2XP3A

Discovery of cell-active phenyl-imidazole pin1 inhibitors by structure-guided fragment evolution
Total Genus 46
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
46
sequence length
157
structure length
145
Chain Sequence
LPPGWEKAMSRSSGRVYYFNHITNASQWERPSEPARVRCSHLLVKHSQSRRPSSWRQEKITRTKEEALELINGYIQKIKSGEEDFESLASQFSDCSSAKARGDLGAFSRGQMQKPFEDASFALRTGEMSGPVFTDSGIHIILRTE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Discovery of Cell-Active Phenyl-Imidazole Pin1 Inhibitors by Structure-Guided Fragment Evolution.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Isomerase
molecule keywords PEPTIDYL-PROLYL CIS-TRANS ISOMERASE NIMA-INTERACTING 1
total genus 46
structure length 145
sequence length 157
ec nomenclature ec 5.2.1.8: Peptidylprolyl isomerase.
pdb deposition date 2010-08-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00397 WW WW domain
A PF00639 Rotamase PPIC-type PPIASE domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.20.70.10 Mainly Beta Single Sheet Ubiquitin Ligase Nedd4; Chain: W; Ubiquitin Ligase Nedd4; Chain: W; 2xp3A01
3.10.50.40 Alpha Beta Roll Chitinase A; domain 3 Chitinase A; domain 3 2xp3A02
3JXVA 5HWCA 3TCZA 3KAHA 3KADA 3O5RA 3UI5A 4DT4A 2FKEA 2PPPA 4ODPA 5B8IC 1Q6HA 1PINA 2M08A 3IK8A 5HWBA 3KZ7A 2DJYA 2M8IA 5AHTA 2AWGA 2OFNA 1FKDA 1ROUA 2KFWA 3IHZA 3PA7A 4TNSA 3KAIA 4TYOA 2RQSA 1I5HW 4QT2A 2DWVA 1FKTA 4ODKA 3IKGA 2DG9A 2N87A 2M1IA 3KABA 3MDYB 1JNSA 2MPHA 1D7IA 1KT1A 2PPNA 2ZQSA 2LGOA 2YSBA 4DZ3A 4FN2A 2JMFA 1FJDA 1NMVA 1FKHA 4ODRA 1WMVA 1L1PA 2MLZA 2EZ5W 3CNGA 4JFLA 1YW5A 2JV4A 4G2PA 2F21A 4W9PA 5HW8A 4BF8A 2MF9A 2XP5A 1B6CA 5DIUA 4DRKA 2XP9A 2YSIA 2PV3A 4QT3A 3CGMA 2ZR4A 2KR7A 4DIPA 2ZR6A 1BL4A 3VAWA 4W9QA 2DMVA 1QPFA 2K8IA 2LPVA 2LKNA 4U85A 2E45A 1A7XA 3H9RB 3O5JA 4TW6A 4MGVA 1BKFA 2LAJA 1FD9A 3PRBA 2DK7A 3OOBA 2PV1A 3RFWA 3O5LA 1FKGA 3UQBA 4GIVA 1TK7A 2Q5AA 2KO7A 1KT0A 2RURA 1JNTA 2IF4A 2FAPA 3JYJA 1FKFA 4LAYA 3JYMA 2DK1A 3TC5A 1J4HA 2PBCA 2UZ5A 1Q1CA 4IQ2A 4LAWA 2ZQTA 4DRQA 1FKBA 4LAVA 3KAFA 1FKRA 3L4HA 2M8JA 2MNTA 4ITZA 4JYSA 2XP3A 1D7JA 2D9FA 1ROTA 4R0XA 5I98A 3UQAA 4NNRA 4G50A 2JXWA 4LAXA 2DG3A 1J4RA 2KGJA 2ZAJA 2ZQUA 1FAPA 2PV2A 1ZCNA 2ITKA 1ZK6A 3KCEA 1O6WA 1D7HA 3CGNA 1QZ2A 1K9RA 5BXJA 1YATA 4N19A 4ODOA 4TX0A 3EY6A 4DZ2A 3O5KA 4GGQA 3UF8A 1C9HA 3O5FA 2KE0A 2F2DA 1Q6IA 2MLYA 5HW7A 1R9HA 3NRKA 3IKDA 3M85A 4DH0A 4QIBA 3O5MA 4IQCA 4MSPA 4ODQA 4REXA 1J4IA 1NSGA 4J4OA 2RUDA 1FKSA 4DRHA 2YSHA 3LE4A 2PPOA 5HKGA 5HTGA 1F40A 3FAPA 2RSEA 3NI6A 2XP7A 3LUOA 4ODNA 2XP8A 2KI3A 3UI6A 3RGCA 3KACA 1JMQA 3GPKA 1EG4A 3O5IA 2JZVA 2XPBA 1EG3A 5HT1A 2M3OW 2RE3A 2MDIA 2YSFA 1PBKA 2LJ4A 4E5RA 1JVWA 5CQ2A 1FKLA 3M7NA 2XP6A 5J6EA 1EQ3A 3O5OA 4FAPA 4ODLA 2YSGA 2XP4A 1HXVA 2Y78A 3B7XA 3PRDA 2VN1A 3O5EA 1W26A 2DG4A 5HUAA 4DRNA 4JFJA 3O5DA 1K9QA 1J6YA 1FKIA 1Q6UA 3TDBA 2RUCA 4DRIA 1M5YA 3O5GA 5GPGA 4DRJA 1Y0OA 2JX8A 2RUQA 4J4NA 1U79A 1FKKA 3O5QA 2BA1A 5DITA 2ZR5A 1FKJA 4ODMA 2M2AA 2L4JA 4JFMA 5D75A 4TW7A 1P5QA 2XPAA 3UI4A 4DRMA 2ZQVA 3UQIA 1N1AA 3NTPA 2L2SA 1EYMA 2F4EA 3I6CA 1D6OA 3KAGA 4U86A 1NMWA 1QPLA 1F8AB 5DIVA 4JFIA 4TW8A 3ODKA 4IPXA 4DROA 4JFKA 4DRPA 1WR7A 1T11A 2VCDA 3WH0A 4O2TA 4U84A 3O5PA 4W9OA 5HW6A 1TCOC 4C02B 2MLXA 2KXQA
chains in the Genus database with same CATH superfamily
1OGGA 3WD0A 5HWCA 2B31A 3KAHA 3UI5A 5B8IC 1Q6HA 1PINA 5HWBA 4Z2JA 4TYOA 4URIA 1ROUA 1RD6A 4WIWA 5E62A 4QT2A 3MDYB 1D7IA 3WIJA 2YSBA 4FN2A 1NMVA 1FKHA 5GPRA 1L1PA 1LL4A 2MLZA 4JFLA 4MNKA 1YW5A 1EIBA 5HW8A 5DIUA 2XP9A 2PV3A 2ZR6A 1BL4A 2LPVA 3O5JA 2LKNA 2F23A 1ZBVA 2ESCA 4MPKA 3AS3A 3CHEA 3OOBA 2PV1A 3RFWA 4UDMA 2DK1A 3TC5A 1J4HA 4S3KA 1D2KA 3B8SA 3L4HA 3EIPA 4ITZA 1HJXA 2MNTA 4JYSA 4R0XA 4LAXA 1J4RA 1HKKA 1FAPA 2OWOA 1ZCNA 3KCEA 1D7HA 1QZ2A 3ARZA 4ZPVR 4ODOA 3EY6A 3ARWA 1Q6IA 2MLYA 3ARQA 3NRKA 3IKDA 1JNDA 1ZB5A 1J4IA 3BXWA 1ZL1A 4DRHA 4AY1A 2O92A 3WL1A 2RSEA 2XP8A 1EG4A 1W1TA 1EG3A 1W1YA 2MDIA 3RM8A 1E6ZA 2WLYA 4P8XA 1X6LA 1UR8A 1W9PA 4ML4A 3O5OA 4ODLA 2YSGA 2Y78A 3FY1A 2DG4A 4JFJA 1WB0A 1Q6UA 4DWSB 4DRIA 2IUZA 3O5GA 2G41A 1Y0OA 3WKZA 5D75A 2L4JA 4MAVA 1P5QA 3UI4A 3UQIA 1N1AA 1NWSA 2L2SA 1TR8A 3WL0A 1D6OA 1QPLA 1NMWA 1JNEA 4C02B 1TCOC 1LQ0A 3JXVA 3WQVA 1H0GA 4S3JA 4ZS6A 3TCZA 3O5RA 4Z2IA 1E44A 3B9DA 2FKEA 2PPPA 2DSZA 4MNJA 4ODPA 2M08A 3KZ7A 4L3NA 2DJYA 3AS1A 3IHZA 3PA7A 1FKDA 2KFWA 4TNSA 1JNSA 2MPHA 2PPNA 2LGOA 3PQHA 2WLZA 4ZPTR 4G2PA 2JV4A 4W9PA 4BF8A 2XP5A 1ZBKA 2YSIA 4DRKA 4DIPA 2PI6A 5E5WA 5E65A 1QPFA 2K8IA 4U85A 4TW6A 1W9VA 4R5EA 4DWSC 3O5LA 3UQBA 2RURA 1ITXA 1JNTA 2AOSA 3JYJA 1FJDA 1FKFA 3MCBA 2WK2A 2EULA 2A3CA 2PN0A 4LAVA 3KAFA 1WAWA 1GPFA 5HBFA 2D9FA 1ROTA 4NNRA 4G50A 2DG3A 1SR0A 2KGJA 2ZQUA 1X6NA 4KQZA 1K9RA 5BXJA 4N19A 4GGQA 4A0TA 1NWUA 2P4VA 3FS8A 5HW7A 1W1PA 4Z2HA 3ARVA 4ODQA 2RUDA 3AS2A 2PPOA 5HKGA 4Q22A 3G6MA 3CH9A 3O5IA 3WD2A 2QF8A 3ARUA 5HT1A 2YSFA 1PBKA 2LJ4A 4E5RA 1JVWA 5U47A 5CQ2A 1FKLA 1GRJA 3CZ8A 1HKJA 2DSVA 3B9EA 1K9TA 4IT4A 1EQ3A 4HARA 3PRDA 2Y8NB 4Z2LA 1NH6A 3CHDA 4NZCA 4DRNA 3O5DA 1FLCA 1K9QA 1FKIA 5HUAA 1J6YA 4HBEA 3RM4A 1M5YA 3AS0A 3MQGA 4DRJA 2JX8A 4J4NA 1U79A 1FKKA 1OGBA 2BA1A 2QRVA 1FKJA 4ODMA 1E15A 3WQWA 2XPAA 2ZQVA 2F4EA 4DROA 3GTYX 4TW8A 3ODKA 1ZBCA 4IPXA 2A3BA 1WR7A 1T11A 4DRPA 4O2TA 3O5PA 5HW6A 3ARSA 4L72B 2DSUA 2KXQA 4DT4A 1GOIA 1NWRA 2M8IA 5AHTA 2AWGA 2ETNA 2OFNA 2WAEA 2OLHA 3KABA 1EDQA 4DZ3A 4DWSD 4ODRA 1WMVA 1CTNA 2WADA 1E6NA 1LG2A 2MF9A 1B6CA 4QT3A 3CGMA 5E64A 2KR7A 1H0IA 1HKMA 4W9QA 3GU0A 3H9RB 4LGXA 2E45A 1A7XA 4MGVA 1FD9A 4WKAA 3WD1A 2DK7A 1GUVA 3FSCA 3LKXB 3WD3A 5DO2A 2KO7A 2Q5AA 1KT0A 4LAYA 4DZ2A 2FAPA 4IQ2A 1Q1CA 2B5UB 2ZQTA 1FKRA 1FKBA 4WK9A 2M8JA 2XP3A 3W4RA 5GQBA 3AQUA 3ARRA 2ZAJA 2PV2A 1OWQA 2ITKA 1ZK6A 3ARPA 2DSWA 1FFRA 3UF8A 5JH8A 1C9HA 1HKIA 1KFWA 1LG1A 2KE0A 1R9HA 1ZBWA 5DF0A 3M85A 4DH0A 3QOKA 3LKXA 3O5MA 4MSPA 1NSGA 4J4OA 1FKSA 2YSHA 3LE4A 2DT0A 1F40A 3FAPA 4ZPWR 2XP7A 1SYTA 2KI3A 3UI6A 3BMBA 2DT3A 2JZVA 4GLXA 2RE3A 1WNOA 3MCBB 2DPEA 1O6IA 3ARTA 2YBUA 1JCHB 2XP6A 1NWTA 4MNMA 4Z2KA 3B7XA 3O5EA 1W26A 1HJWA 1TFVA 3TDBA 2DT1A 3RMEA 4IT6A 1HXVA 2M2AA 4DRMA 4TW7A 3MQHA 1EYMA 1HJVA 3I6CA 4JFKA 2G8ZA 2MLXA 3FXYA 3G6LA 3KADA 1LL6A 3PRAA 3IK8A 4XAKA 3CHFA 1W9UA 3KAIA 2YBTA 2RQSA 1I5HW 2DWVA 1FKTA 4MNLA 3IKGA 2DG9A 2N87A 2M1IA 4ODKA 4HBOA 1KT1A 2ZQSA 2JMFA 2A3AA 3OA5A 2EZ5W 3CNGA 5E66A 2F21A 4KR0B 3WD4A 1E6PA 2ZR4A 1XHGA 3VAWA 2DMVA 3FSBA 1LL7A 4Q7NA 1BKFA 2LAJA 3PR9A 2O9OA 3PRBA 1IX5A 4NSBA 2DT2A 1FKGA 3ARXA 4GIVA 1TK7A 1E6RA 4ODNA 4WKHA 1RP5A 2IF4A 5DIVA 3JYMA 4P8WA 2UZ5A 4LAWA 1E9LA 2PBCA 4DRQA 5I98A 1D7JA 3UQAA 2JXWA 4Z2GA 4DWSA 3CGNA 1O6WA 1YATA 4TX0A 4QZVB 3O5KA 4WKFA 3O5FA 2F2DA 3ALGA 3ALFA 4WJXA 4QIBA 2WM0A 3ARYA 4IQCA 4REXA 1LJYA 5HTGA 3RM9A 3CHCA 3NI6A 2A3EA 3LUOA 4MTVA 3RGCA 3KACA 1JMQA 1FFQA 3GPKA 2XPBA 2M3OW 2FDMA 5DEZA 1W1VA 3M7NA 5J6EA 4FAPA 2XP4A 1EHNA 1VF8A 4P8UA 2VN1A 1ZU8A 3B9AA 2RUCA 4PTMA 5GPGA 4P8VA 2RUQA 3AROA 3O5QA 5DITA 2ZR5A 4W5UA 4JFMA 3NTPA 3KAGA 4U86A 1UR9A 1F8AB 1XRVA 4JFIA 2VCDA 3WH0A 4U84A 4W9OA 4A0UA 2YAJB
chains in the Genus database with same CATH topology
1OGGA 3WD0A 5HWCA 2B31A 3KAHA 3UI5A 5B8IC 1Q6HA 1PINA 5HWBA 4Z2JA 4TYOA 4URIA 1ROUA 1RD6A 4WIWA 5E62A 4QT2A 3MDYB 1D7IA 3WIJA 2YSBA 4FN2A 1NMVA 1FKHA 5GPRA 1L1PA 1LL4A 2MLZA 4JFLA 4MNKA 1YW5A 1EIBA 5HW8A 5DIUA 2XP9A 2PV3A 2ZR6A 1BL4A 2LPVA 3O5JA 2LKNA 1ZBVA 2ESCA 4MPKA 3AS3A 3CHEA 3OOBA 2PV1A 3RFWA 2DK1A 3TC5A 1J4HA 4S3KA 1D2KA 3B8SA 3L4HA 4ITZA 1HJXA 2MNTA 4JYSA 4R0XA 4LAXA 1J4RA 1HKKA 1FAPA 2OWOA 1ZCNA 3KCEA 1D7HA 1QZ2A 3ARZA 4ZPVR 4ODOA 3EY6A 3ARWA 1Q6IA 2MLYA 3ARQA 3NRKA 3IKDA 1JNDA 1ZB5A 1J4IA 3BXWA 1ZL1A 4DRHA 4AY1A 2O92A 3WL1A 2RSEA 2XP8A 1EG4A 1W1TA 1EG3A 1W1YA 2MDIA 3RM8A 1E6ZA 2WLYA 4P8XA 1X6LA 1UR8A 1W9PA 4ML4A 3O5OA 4ODLA 2YSGA 2Y78A 3FY1A 2DG4A 4JFJA 1WB0A 1Q6UA 4DWSB 4DRIA 2IUZA 3O5GA 2G41A 1Y0OA 3WKZA 5D75A 2L4JA 4MAVA 1P5QA 3UI4A 3UQIA 1N1AA 1NWSA 2L2SA 1TR8A 3WL0A 1D6OA 1QPLA 1NMWA 1JNEA 4C02B 1TCOC 1LQ0A 3JXVA 3WQVA 1H0GA 4S3JA 4ZS6A 3TCZA 3O5RA 4Z2IA 3B9DA 2FKEA 2PPPA 2DSZA 4MNJA 4ODPA 2M08A 3KZ7A 4L3NA 2DJYA 3AS1A 3IHZA 3PA7A 1FKDA 2KFWA 4TNSA 1JNSA 2MPHA 2PPNA 2LGOA 3PQHA 2WLZA 4ZPTR 4G2PA 2JV4A 4W9PA 4BF8A 2XP5A 1ZBKA 2YSIA 4DRKA 4DIPA 2PI6A 5E5WA 5E65A 1QPFA 2K8IA 4U85A 4TW6A 1W9VA 4R5EA 4DWSC 3O5LA 3UQBA 2RURA 1ITXA 1JNTA 2AOSA 3JYJA 1FJDA 1FKFA 3MCBA 2WK2A 2A3CA 4LAVA 3KAFA 1WAWA 1GPFA 5HBFA 2D9FA 1ROTA 4NNRA 4G50A 2DG3A 1SR0A 2KGJA 2ZQUA 1X6NA 4KQZA 1K9RA 5BXJA 4N19A 4GGQA 4A0TA 1NWUA 3FS8A 5HW7A 1W1PA 4Z2HA 3ARVA 4ODQA 2RUDA 3AS2A 2PPOA 5HKGA 4Q22A 3G6MA 3CH9A 3O5IA 3WD2A 2QF8A 3ARUA 5HT1A 2YSFA 1PBKA 2LJ4A 4E5RA 1JVWA 5U47A 5CQ2A 1FKLA 3CZ8A 1HKJA 2DSVA 3B9EA 1K9TA 4IT4A 1EQ3A 4HARA 3PRDA 2Y8NB 4Z2LA 1NH6A 3CHDA 4NZCA 4DRNA 3O5DA 1FLCA 1K9QA 1FKIA 5HUAA 1J6YA 4HBEA 3RM4A 1M5YA 3AS0A 3MQGA 4DRJA 2JX8A 4J4NA 1U79A 1FKKA 1OGBA 2BA1A 2QRVA 1FKJA 4ODMA 1E15A 3WQWA 2XPAA 2ZQVA 2F4EA 4DROA 4TW8A 3ODKA 1ZBCA 4IPXA 2A3BA 1WR7A 1T11A 4DRPA 4O2TA 3O5PA 5HW6A 3ARSA 4L72B 2DSUA 2KXQA 4DT4A 1GOIA 1NWRA 2M8IA 5AHTA 2AWGA 2OFNA 2WAEA 2OLHA 3KABA 1EDQA 4DZ3A 4DWSD 4ODRA 1WMVA 1CTNA 2WADA 1E6NA 1LG2A 2MF9A 1B6CA 4QT3A 3CGMA 5E64A 2KR7A 1H0IA 1HKMA 4W9QA 3H9RB 4LGXA 2E45A 1A7XA 4MGVA 1FD9A 4WKAA 3WD1A 2DK7A 1GUVA 3FSCA 3LKXB 3WD3A 5DO2A 2KO7A 2Q5AA 1KT0A 4LAYA 4DZ2A 2FAPA 4IQ2A 1Q1CA 2ZQTA 1FKRA 1FKBA 4WK9A 2M8JA 2XP3A 3W4RA 5GQBA 3AQUA 3ARRA 2ZAJA 2PV2A 1OWQA 2ITKA 1ZK6A 3ARPA 2DSWA 1FFRA 3UF8A 5JH8A 1C9HA 1HKIA 1KFWA 1LG1A 2KE0A 1R9HA 1ZBWA 5DF0A 3M85A 4DH0A 3QOKA 3LKXA 3O5MA 4MSPA 1NSGA 4J4OA 1FKSA 2YSHA 3LE4A 2DT0A 1F40A 3FAPA 4ZPWR 2XP7A 1SYTA 2KI3A 3UI6A 2DT3A 2JZVA 4GLXA 2RE3A 1WNOA 3MCBB 2DPEA 1O6IA 3ARTA 2YBUA 2XP6A 1NWTA 4MNMA 4Z2KA 3B7XA 3O5EA 1W26A 1HJWA 1TFVA 3TDBA 2DT1A 3RMEA 4IT6A 1HXVA 2M2AA 4DRMA 4TW7A 3MQHA 1EYMA 1HJVA 3I6CA 4JFKA 2G8ZA 2MLXA 3FXYA 3G6LA 3KADA 1LL6A 3PRAA 3IK8A 4XAKA 3CHFA 1W9UA 3KAIA 2YBTA 2RQSA 1I5HW 2DWVA 1FKTA 4MNLA 3IKGA 2DG9A 2N87A 2M1IA 4ODKA 4HBOA 1KT1A 2ZQSA 2JMFA 2A3AA 3OA5A 2EZ5W 3CNGA 5E66A 2F21A 4KR0B 3WD4A 1E6PA 2ZR4A 1XHGA 3VAWA 2DMVA 3FSBA 1LL7A 4Q7NA 1BKFA 2LAJA 3PR9A 2O9OA 3PRBA 1IX5A 4NSBA 2DT2A 1FKGA 3ARXA 4GIVA 1TK7A 1E6RA 4ODNA 4WKHA 1RP5A 2IF4A 5DIVA 3JYMA 4P8WA 2UZ5A 4LAWA 1E9LA 2PBCA 4DRQA 5I98A 1D7JA 3UQAA 2JXWA 4Z2GA 4DWSA 3CGNA 1O6WA 1YATA 4TX0A 4QZVB 3O5KA 4WKFA 3O5FA 2F2DA 3ALGA 3ALFA 4WJXA 4QIBA 2WM0A 3ARYA 4IQCA 4REXA 1LJYA 5HTGA 3RM9A 3CHCA 3NI6A 2A3EA 3LUOA 4MTVA 3RGCA 3KACA 1JMQA 1FFQA 3GPKA 2XPBA 2M3OW 2FDMA 5DEZA 1W1VA 3M7NA 5J6EA 4FAPA 2XP4A 1EHNA 1VF8A 4P8UA 2VN1A 1ZU8A 3B9AA 2RUCA 4PTMA 5GPGA 4P8VA 2RUQA 3AROA 3O5QA 5DITA 2ZR5A 4W5UA 4JFMA 3NTPA 3KAGA 4U86A 1UR9A 1F8AB 1XRVA 4JFIA 2VCDA 3WH0A 4U84A 4W9OA 4A0UA 2YAJB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3JXV A;  5HWC A;  3TCZ A;  3KAH A;  3KAD A;  3O5R A;  3UI5 A;  4DT4 A;  2FKE A;  2PPP A;  4ODP A;  5B8I C;  1Q6H A;  1PIN A;  2M08 A;  3IK8 A;  5HWB A;  3KZ7 A;  2DJY A;  2M8I A;  5AHT A;  2AWG A;  2OFN A;  1FKD A;  1ROU A;  2KFW A;  3IHZ A;  3PA7 A;  4TNS A;  3KAI A;  4TYO A;  2RQS A;  1I5H W;  4QT2 A;  2DWV A;  1FKT A;  4ODK A;  3IKG A;  2DG9 A;  2N87 A;  2M1I A;  3KAB A;  3MDY B;  1JNS A;  2MPH A;  1D7I A;  1KT1 A;  2PPN A;  2ZQS A;  2LGO A;  2YSB A;  4DZ3 A;  4FN2 A;  2JMF A;  1FJD A;  1NMV A;  1FKH A;  4ODR A;  1WMV A;  1L1P A;  2MLZ A;  2EZ5 W;  3CNG A;  4JFL A;  1YW5 A;  2JV4 A;  4G2P A;  2F21 A;  4W9P A;  5HW8 A;  4BF8 A;  2MF9 A;  2XP5 A;  1B6C A;  5DIU A;  4DRK A;  2XP9 A;  2YSI A;  2PV3 A;  4QT3 A;  3CGM A;  2ZR4 A;  2KR7 A;  4DIP A;  2ZR6 A;  1BL4 A;  3VAW A;  4W9Q A;  2DMV A;  1QPF A;  2K8I A;  2LPV A;  2LKN A;  4U85 A;  2E45 A;  1A7X A;  3H9R B;  3O5J A;  4TW6 A;  4MGV A;  1BKF A;  2LAJ A;  1FD9 A;  3PRB A;  2DK7 A;  3OOB A;  2PV1 A;  3RFW A;  3O5L A;  1FKG A;  3UQB A;  4GIV A;  1TK7 A;  2Q5A A;  2KO7 A;  1KT0 A;  2RUR A;  1JNT A;  2IF4 A;  2FAP A;  3JYJ A;  1FKF A;  4LAY A;  3JYM A;  2DK1 A;  3TC5 A;  1J4H A;  2PBC A;  2UZ5 A;  1Q1C A;  4IQ2 A;  4LAW A;  2ZQT A;  4DRQ A;  1FKB A;  4LAV A;  3KAF A;  1FKR A;  3L4H A;  2M8J A;  2MNT A;  4ITZ A;  4JYS A;  2XP3 A;  1D7J A;  2D9F A;  1ROT A;  4R0X A;  5I98 A;  3UQA A;  4NNR A;  4G50 A;  2JXW A;  4LAX A;  2DG3 A;  1J4R A;  2KGJ A;  2ZAJ A;  2ZQU A;  1FAP A;  2PV2 A;  1ZCN A;  2ITK A;  1ZK6 A;  3KCE A;  1O6W A;  1D7H A;  3CGN A;  1QZ2 A;  1K9R A;  5BXJ A;  1YAT A;  4N19 A;  4ODO A;  4TX0 A;  3EY6 A;  4DZ2 A;  3O5K A;  4GGQ A;  3UF8 A;  1C9H A;  3O5F A;  2KE0 A;  2F2D A;  1Q6I A;  2MLY A;  5HW7 A;  1R9H A;  3NRK A;  3IKD A;  3M85 A;  4DH0 A;  4QIB A;  3O5M A;  4IQC A;  4MSP A;  4ODQ A;  4REX A;  1J4I A;  1NSG A;  4J4O A;  2RUD A;  1FKS A;  4DRH A;  2YSH A;  3LE4 A;  2PPO A;  5HKG A;  5HTG A;  1F40 A;  3FAP A;  2RSE A;  3NI6 A;  2XP7 A;  3LUO A;  4ODN A;  2XP8 A;  2KI3 A;  3UI6 A;  3RGC A;  3KAC A;  1JMQ A;  3GPK A;  1EG4 A;  3O5I A;  2JZV A;  2XPB A;  1EG3 A;  5HT1 A;  2M3O W;  2RE3 A;  2MDI A;  2YSF A;  1PBK A;  2LJ4 A;  4E5R A;  1JVW A;  5CQ2 A;  1FKL A;  3M7N A;  2XP6 A;  5J6E A;  1EQ3 A;  3O5O A;  4FAP A;  4ODL A;  2YSG A;  2XP4 A;  1HXV A;  2Y78 A;  3B7X A;  3PRD A;  2VN1 A;  3O5E A;  1W26 A;  2DG4 A;  5HUA A;  4DRN A;  4JFJ A;  3O5D A;  1K9Q A;  1J6Y A;  1FKI A;  1Q6U A;  3TDB A;  2RUC A;  4DRI A;  1M5Y A;  3O5G A;  5GPG A;  4DRJ A;  1Y0O A;  2JX8 A;  2RUQ A;  4J4N A;  1U79 A;  1FKK A;  3O5Q A;  2BA1 A;  5DIT A;  2ZR5 A;  1FKJ A;  4ODM A;  2M2A A;  2L4J A;  4JFM A;  5D75 A;  4TW7 A;  1P5Q A;  2XPA A;  3UI4 A;  4DRM A;  2ZQV A;  3UQI A;  1N1A A;  3NTP A;  2L2S A;  1EYM A;  2F4E A;  3I6C A;  1D6O A;  3KAG A;  4U86 A;  1NMW A;  1QPL A;  1F8A B;  5DIV A;  4JFI A;  4TW8 A;  3ODK A;  4IPX A;  4DRO A;  4JFK A;  4DRP A;  1WR7 A;  1T11 A;  2VCD A;  3WH0 A;  4O2T A;  4U84 A;  3O5P A;  4W9O A;  5HW6 A;  1TCO C;  4C02 B;  2MLX A;  2KXQ A; 
#chains in the Genus database with same CATH topology
 1OGG A;  3WD0 A;  5HWC A;  2B31 A;  3KAH A;  3UI5 A;  5B8I C;  1Q6H A;  1PIN A;  5HWB A;  4Z2J A;  4TYO A;  4URI A;  1ROU A;  1RD6 A;  4WIW A;  5E62 A;  4QT2 A;  3MDY B;  1D7I A;  3WIJ A;  2YSB A;  4FN2 A;  1NMV A;  1FKH A;  5GPR A;  1L1P A;  1LL4 A;  2MLZ A;  4JFL A;  4MNK A;  1YW5 A;  1EIB A;  5HW8 A;  5DIU A;  2XP9 A;  2PV3 A;  2ZR6 A;  1BL4 A;  2LPV A;  3O5J A;  2LKN A;  2F23 A;  1ZBV A;  2ESC A;  4MPK A;  3AS3 A;  3CHE A;  3OOB A;  2PV1 A;  3RFW A;  4UDM A;  2DK1 A;  3TC5 A;  1J4H A;  4S3K A;  1D2K A;  3B8S A;  3L4H A;  3EIP A;  4ITZ A;  1HJX A;  2MNT A;  4JYS A;  4R0X A;  4LAX A;  1J4R A;  1HKK A;  1FAP A;  2OWO A;  1ZCN A;  3KCE A;  1D7H A;  1QZ2 A;  3ARZ A;  4ZPV R;  4ODO A;  3EY6 A;  3ARW A;  1Q6I A;  2MLY A;  3ARQ A;  3NRK A;  3IKD A;  1JND A;  1ZB5 A;  1J4I A;  3BXW A;  1ZL1 A;  4DRH A;  4AY1 A;  2O92 A;  3WL1 A;  2RSE A;  2XP8 A;  1EG4 A;  1W1T A;  1EG3 A;  1W1Y A;  2MDI A;  3RM8 A;  1E6Z A;  2WLY A;  4P8X A;  1X6L A;  1UR8 A;  1W9P A;  4ML4 A;  3O5O A;  4ODL A;  2YSG A;  2Y78 A;  3FY1 A;  2DG4 A;  4JFJ A;  1WB0 A;  1Q6U A;  4DWS B;  4DRI A;  2IUZ A;  3O5G A;  2G41 A;  1Y0O A;  3WKZ A;  5D75 A;  2L4J A;  4MAV A;  1P5Q A;  3UI4 A;  3UQI A;  1N1A A;  1NWS A;  2L2S A;  1TR8 A;  3WL0 A;  1D6O A;  1QPL A;  1NMW A;  1JNE A;  4C02 B;  1TCO C;  1LQ0 A;  3JXV A;  3WQV A;  1H0G A;  4S3J A;  4ZS6 A;  3TCZ A;  3O5R A;  4Z2I A;  1E44 A;  3B9D A;  2FKE A;  2PPP A;  2DSZ A;  4MNJ A;  4ODP A;  2M08 A;  3KZ7 A;  4L3N A;  2DJY A;  3AS1 A;  3IHZ A;  3PA7 A;  1FKD A;  2KFW A;  4TNS A;  1JNS A;  2MPH A;  2PPN A;  2LGO A;  3PQH A;  2WLZ A;  4ZPT R;  4G2P A;  2JV4 A;  4W9P A;  4BF8 A;  2XP5 A;  1ZBK A;  2YSI A;  4DRK A;  4DIP A;  2PI6 A;  5E5W A;  5E65 A;  1QPF A;  2K8I A;  4U85 A;  4TW6 A;  1W9V A;  4R5E A;  4DWS C;  3O5L A;  3UQB A;  2RUR A;  1ITX A;  1JNT A;  2AOS A;  3JYJ A;  1FJD A;  1FKF A;  3MCB A;  2WK2 A;  2EUL A;  2A3C A;  2PN0 A;  4LAV A;  3KAF A;  1WAW A;  1GPF A;  5HBF A;  2D9F A;  1ROT A;  4NNR A;  4G50 A;  2DG3 A;  1SR0 A;  2KGJ A;  2ZQU A;  1X6N A;  4KQZ A;  1K9R A;  5BXJ A;  4N19 A;  4GGQ A;  4A0T A;  1NWU A;  2P4V A;  3FS8 A;  5HW7 A;  1W1P A;  4Z2H A;  3ARV A;  4ODQ A;  2RUD A;  3AS2 A;  2PPO A;  5HKG A;  4Q22 A;  3G6M A;  3CH9 A;  3O5I A;  3WD2 A;  2QF8 A;  3ARU A;  5HT1 A;  2YSF A;  1PBK A;  2LJ4 A;  4E5R A;  1JVW A;  5U47 A;  5CQ2 A;  1FKL A;  1GRJ A;  3CZ8 A;  1HKJ A;  2DSV A;  3B9E A;  1K9T A;  4IT4 A;  1EQ3 A;  4HAR A;  3PRD A;  2Y8N B;  4Z2L A;  1NH6 A;  3CHD A;  4NZC A;  4DRN A;  3O5D A;  1FLC A;  1K9Q A;  1FKI A;  5HUA A;  1J6Y A;  4HBE A;  3RM4 A;  1M5Y A;  3AS0 A;  3MQG A;  4DRJ A;  2JX8 A;  4J4N A;  1U79 A;  1FKK A;  1OGB A;  2BA1 A;  2QRV A;  1FKJ A;  4ODM A;  1E15 A;  3WQW A;  2XPA A;  2ZQV A;  2F4E A;  4DRO A;  3GTY X;  4TW8 A;  3ODK A;  1ZBC A;  4IPX A;  2A3B A;  1WR7 A;  1T11 A;  4DRP A;  4O2T A;  3O5P A;  5HW6 A;  3ARS A;  4L72 B;  2DSU A;  2KXQ A;  4DT4 A;  1GOI A;  1NWR A;  2M8I A;  5AHT A;  2AWG A;  2ETN A;  2OFN A;  2WAE A;  2OLH A;  3KAB A;  1EDQ A;  4DZ3 A;  4DWS D;  4ODR A;  1WMV A;  1CTN A;  2WAD A;  1E6N A;  1LG2 A;  2MF9 A;  1B6C A;  4QT3 A;  3CGM A;  5E64 A;  2KR7 A;  1H0I A;  1HKM A;  4W9Q A;  3GU0 A;  3H9R B;  4LGX A;  2E45 A;  1A7X A;  4MGV A;  1FD9 A;  4WKA A;  3WD1 A;  2DK7 A;  1GUV A;  3FSC A;  3LKX B;  3WD3 A;  5DO2 A;  2KO7 A;  2Q5A A;  1KT0 A;  4LAY A;  4DZ2 A;  2FAP A;  4IQ2 A;  1Q1C A;  2B5U B;  2ZQT A;  1FKR A;  1FKB A;  4WK9 A;  2M8J A;  2XP3 A;  3W4R A;  5GQB A;  3AQU A;  3ARR A;  2ZAJ A;  2PV2 A;  1OWQ A;  2ITK A;  1ZK6 A;  3ARP A;  2DSW A;  1FFR A;  3UF8 A;  5JH8 A;  1C9H A;  1HKI A;  1KFW A;  1LG1 A;  2KE0 A;  1R9H A;  1ZBW A;  5DF0 A;  3M85 A;  4DH0 A;  3QOK A;  3LKX A;  3O5M A;  4MSP A;  1NSG A;  4J4O A;  1FKS A;  2YSH A;  3LE4 A;  2DT0 A;  1F40 A;  3FAP A;  4ZPW R;  2XP7 A;  1SYT A;  2KI3 A;  3UI6 A;  3BMB A;  2DT3 A;  2JZV A;  4GLX A;  2RE3 A;  1WNO A;  3MCB B;  2DPE A;  1O6I A;  3ART A;  2YBU A;  1JCH B;  2XP6 A;  1NWT A;  4MNM A;  4Z2K A;  3B7X A;  3O5E A;  1W26 A;  1HJW A;  1TFV A;  3TDB A;  2DT1 A;  3RME A;  4IT6 A;  1HXV A;  2M2A A;  4DRM A;  4TW7 A;  3MQH A;  1EYM A;  1HJV A;  3I6C A;  4JFK A;  2G8Z A;  2MLX A;  3FXY A;  3G6L A;  3KAD A;  1LL6 A;  3PRA A;  3IK8 A;  4XAK A;  3CHF A;  1W9U A;  3KAI A;  2YBT A;  2RQS A;  1I5H W;  2DWV A;  1FKT A;  4MNL A;  3IKG A;  2DG9 A;  2N87 A;  2M1I A;  4ODK A;  4HBO A;  1KT1 A;  2ZQS A;  2JMF A;  2A3A A;  3OA5 A;  2EZ5 W;  3CNG A;  5E66 A;  2F21 A;  4KR0 B;  3WD4 A;  1E6P A;  2ZR4 A;  1XHG A;  3VAW A;  2DMV A;  3FSB A;  1LL7 A;  4Q7N A;  1BKF A;  2LAJ A;  3PR9 A;  2O9O A;  3PRB A;  1IX5 A;  4NSB A;  2DT2 A;  1FKG A;  3ARX A;  4GIV A;  1TK7 A;  1E6R A;  4ODN A;  4WKH A;  1RP5 A;  2IF4 A;  5DIV A;  3JYM A;  4P8W A;  2UZ5 A;  4LAW A;  1E9L A;  2PBC A;  4DRQ A;  5I98 A;  1D7J A;  3UQA A;  2JXW A;  4Z2G A;  4DWS A;  3CGN A;  1O6W A;  1YAT A;  4TX0 A;  4QZV B;  3O5K A;  4WKF A;  3O5F A;  2F2D A;  3ALG A;  3ALF A;  4WJX A;  4QIB A;  2WM0 A;  3ARY A;  4IQC A;  4REX A;  1LJY A;  5HTG A;  3RM9 A;  3CHC A;  3NI6 A;  2A3E A;  3LUO A;  4MTV A;  3RGC A;  3KAC A;  1JMQ A;  1FFQ A;  3GPK A;  2XPB A;  2M3O W;  2FDM A;  5DEZ A;  1W1V A;  3M7N A;  5J6E A;  4FAP A;  2XP4 A;  1EHN A;  1VF8 A;  4P8U A;  2VN1 A;  1ZU8 A;  3B9A A;  2RUC A;  4PTM A;  5GPG A;  4P8V A;  2RUQ A;  3ARO A;  3O5Q A;  5DIT A;  2ZR5 A;  4W5U A;  4JFM A;  3NTP A;  3KAG A;  4U86 A;  1UR9 A;  1F8A B;  1XRV A;  4JFI A;  2VCD A;  3WH0 A;  4U84 A;  4W9O A;  4A0U A;  2YAJ B; 
#chains in the Genus database with same CATH homology
 1OGG A;  3WD0 A;  5HWC A;  2B31 A;  3KAH A;  3UI5 A;  5B8I C;  1Q6H A;  1PIN A;  5HWB A;  4Z2J A;  4TYO A;  4URI A;  1ROU A;  1RD6 A;  4WIW A;  5E62 A;  4QT2 A;  3MDY B;  1D7I A;  3WIJ A;  2YSB A;  4FN2 A;  1NMV A;  1FKH A;  5GPR A;  1L1P A;  1LL4 A;  2MLZ A;  4JFL A;  4MNK A;  1YW5 A;  1EIB A;  5HW8 A;  5DIU A;  2XP9 A;  2PV3 A;  2ZR6 A;  1BL4 A;  2LPV A;  3O5J A;  2LKN A;  1ZBV A;  2ESC A;  4MPK A;  3AS3 A;  3CHE A;  3OOB A;  2PV1 A;  3RFW A;  2DK1 A;  3TC5 A;  1J4H A;  4S3K A;  1D2K A;  3B8S A;  3L4H A;  4ITZ A;  1HJX A;  2MNT A;  4JYS A;  4R0X A;  4LAX A;  1J4R A;  1HKK A;  1FAP A;  2OWO A;  1ZCN A;  3KCE A;  1D7H A;  1QZ2 A;  3ARZ A;  4ZPV R;  4ODO A;  3EY6 A;  3ARW A;  1Q6I A;  2MLY A;  3ARQ A;  3NRK A;  3IKD A;  1JND A;  1ZB5 A;  1J4I A;  3BXW A;  1ZL1 A;  4DRH A;  4AY1 A;  2O92 A;  3WL1 A;  2RSE A;  2XP8 A;  1EG4 A;  1W1T A;  1EG3 A;  1W1Y A;  2MDI A;  3RM8 A;  1E6Z A;  2WLY A;  4P8X A;  1X6L A;  1UR8 A;  1W9P A;  4ML4 A;  3O5O A;  4ODL A;  2YSG A;  2Y78 A;  3FY1 A;  2DG4 A;  4JFJ A;  1WB0 A;  1Q6U A;  4DWS B;  4DRI A;  2IUZ A;  3O5G A;  2G41 A;  1Y0O A;  3WKZ A;  5D75 A;  2L4J A;  4MAV A;  1P5Q A;  3UI4 A;  3UQI A;  1N1A A;  1NWS A;  2L2S A;  1TR8 A;  3WL0 A;  1D6O A;  1QPL A;  1NMW A;  1JNE A;  4C02 B;  1TCO C;  1LQ0 A;  3JXV A;  3WQV A;  1H0G A;  4S3J A;  4ZS6 A;  3TCZ A;  3O5R A;  4Z2I A;  3B9D A;  2FKE A;  2PPP A;  2DSZ A;  4MNJ A;  4ODP A;  2M08 A;  3KZ7 A;  4L3N A;  2DJY A;  3AS1 A;  3IHZ A;  3PA7 A;  1FKD A;  2KFW A;  4TNS A;  1JNS A;  2MPH A;  2PPN A;  2LGO A;  3PQH A;  2WLZ A;  4ZPT R;  4G2P A;  2JV4 A;  4W9P A;  4BF8 A;  2XP5 A;  1ZBK A;  2YSI A;  4DRK A;  4DIP A;  2PI6 A;  5E5W A;  5E65 A;  1QPF A;  2K8I A;  4U85 A;  4TW6 A;  1W9V A;  4R5E A;  4DWS C;  3O5L A;  3UQB A;  2RUR A;  1ITX A;  1JNT A;  2AOS A;  3JYJ A;  1FJD A;  1FKF A;  3MCB A;  2WK2 A;  2A3C A;  4LAV A;  3KAF A;  1WAW A;  1GPF A;  5HBF A;  2D9F A;  1ROT A;  4NNR A;  4G50 A;  2DG3 A;  1SR0 A;  2KGJ A;  2ZQU A;  1X6N A;  4KQZ A;  1K9R A;  5BXJ A;  4N19 A;  4GGQ A;  4A0T A;  1NWU A;  3FS8 A;  5HW7 A;  1W1P A;  4Z2H A;  3ARV A;  4ODQ A;  2RUD A;  3AS2 A;  2PPO A;  5HKG A;  4Q22 A;  3G6M A;  3CH9 A;  3O5I A;  3WD2 A;  2QF8 A;  3ARU A;  5HT1 A;  2YSF A;  1PBK A;  2LJ4 A;  4E5R A;  1JVW A;  5U47 A;  5CQ2 A;  1FKL A;  3CZ8 A;  1HKJ A;  2DSV A;  3B9E A;  1K9T A;  4IT4 A;  1EQ3 A;  4HAR A;  3PRD A;  2Y8N B;  4Z2L A;  1NH6 A;  3CHD A;  4NZC A;  4DRN A;  3O5D A;  1FLC A;  1K9Q A;  1FKI A;  5HUA A;  1J6Y A;  4HBE A;  3RM4 A;  1M5Y A;  3AS0 A;  3MQG A;  4DRJ A;  2JX8 A;  4J4N A;  1U79 A;  1FKK A;  1OGB A;  2BA1 A;  2QRV A;  1FKJ A;  4ODM A;  1E15 A;  3WQW A;  2XPA A;  2ZQV A;  2F4E A;  4DRO A;  4TW8 A;  3ODK A;  1ZBC A;  4IPX A;  2A3B A;  1WR7 A;  1T11 A;  4DRP A;  4O2T A;  3O5P A;  5HW6 A;  3ARS A;  4L72 B;  2DSU A;  2KXQ A;  4DT4 A;  1GOI A;  1NWR A;  2M8I A;  5AHT A;  2AWG A;  2OFN A;  2WAE A;  2OLH A;  3KAB A;  1EDQ A;  4DZ3 A;  4DWS D;  4ODR A;  1WMV A;  1CTN A;  2WAD A;  1E6N A;  1LG2 A;  2MF9 A;  1B6C A;  4QT3 A;  3CGM A;  5E64 A;  2KR7 A;  1H0I A;  1HKM A;  4W9Q A;  3H9R B;  4LGX A;  2E45 A;  1A7X A;  4MGV A;  1FD9 A;  4WKA A;  3WD1 A;  2DK7 A;  1GUV A;  3FSC A;  3LKX B;  3WD3 A;  5DO2 A;  2KO7 A;  2Q5A A;  1KT0 A;  4LAY A;  4DZ2 A;  2FAP A;  4IQ2 A;  1Q1C A;  2ZQT A;  1FKR A;  1FKB A;  4WK9 A;  2M8J A;  2XP3 A;  3W4R A;  5GQB A;  3AQU A;  3ARR A;  2ZAJ A;  2PV2 A;  1OWQ A;  2ITK A;  1ZK6 A;  3ARP A;  2DSW A;  1FFR A;  3UF8 A;  5JH8 A;  1C9H A;  1HKI A;  1KFW A;  1LG1 A;  2KE0 A;  1R9H A;  1ZBW A;  5DF0 A;  3M85 A;  4DH0 A;  3QOK A;  3LKX A;  3O5M A;  4MSP A;  1NSG A;  4J4O A;  1FKS A;  2YSH A;  3LE4 A;  2DT0 A;  1F40 A;  3FAP A;  4ZPW R;  2XP7 A;  1SYT A;  2KI3 A;  3UI6 A;  2DT3 A;  2JZV A;  4GLX A;  2RE3 A;  1WNO A;  3MCB B;  2DPE A;  1O6I A;  3ART A;  2YBU A;  2XP6 A;  1NWT A;  4MNM A;  4Z2K A;  3B7X A;  3O5E A;  1W26 A;  1HJW A;  1TFV A;  3TDB A;  2DT1 A;  3RME A;  4IT6 A;  1HXV A;  2M2A A;  4DRM A;  4TW7 A;  3MQH A;  1EYM A;  1HJV A;  3I6C A;  4JFK A;  2G8Z A;  2MLX A;  3FXY A;  3G6L A;  3KAD A;  1LL6 A;  3PRA A;  3IK8 A;  4XAK A;  3CHF A;  1W9U A;  3KAI A;  2YBT A;  2RQS A;  1I5H W;  2DWV A;  1FKT A;  4MNL A;  3IKG A;  2DG9 A;  2N87 A;  2M1I A;  4ODK A;  4HBO A;  1KT1 A;  2ZQS A;  2JMF A;  2A3A A;  3OA5 A;  2EZ5 W;  3CNG A;  5E66 A;  2F21 A;  4KR0 B;  3WD4 A;  1E6P A;  2ZR4 A;  1XHG A;  3VAW A;  2DMV A;  3FSB A;  1LL7 A;  4Q7N A;  1BKF A;  2LAJ A;  3PR9 A;  2O9O A;  3PRB A;  1IX5 A;  4NSB A;  2DT2 A;  1FKG A;  3ARX A;  4GIV A;  1TK7 A;  1E6R A;  4ODN A;  4WKH A;  1RP5 A;  2IF4 A;  5DIV A;  3JYM A;  4P8W A;  2UZ5 A;  4LAW A;  1E9L A;  2PBC A;  4DRQ A;  5I98 A;  1D7J A;  3UQA A;  2JXW A;  4Z2G A;  4DWS A;  3CGN A;  1O6W A;  1YAT A;  4TX0 A;  4QZV B;  3O5K A;  4WKF A;  3O5F A;  2F2D A;  3ALG A;  3ALF A;  4WJX A;  4QIB A;  2WM0 A;  3ARY A;  4IQC A;  4REX A;  1LJY A;  5HTG A;  3RM9 A;  3CHC A;  3NI6 A;  2A3E A;  3LUO A;  4MTV A;  3RGC A;  3KAC A;  1JMQ A;  1FFQ A;  3GPK A;  2XPB A;  2M3O W;  2FDM A;  5DEZ A;  1W1V A;  3M7N A;  5J6E A;  4FAP A;  2XP4 A;  1EHN A;  1VF8 A;  4P8U A;  2VN1 A;  1ZU8 A;  3B9A A;  2RUC A;  4PTM A;  5GPG A;  4P8V A;  2RUQ A;  3ARO A;  3O5Q A;  5DIT A;  2ZR5 A;  4W5U A;  4JFM A;  3NTP A;  3KAG A;  4U86 A;  1UR9 A;  1F8A B;  1XRV A;  4JFI A;  2VCD A;  3WH0 A;  4U84 A;  4W9O A;  4A0U A;  2YAJ B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...