  3MCB B;  4LAW A;  1WB0 A;  1NSG A;  1X6N A;  3RGC A;  1QPL A;  1QZ2 A;  4URI A;  4BF8 A;  1PIN A;  3AQU A;  3PQH A;  2IF4 A;  2AWG A;  4ZS6 A;  5DEZ A;  1WR7 A;  3ARS A;  5I98 A;  4E5R A;  1ZCN A;  2DT1 A;  1E6Z A;  3MCB A;  5J6E A;  3OA5 A;  3UI6 A;  3KAD A;  3KAC A;  2YAJ B;  4UDM A;  1E6N A;  3KCE A;  4TW8 A;  2WLY A;  3ALG A;  3IHZ A;  5BXJ A;  4G2P A;  2WLZ A;  3TCZ A;  2DG3 A;  2MLZ A;  1FKT A;  2G8Z A;  1D2K A;  4DRJ A;  2F4E A;  4MNK A;  2XPB A;  1FKR A;  3O5R A;  3B9D A;  1QPF A;  1W9U A;  2PV3 A;  1E9L A;  2DWV A;  1BKF A;  4TYO A;  3RM4 A;  2E45 A;  1EHN A;  3JYJ A;  2XP6 A;  3TC5 A;  2PI6 A;  2D9F A;  4WKH A;  1FKH A;  1GUV A;  2O92 A;  5DIU A;  3WH0 A;  4QT2 A;  4P8W A;  4JFK A;  2Y8N B;  2M8I A;  2VCD A;  2WM0 A;  4MNL A;  2RSE A;  1OWQ A;  4IQC A;  2M8J A;  1JNE A;  5HW8 A;  3ARX A;  3O5D A;  2YSB A;  2Q5A A;  3L4H A;  4O2T A;  1ZBV A;  5AHT A;  2IUZ A;  2KI3 A;  2PBC A;  4MPK A;  1FKS A;  4S3K A;  2A3C A;  1EIB A;  2XPA A;  3LKX B;  2PV2 A;  3PRB A;  1RP5 A;  5HTG A;  1D7J A;  2RUQ A;  2ZR5 A;  3O5Q A;  1VF8 A;  2DMV A;  1FKL A;  3LUO A;  1X6L A;  4Z2I A;  1RD6 A;  1E44 A;  4TX0 A;  1H0I A;  2XP4 A;  2DSZ A;  3ALF A;  2XP7 A;  2L2S A;  4ODM A;  4MAV A;  3MQG A;  1NMV A;  3ODK A;  1FD9 A;  2ZQU A;  3UQA A;  4DZ2 A;  5CQ2 A;  1LL6 A;  2YSF A;  4PTM A;  3KAB A;  2A3E A;  2DSU A;  5DO2 A;  4MTV A;  2DJY A;  4AY1 A;  3GTY X;  1FKI A;  2DK7 A;  4DRO A;  3O5F A;  2FAP A;  4MGV A;  2DG4 A;  1HXV A;  2KO7 A;  1FKF A;  3B9A A;  1O6W A;  3KAI A;  4W9O A;  4KR0 B;  4HAR A;  4MNJ A;  4DRH A;  1UR8 A;  3UI4 A;  2LAJ A;  4HBE A;  3WL0 A;  1ZBK A;  5HWC A;  1JVW A;  4Z2J A;  3AS1 A;  5HW7 A;  3PRD A;  2PPO A;  1P5Q A;  2M1I A;  5HW6 A;  2XP3 A;  1FFR A;  5DIV A;  2PPN A;  2KXQ A;  3UF8 A;  2ZR4 A;  4JFM A;  4ZPW R;  5HT1 A;  3O5M A;  3AS2 A;  3ARO A;  2JZV A;  3RM9 A;  4IT4 A;  1HJX A;  1D6O A;  2DSW A;  1U79 A;  4GIV A;  4DH0 A;  1ZK6 A;  1M5Y A;  2ESC A;  3ARU A;  2LPV A;  3KZ7 A;  4IQ2 A;  2EZ5 W;  1HJV A;  1W1Y A;  4R5E A;  2UZ5 A;  4WKF A;  2MDI A;  3UI5 A;  4QZV B;  4L3N A;  4U84 A;  2ZQT A;  3FSB A;  4LAX A;  3ART A;  4DRQ A;  4NSB A;  3ARQ A;  2MNT A;  3I6C A;  1FKB A;  4WK9 A;  3TDB A;  1EG3 A;  4DWS C;  1D7I A;  1J4I A;  3ARR A;  2XP9 A;  1FFQ A;  3CH9 A;  2QRV A;  5B8I C;  3JYM A;  3G6L A;  1EQ3 A;  4GLX A;  4A0U A;  4JFL A;  1NWS A;  3O5G A;  3UQI A;  3CNG A;  3CGM A;  1R9H A;  4Z2L A;  5HBF A;  1K9R A;  1KT1 A;  4DZ3 A;  1ROU A;  2RUC A;  5E65 A;  3UQB A;  1ITX A;  1ZBC A;  2LKN A;  5GPR A;  2MPH A;  5DF0 A;  5HKG A;  5HUA A;  2FKE A;  1WMV A;  3WIJ A;  2OFN A;  3WD0 A;  1SR0 A;  2BA1 A;  3NRK A;  1HKM A;  1Q1C A;  3NTP A;  3O5K A;  4Z2G A;  3ARY A;  4LGX A;  4LAY A;  1K9Q A;  1A7X A;  1ROT A;  2RUR A;  4A0T A;  1T11 A;  1NWU A;  4ODQ A;  1J4R A;  1FKJ A;  2RE3 A;  4DWS B;  1FJD A;  3O5L A;  2JX8 A;  2A3A A;  1I5H W;  4ODN A;  2ZR6 A;  4J4O A;  1NWT A;  4Z2K A;  1HKI A;  1FLC A;  2JMF A;  2YSI A;  1GOI A;  3AS0 A;  1NH6 A;  4TNS A;  4TW6 A;  3W4R A;  1GPF A;  4ZPT R;  3H9R B;  5JH8 A;  3LKX A;  2FDM A;  3M7N A;  3GU0 A;  1IX5 A;  3IKD A;  4W9P A;  5E5W A;  2ETN A;  1WNO A;  4REX A;  4L72 B;  3ARV A;  3WKZ A;  1KFW A;  1NMW A;  2AOS A;  2MF9 A;  3FS8 A;  2WAD A;  3EY6 A;  4MNM A;  2DT3 A;  4LAV A;  5E64 A;  2JXW A;  3WD3 A;  1E6R A;  3FAP A;  3ARZ A;  2YBU A;  3ARW A;  2F2D A;  1JNS A;  1CTN A;  4Q22 A;  1K9T A;  1YW5 A;  4JYS A;  3AS3 A;  3CHE A;  2A3B A;  4DRP A;  1NWR A;  3PR9 A;  2ITK A;  3GPK A;  4DT4 A;  2RQS A;  4FAP A;  1JMQ A;  2RUD A;  2YSH A;  2OLH A;  1YAT A;  1ZU8 A;  1LL4 A;  3PRA A;  1SYT A;  3FY1 A;  1FKK A;  4QIB A;  1W1T A;  1E6P A;  1JCH B;  4ODL A;  2DPE A;  1Q6I A;  4KQZ A;  1FKG A;  2Y78 A;  3PA7 A;  3EIP A;  5GPG A;  1J4H A;  3VAW A;  1L1P A;  3KAG A;  1PBK A;  4IT6 A;  3BXW A;  2KFW A;  4J4N A;  4WJX A;  3M85 A;  3G6M A;  2M2A A;  3WL1 A;  1KT0 A;  1EG4 A;  1WAW A;  2DT0 A;  2LGO A;  4ITZ A;  1J6Y A;  2WK2 A;  3B7X A; 
#chains in the Genus database with same CATH homology
 3OOB A;  1XRV A;  1D7H A;  4FN2 A;  2K8I A;  1TFV A;  1LJY A;  5E66 A;  3MQH A;  3MDY B;  3O5J A;  1C9H A;  4DRK A;  2DG9 A;  4ODK A;  2KE0 A;  3LE4 A;  5DIT A;  2N87 A;  4WKA A;  4C02 B;  1H0G A;  1JNT A;  3QOK A;  1W1P A;  1TR8 A;  5E62 A;  1LG1 A;  4P8U A;  1EYM A;  3CGN A;  4ODP A;  2F21 A;  3JXV A;  3CHD A;  4DWS D;  1UR9 A;  3CHF A;  1Y0O A;  4MSP A;  3IK8 A;  2DK1 A;  1FAP A;  3RM8 A;  1E15 A;  4W5U A;  3CZ8 A;  2ZQS A;  1LG2 A;  2YBT A;  4U86 A;  1Q6H A;  4ZPV R;  2DT2 A;  2M08 A;  4DIP A;  1JND A;  3RFW A;  1BL4 A;  1OGG A;  1ZL1 A;  4DRN A;  1HJW A;  5U47 A;  3O5I A;  1TK7 A;  4DRI A;  4JFI A;  2OWO A;  4N19 A;  2XP8 A;  3O5E A;  4NNR A;  2M3O W;  3FXY A;  1W26 A;  2B31 A;  2KGJ A;  4DWS A;  4HBO A;  1F8A B;  2G41 A;  3ARP A;  4U85 A;  3IKG A;  4WIW A;  2ZQV A;  1B6C A;  3RME A;  2L4J A;  2MLY A;  3WD1 A;  3WQW A;  3WQV A;  3FSC A;  1EDQ A;  3WD4 A;  4NZC A;  1W1V A;  1ZBW A;  5GQB A;  3O5P A;  4W9Q A;  4IPX A;  3B9E A;  1TCO C;  2PV1 A;  4DRM A;  2VN1 A;  4GGQ A;  3WD2 A;  1W9P A;  2WAE A;  1LL7 A;  2DSV A;  5D75 A;  5HWB A;  2LJ4 A;  1N1A A;  4P8X A;  2QF8 A;  3KAF A;  4G50 A;  4TW7 A;  4Z2H A;  4JFJ A;  2ZAJ A;  2PPP A;  2XP5 A;  1XHG A;  1W9V A;  2JV4 A;  1FKD A;  4ML4 A;  2KR7 A;  3KAH A;  4Q7N A;  4P8V A;  3CHC A;  1LQ0 A;  2O9O A;  1O6I A;  1OGB A;  3NI6 A;  3B8S A;  4QT3 A;  1Q6U A;  1HKK A;  1ZB5 A;  3O5O A;  4ODO A;  2YSG A;  4XAK A;  1F40 A;  4S3J A;  2MLX A;  4ODR A;  1HKJ A;  4R0X A;  3MCB B;  4LAW A;  1WB0 A;  1NSG A;  1X6N A;  3RGC A;  1QPL A;  1QZ2 A;  4URI A;  4BF8 A;  1PIN A;  3AQU A;  3PQH A;  2IF4 A;  2AWG A;  4ZS6 A;  5DEZ A;  1WR7 A;  3ARS A;  5I98 A;  4E5R A;  1ZCN A;  2DT1 A;  1E6Z A;  3MCB A;  5J6E A;  3OA5 A;  3UI6 A;  3KAD A;  3KAC A;  2YAJ B;  1E6N A;  3KCE A;  4TW8 A;  2WLY A;  3ALG A;  3IHZ A;  5BXJ A;  4G2P A;  2WLZ A;  3TCZ A;  2DG3 A;  2MLZ A;  1FKT A;  2G8Z A;  1D2K A;  4DRJ A;  2F4E A;  4MNK A;  2XPB A;  1FKR A;  3O5R A;  3B9D A;  1QPF A;  1W9U A;  2PV3 A;  1E9L A;  2DWV A;  1BKF A;  4TYO A;  3RM4 A;  2E45 A;  1EHN A;  3JYJ A;  2XP6 A;  3TC5 A;  2PI6 A;  2D9F A;  4WKH A;  1FKH A;  1GUV A;  2O92 A;  5DIU A;  3WH0 A;  4QT2 A;  4P8W A;  4JFK A;  2Y8N B;  2M8I A;  2VCD A;  2WM0 A;  4MNL A;  2RSE A;  1OWQ A;  4IQC A;  2M8J A;  1JNE A;  5HW8 A;  3ARX A;  3O5D A;  2YSB A;  2Q5A A;  3L4H A;  4O2T A;  1ZBV A;  5AHT A;  2IUZ A;  2KI3 A;  2PBC A;  4MPK A;  1FKS A;  4S3K A;  2A3C A;  1EIB A;  2XPA A;  3LKX B;  2PV2 A;  3PRB A;  1RP5 A;  5HTG A;  1D7J A;  2RUQ A;  2ZR5 A;  3O5Q A;  1VF8 A;  2DMV A;  1FKL A;  3LUO A;  1X6L A;  4Z2I A;  1RD6 A;  4TX0 A;  1H0I A;  2XP4 A;  2DSZ A;  3ALF A;  2XP7 A;  2L2S A;  4ODM A;  4MAV A;  3MQG A;  1NMV A;  3ODK A;  1FD9 A;  2ZQU A;  3UQA A;  4DZ2 A;  5CQ2 A;  1LL6 A;  2YSF A;  4PTM A;  3KAB A;  2A3E A;  2DSU A;  5DO2 A;  4MTV A;  2DJY A;  4AY1 A;  1FKI A;  2DK7 A;  4DRO A;  3O5F A;  2FAP A;  4MGV A;  2DG4 A;  1HXV A;  2KO7 A;  1FKF A;  3B9A A;  1O6W A;  3KAI A;  4W9O A;  4KR0 B;  4HAR A;  4MNJ A;  4DRH A;  1UR8 A;  3UI4 A;  2LAJ A;  4HBE A;  3WL0 A;  1ZBK A;  5HWC A;  1JVW A;  4Z2J A;  3AS1 A;  5HW7 A;  3PRD A;  2PPO A;  1P5Q A;  2M1I A;  5HW6 A;  2XP3 A;  1FFR A;  5DIV A;  2PPN A;  2KXQ A;  3UF8 A;  2ZR4 A;  4JFM A;  4ZPW R;  5HT1 A;  3O5M A;  3AS2 A;  3ARO A;  2JZV A;  3RM9 A;  4IT4 A;  1HJX A;  1D6O A;  2DSW A;  1U79 A;  4GIV A;  4DH0 A;  1ZK6 A;  1M5Y A;  2ESC A;  3ARU A;  2LPV A;  3KZ7 A;  4IQ2 A;  2EZ5 W;  1HJV A;  1W1Y A;  4R5E A;  2UZ5 A;  4WKF A;  2MDI A;  3UI5 A;  4QZV B;  4L3N A;  4U84 A;  2ZQT A;  3FSB A;  4LAX A;  3ART A;  4DRQ A;  4NSB A;  3ARQ A;  2MNT A;  3I6C A;  1FKB A;  4WK9 A;  3TDB A;  1EG3 A;  4DWS C;  1D7I A;  1J4I A;  3ARR A;  2XP9 A;  1FFQ A;  3CH9 A;  2QRV A;  5B8I C;  3JYM A;  3G6L A;  1EQ3 A;  4GLX A;  4A0U A;  4JFL A;  1NWS A;  3O5G A;  3UQI A;  3CNG A;  3CGM A;  1R9H A;  4Z2L A;  5HBF A;  1K9R A;  1KT1 A;  4DZ3 A;  1ROU A;  2RUC A;  5E65 A;  3UQB A;  1ITX A;  1ZBC A;  2LKN A;  5GPR A;  2MPH A;  5DF0 A;  5HKG A;  5HUA A;  2FKE A;  1WMV A;  3WIJ A;  2OFN A;  3WD0 A;  1SR0 A;  2BA1 A;  3NRK A;  1HKM A;  1Q1C A;  3NTP A;  3O5K A;  4Z2G A;  3ARY A;  4LGX A;  4LAY A;  1K9Q A;  1A7X A;  1ROT A;  2RUR A;  4A0T A;  1T11 A;  1NWU A;  4ODQ A;  1J4R A;  1FKJ A;  2RE3 A;  4DWS B;  1FJD A;  3O5L A;  2JX8 A;  2A3A A;  1I5H W;  4ODN A;  2ZR6 A;  4J4O A;  1NWT A;  4Z2K A;  1HKI A;  1FLC A;  2JMF A;  2YSI A;  1GOI A;  3AS0 A;  1NH6 A;  4TNS A;  4TW6 A;  3W4R A;  1GPF A;  4ZPT R;  3H9R B;  5JH8 A;  3LKX A;  2FDM A;  3M7N A;  1IX5 A;  3IKD A;  4W9P A;  5E5W A;  1WNO A;  4REX A;  4L72 B;  3ARV A;  3WKZ A;  1KFW A;  1NMW A;  2AOS A;  2MF9 A;  3FS8 A;  2WAD A;  3EY6 A;  4MNM A;  2DT3 A;  4LAV A;  5E64 A;  2JXW A;  3WD3 A;  1E6R A;  3FAP A;  3ARZ A;  2YBU A;  3ARW A;  2F2D A;  1JNS A;  1CTN A;  4Q22 A;  1K9T A;  1YW5 A;  4JYS A;  3AS3 A;  3CHE A;  2A3B A;  4DRP A;  1NWR A;  3PR9 A;  2ITK A;  3GPK A;  4DT4 A;  2RQS A;  4FAP A;  1JMQ A;  2RUD A;  2YSH A;  2OLH A;  1YAT A;  1ZU8 A;  1LL4 A;  3PRA A;  1SYT A;  3FY1 A;  1FKK A;  4QIB A;  1W1T A;  1E6P A;  4ODL A;  2DPE A;  1Q6I A;  4KQZ A;  1FKG A;  2Y78 A;  3PA7 A;  5GPG A;  1J4H A;  3VAW A;  1L1P A;  3KAG A;  1PBK A;  4IT6 A;  3BXW A;  2KFW A;  4J4N A;  4WJX A;  3M85 A;  3G6M A;  2M2A A;  3WL1 A;  1KT0 A;  1EG4 A;  1WAW A;  2DT0 A;  2LGO A;  4ITZ A;  1J6Y A;  2WK2 A;  3B7X A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...