2XP3A

Discovery of cell-active phenyl-imidazole pin1 inhibitors by structure-guided fragment evolution
Total Genus 46
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
46
sequence length
157
structure length
145
Chain Sequence
LPPGWEKAMSRSSGRVYYFNHITNASQWERPSEPARVRCSHLLVKHSQSRRPSSWRQEKITRTKEEALELINGYIQKIKSGEEDFESLASQFSDCSSAKARGDLGAFSRGQMQKPFEDASFALRTGEMSGPVFTDSGIHIILRTE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Discovery of Cell-Active Phenyl-Imidazole Pin1 Inhibitors by Structure-Guided Fragment Evolution.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Isomerase
molecule keywords PEPTIDYL-PROLYL CIS-TRANS ISOMERASE NIMA-INTERACTING 1
total genus 46
structure length 145
sequence length 157
ec nomenclature ec 5.2.1.8: Peptidylprolyl isomerase.
pdb deposition date 2010-08-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00397 WW WW domain
A PF00639 Rotamase PPIC-type PPIASE domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.20.70.10 Mainly Beta Single Sheet Ubiquitin Ligase Nedd4; Chain: W; Ubiquitin Ligase Nedd4; Chain: W; 2xp3A01
3.10.50.40 Alpha Beta Roll Chitinase A; domain 3 Chitinase A; domain 3 2xp3A02
1TCOC 2RSEA 4LAWA 3LE4A 5DITA 3NI6A 4DRPA 1FKBA 4U84A 3GPKA 2E45A 3TCZA 2M8JA 1Y0OA 2M8IA 2ZR6A 3EY6A 3OOBA 2ZQUA 5CQ2A 2M2AA 3I6CA 3O5KA 3PRBA 4G2PA 2XP8A 2IF4A 1Q6HA 4JFKA 2OFNA 4LAVA 5HWBA 4W9OA 1EQ3A 4DZ3A 2JV4A 2LGOA 5DIVA 1FKRA 4U86A 4N19A 3UI4A 1FKSA 3NRKA 1L1PA 1QZ2A 1F40A 1J4IA 2KFWA 2PV3A 5HW7A 1FKKA 2DG9A 4DH0A 3TC5A 2MLYA 2N87A 4ODPA 2ZR5A 1FKJA 4JFLA 2MDIA 2ZR4A 2L4JA 2PV2A 1M5YA 5HKGA 2Q5AA 3KABA 1I5HW 4BF8A 2DK1A 1FJDA 2KO7A 4MGVA 4ODLA 4DRNA 1T11A 5BXJA 4QT3A 2YSBA 4LAYA 5HUAA 1EG4A 2DK7A 3O5PA 5D75A 4IQ2A 3O5FA 4DZ2A 2XP7A 4ODRA 3M85A 1P5QA 3O5GA 4DRHA 4W9QA 1ROUA 3PRDA 2XP6A 2JX8A 2Y78A 2ZQVA 3IK8A 3NTPA 3MDYB 1FKFA 2XP9A 4REXA 4FN2A 3UI6A 3VAWA 5HWCA 2KE0A 1QPFA 2ZQTA 4TX0A 4R0XA 5GPGA 1JNSA 5I98A 1D7JA 2KXQA 4JFJA 1FD9A 4ODOA 1WMVA 1HXVA 2MF9A 4TNSA 1YW5A 4TYOA 3UQBA 3O5IA 2BA1A 1N1AA 1EYMA 4IQCA 4O2TA 4QT2A 4TW6A 3KZ7A 2DMVA 3KCEA 1W26A 4IPXA 2MLXA 4DROA 1J6YA 1JNTA 2JXWA 2YSGA 2RUQA 3JYMA 2ITKA 3CNGA 1NMVA 2XPBA 2JZVA 4GGQA 1J4RA 4DIPA 2XP4A 1R9HA 3KAIA 4MSPA 4JYSA 1B6CA 3O5LA 1J4HA 2LPVA 4ODKA 4TW7A 3RFWA 4DT4A 3WH0A 2FKEA 3IHZA 3IKGA 1O6WA 3JYJA 3TDBA 2XP3A 3O5JA 3O5MA 4TW8A 4JFIA 2MPHA 4ODNA 2LKNA 2KGJA 3KACA 1NMWA 4G50A 3UQIA 2K8IA 2RUDA 2XP5A 2F21A 1JMQA 1BKFA 5DIUA 1Q6UA 1ZCNA 2YSIA 4QIBA 1NSGA 1FKGA 2EZ5W 3KAFA 2RURA 2F4EA 3CGNA 1Q1CA 2DJYA 1ROTA 2RE3A 2RQSA 1K9RA 2RUCA 3CGMA 3O5EA 2JMFA 1D7IA 1QPLA 3UI5A 2PPPA 2MNTA 1FAPA 1FKLA 4DRKA 2VCDA 2F2DA 3M7NA 1ZK6A 2AWGA 2M1IA 1D6OA 2VN1A 1A7XA 2KI3A 1PINA 2PPOA 1PBKA 3O5OA 3FAPA 4DRMA 5B8IC 4C02B 2PPNA 3O5QA 1TK7A 2KR7A 2DWVA 2M08A 4J4NA 4ODMA 5HW8A 5J6EA 3KAGA 3JXVA 4ITZA 2L2SA 4J4OA 5HT1A 3RGCA 4FAPA 3IKDA 4DRIA 1FKDA 1F8AB 4U85A 3PA7A 2XPAA 1D7HA 2D9FA 2UZ5A 4GIVA 2M3OW 3UQAA 2YSFA 5AHTA 1YATA 4LAXA 2LJ4A 4E5RA 2DG4A 3O5DA 3LUOA 1Q6IA 1WR7A 2LAJA 3L4HA 3H9RB 4NNRA 4DRJA 1EG3A 2MLZA 3B7XA 4W9PA 2PV1A 1FKTA 1U79A 4ODQA 5HW6A 2ZAJA 1KT0A 4JFMA 3UF8A 3KAHA 1FKIA 1KT1A 1BL4A 1JVWA 5HTGA 4DRQA 3KADA 2YSHA 2FAPA 1K9QA 1C9HA 2PBCA 2DG3A 1FKHA 3O5RA 2ZQSA 3ODKA
chains in the Genus database with same CATH superfamily
4DRPA 4LAWA 3LE4A 1FKBA 1E6NA 1W1TA 2M8JA 3LKXA 4Z2IA 2ZR6A 3EY6A 4G2PA 2ZQUA 2M2AA 1RP5A 1XRVA 3I6CA 5GQBA 1EQ3A 5HWBA 1ZB5A 1W9VA 3G6MA 4DZ3A 2JV4A 1ITXA 4N19A 2DT3A 3CHFA 1FKSA 4ZPVR 2DT0A 2WADA 3TC5A 2ZR5A 1FKJA 2O92A 5HKGA 2DK1A 1FJDA 1LL4A 4ODLA 1T11A 2YSBA 2DK7A 4GLXA 1X6LA 3WIJA 3RM4A 3M85A 4JFIA 1CTNA 3UI6A 3NTPA 3OA5A 4FN2A 4P8XA 1QPFA 1FFQA 1OWQA 5DEZA 1WMVA 2MF9A 1YW5A 4WKHA 1IX5A 1OGBA 1W26A 4DROA 5E64A 2RUQA 2ITKA 1NMVA 2XPBA 2JZVA 1K9TA 4WK9A 4MSPA 4JYSA 3O5LA 2YBUA 2LPVA 4LGXA 3WH0A 2FKEA 4DT4A 3IKGA 5DO2A 3JYJA 4TW8A 2G8ZA 1LQ0A 3AQUA 4G50A 3UQIA 2F21A 1HKMA 5DIUA 2DSZA 1HJVA 1RD6A 4HBEA 1ROTA 3UI5A 4Z2LA 4ML4A 4A0TA 1ZK6A 4DWSA 2KI3A 3O5OA 3O5QA 1TK7A 5HW8A 1HKJA 4Q22A 3RGCA 4FAPA 1HKIA 3UQAA 4MNJA 1GUVA 2UZ5A 2M3OW 3PR9A 3PQHA 2IUZA 4LAXA 1NWUA 3O5DA 2DG4A 3LUOA 1LL6A 4IT4A 2ETNA 3W4RA 2PV1A 3ALGA 1U79A 3G6LA 4JFMA 3UF8A 2A3BA 3ARYA 3KADA 1K9QA 1C9HA 2PBCA 1EHNA 3O5RA 3BXWA 3ODKA 2RSEA 3GPKA 3ARTA 2M8IA 3O5KA 3OOBA 3AROA 2QRVA 2XP8A 1ZBCA 4JFKA 4LAVA 4S3KA 4W9OA 2P4VA 1LG1A 2LGOA 4U86A 1L1PA 3WL0A 2O9OA 2PV3A 5HW7A 1LG2A 4UDMA 1KFWA 2DG9A 2N87A 2MLYA 2MDIA 1VF8A 2L4JA 1I5HW 3ARUA 2KO7A 2WLYA 4QT3A 1EG4A 4WKFA 3AS3A 3WL1A 3O5FA 4DZ2A 4ODRA 2DSUA 3WQVA 1ROUA 2XP6A 2B31A 2Y78A 2ZQVA 3IK8A 3MDYB 3WD0A 2XP9A 4REXA 3ARRA 2ZQTA 3B9AA 4R0XA 5I98A 2KXQA 4ODOA 3FSCA 1HXVA 3ARSA 1E44A 4TYOA 3O5IA 2BA1A 5E65A 4IT6A 4QT2A 4DWSB 5U47A 3ARXA 3WD3A 2YSGA 4DWSC 3CNGA 3AS0A 4GGQA 1J4RA 1R9HA 1NWSA 1H0GA 3IHZA 3FXYA 1HJWA 3TDBA 2MPHA 4ODNA 2KGJA 1NMWA 2XP5A 1JMQA 1BKFA 4QIBA 1NSGA 2EZ5W 3KAFA 4NZCA 2F4EA 3BMBA 2DJYA 1K9RA 1D7IA 2OWOA 2PPPA 1FAPA 4WKAA 1UR9A 4DRKA 2M1IA 1A7XA 3B8SA 2PPOA 4DRMA 5B8IC 4C02B 2PPNA 2KR7A 2DWVA 2M08A 4J4NA 4ODMA 4HARA 2WAEA 4DRIA 3MCBA 1FKDA 3FY1A 2XPAA 2YSFA 2YBTA 4URIA 1W1YA 4E5RA 3UQBA 4W9PA 3FS8A 1KT1A 1JVWA 2FAPA 1FLCA 5GPRA 5HT1A 1TCOC 1XHGA 4MAVA 3CHDA 5CQ2A 3CHEA 4MNMA 1Q6HA 2OFNA 4ZPWR 1FKRA 2DSWA 3NRKA 1QZ2A 4MNLA 1JNEA 4Z2HA 1FKKA 3PRAA 4DH0A 2DT1A 4JFLA 2FDMA 1M5YA 3KABA 4BF8A 4MGVA 1GOIA 3FSBA 4LAYA 2QF8A 4XAKA 2Y8NB 1E15A 4IQ2A 4Q7NA 2XP7A 3MCBB 2B5UB 3O5GA 3WQWA 4W9QA 4DRNA 3PRDA 3AS1A 3VAWA 2KE0A 1ZU8A 5GPGA 1JNSA 1WNOA 4JFJA 4MPKA 1H0IA 4TNSA 1N1AA 1EYMA 4TW6A 3KCEA 1LJYA 4WIWA 4PTMA 3JYMA 4P8VA 2G41A 1W1PA 1FFRA 4DIPA 2DPEA 4ODKA 4MNKA 2XP3A 4A0UA 3O5MA 2ESCA 2LKNA 3KACA 1GRJA 1ZBWA 2K8IA 3ARQA 2RUDA 4Z2KA 1E6ZA 1Q6UA 4L3NA 1ZL1A 3B9DA 4Z2GA 2WK2A 3CGNA 2RQSA 2RUCA 1FKLA 4P8WA 1E6PA 1SR0A 1D6OA 2VN1A 1PINA 4MTVA 3GU0A 4ZS6A 5J6EA 4ITZA 4J4OA 2L2SA 4W5UA 2WLZA 3IKDA 2OLHA 1D7HA 1NH6A 2D9FA 5AHTA 3AS2A 1YATA 2LJ4A 4NNRA 2LAJA 3L4HA 2A3CA 3QOKA 4DRJA 1EG3A 4KQZA 3ARVA 1JCHB 5JH8A 2ZAJA 3CH9A 1NWTA 2DSVA 1FKHA 2EULA 3EIPA 5DITA 3NI6A 4U84A 2E45A 3TCZA 1Y0OA 2PN0A 4P8UA 3PRBA 2IF4A 2F23A 4DWSD 1W1VA 5DIVA 3UI4A 3WD1A 3MQGA 3ARZA 1J4IA 3RM9A 2KFWA 3LKXB 2A3AA 2DT2A 4ODPA 1JNDA 2ZR4A 2PV2A 3WKZA 2Q5AA 5BXJA 4WJXA 5HUAA 3O5PA 4HBOA 5D75A 5E5WA 1P5QA 4DRHA 1ZBKA 1F40A 2JX8A 5HWCA 2YAJB 3MQHA 1FKFA 4AY1A 4KR0B 4TX0A 1HKKA 4ZPTR 1D7JA 3WD4A 1NWRA 1FD9A 3CZ8A 3RM8A 3CHCA 2A3EA 4IQCA 4O2TA 1WAWA 4NSBA 3KZ7A 2DMVA 4IPXA 1J6YA 2MLXA 3RMEA 1JNTA 2JXWA 1SYTA 1W9UA 1X6NA 2AOSA 2ZQSA 2XP4A 3KAIA 1E9LA 1B6CA 1J4HA 2PI6A 3GTYX 4TW7A 3RFWA 1OGGA 1O6WA 4R5EA 1EDQA 3O5JA 1UR8A 1W9PA 3B9EA 1E6RA 2WM0A 1ZCNA 2YSIA 3ARWA 1FKGA 1GPFA 5HBFA 1EIBA 5DF0A 1TR8A 2RURA 1D2KA 1Q1CA 3O5EA 2RE3A 3CGMA 1ZBVA 2JMFA 1QPLA 2MNTA 2VCDA 2F2DA 3M7NA 2AWGA 5E66A 1PBKA 3FAPA 3KAGA 3JXVA 3ALFA 1F8AB 3ARPA 4U85A 5E62A 3PA7A 4GIVA 4L72B 4QZVB 1LL7A 1O6IA 4S3JA 3WD2A 1TFVA 1Q6IA 1WR7A 3H9RB 4Z2JA 2MLZA 3B7XA 1FKTA 4ODQA 5HW6A 1KT0A 3KAHA 1FKIA 1BL4A 1HJXA 5HTGA 4DRQA 2YSHA 2DG3A 1WB0A
chains in the Genus database with same CATH topology
4DRPA 4LAWA 3LE4A 1FKBA 1E6NA 1W1TA 2M8JA 3LKXA 4Z2IA 2ZR6A 3EY6A 4G2PA 2ZQUA 2M2AA 1RP5A 1XRVA 3I6CA 5GQBA 1EQ3A 5HWBA 1ZB5A 1W9VA 3G6MA 4DZ3A 2JV4A 1ITXA 4N19A 2DT3A 3CHFA 1FKSA 4ZPVR 2DT0A 2WADA 3TC5A 2ZR5A 1FKJA 2O92A 5HKGA 2DK1A 1FJDA 1LL4A 4ODLA 1T11A 2YSBA 2DK7A 4GLXA 1X6LA 3WIJA 3RM4A 3M85A 4JFIA 1CTNA 3UI6A 3NTPA 3OA5A 4FN2A 4P8XA 1QPFA 1FFQA 1OWQA 5DEZA 1WMVA 2MF9A 1YW5A 4WKHA 1IX5A 1OGBA 1W26A 4DROA 5E64A 2RUQA 2ITKA 1NMVA 2XPBA 2JZVA 1K9TA 4WK9A 4MSPA 4JYSA 3O5LA 2YBUA 2LPVA 4LGXA 3WH0A 2FKEA 4DT4A 3IKGA 5DO2A 3JYJA 4TW8A 2G8ZA 1LQ0A 3AQUA 4G50A 3UQIA 2F21A 1HKMA 5DIUA 2DSZA 1HJVA 1RD6A 4HBEA 1ROTA 3UI5A 4Z2LA 4ML4A 4A0TA 1ZK6A 4DWSA 2KI3A 3O5OA 3O5QA 1TK7A 5HW8A 1HKJA 4Q22A 3RGCA 4FAPA 1HKIA 3UQAA 4MNJA 1GUVA 2UZ5A 2M3OW 3PR9A 3PQHA 2IUZA 4LAXA 1NWUA 3O5DA 2DG4A 3LUOA 1LL6A 4IT4A 3W4RA 2PV1A 3ALGA 1U79A 3G6LA 4JFMA 3UF8A 2A3BA 3ARYA 3KADA 1K9QA 1C9HA 2PBCA 1EHNA 3O5RA 3BXWA 3ODKA 2RSEA 3GPKA 3ARTA 2M8IA 3O5KA 3OOBA 3AROA 2QRVA 2XP8A 1ZBCA 4JFKA 4LAVA 4S3KA 4W9OA 1LG1A 2LGOA 4U86A 1L1PA 3WL0A 2O9OA 2PV3A 5HW7A 1LG2A 1KFWA 2DG9A 2N87A 2MLYA 2MDIA 1VF8A 2L4JA 1I5HW 3ARUA 2KO7A 2WLYA 4QT3A 1EG4A 4WKFA 3AS3A 3WL1A 3O5FA 4DZ2A 4ODRA 2DSUA 3WQVA 1ROUA 2XP6A 2B31A 2Y78A 2ZQVA 3IK8A 3MDYB 3WD0A 2XP9A 4REXA 3ARRA 2ZQTA 3B9AA 4R0XA 5I98A 2KXQA 4ODOA 3FSCA 1HXVA 3ARSA 4TYOA 3O5IA 2BA1A 5E65A 4IT6A 4QT2A 4DWSB 5U47A 3ARXA 3WD3A 2YSGA 4DWSC 3AS0A 3CNGA 4GGQA 1J4RA 1R9HA 1NWSA 1H0GA 3IHZA 3FXYA 1HJWA 3TDBA 2MPHA 4ODNA 2KGJA 1NMWA 2XP5A 1JMQA 1BKFA 4QIBA 1NSGA 2EZ5W 3KAFA 4NZCA 2F4EA 2DJYA 1K9RA 1D7IA 2OWOA 2PPPA 1FAPA 4WKAA 1UR9A 4DRKA 2M1IA 1A7XA 3B8SA 2PPOA 4DRMA 5B8IC 4C02B 2PPNA 2KR7A 2DWVA 2M08A 4J4NA 4ODMA 4HARA 2WAEA 4DRIA 3MCBA 1FKDA 3FY1A 2XPAA 2YSFA 2YBTA 4URIA 1W1YA 4E5RA 3UQBA 4W9PA 3FS8A 1KT1A 1JVWA 2FAPA 1FLCA 5GPRA 5HT1A 1TCOC 1XHGA 4MAVA 3CHDA 5CQ2A 3CHEA 4MNMA 1Q6HA 2OFNA 4ZPWR 1FKRA 2DSWA 3NRKA 1QZ2A 4MNLA 1JNEA 4Z2HA 1FKKA 3PRAA 4DH0A 2DT1A 4JFLA 2FDMA 1M5YA 3KABA 4BF8A 4MGVA 1GOIA 3FSBA 4LAYA 2QF8A 4XAKA 2Y8NB 1E15A 4IQ2A 4Q7NA 2XP7A 3MCBB 3O5GA 3WQWA 4W9QA 4DRNA 3PRDA 3AS1A 3VAWA 2KE0A 1ZU8A 5GPGA 1JNSA 1WNOA 4JFJA 4MPKA 1H0IA 4TNSA 1N1AA 1EYMA 4TW6A 3KCEA 1LJYA 4WIWA 4PTMA 3JYMA 4P8VA 2G41A 1W1PA 1FFRA 4DIPA 2DPEA 4ODKA 4MNKA 2XP3A 4A0UA 3O5MA 2ESCA 2LKNA 3KACA 1ZBWA 2K8IA 3ARQA 2RUDA 4Z2KA 1E6ZA 1Q6UA 4L3NA 1ZL1A 3B9DA 4Z2GA 2WK2A 3CGNA 2RQSA 2RUCA 1FKLA 4P8WA 1E6PA 1SR0A 1D6OA 2VN1A 1PINA 4MTVA 4ZS6A 5J6EA 4ITZA 4J4OA 2L2SA 4W5UA 2WLZA 3IKDA 2OLHA 1D7HA 1NH6A 2D9FA 5AHTA 3AS2A 1YATA 2LJ4A 4NNRA 2LAJA 3L4HA 2A3CA 3QOKA 4DRJA 1EG3A 4KQZA 3ARVA 5JH8A 2ZAJA 3CH9A 1NWTA 2DSVA 1FKHA 5DITA 3NI6A 4U84A 2E45A 3TCZA 1Y0OA 4P8UA 3PRBA 2IF4A 4DWSD 1W1VA 5DIVA 3UI4A 3WD1A 3MQGA 3ARZA 1J4IA 3RM9A 2KFWA 3LKXB 2A3AA 2DT2A 4ODPA 1JNDA 2ZR4A 2PV2A 3WKZA 2Q5AA 5BXJA 4WJXA 5HUAA 3O5PA 4HBOA 5D75A 5E5WA 1P5QA 4DRHA 1ZBKA 1F40A 2JX8A 5HWCA 2YAJB 3MQHA 1FKFA 4AY1A 4KR0B 4TX0A 1HKKA 4ZPTR 1D7JA 3WD4A 1NWRA 1FD9A 3CZ8A 3RM8A 3CHCA 2A3EA 4IQCA 4O2TA 1WAWA 4NSBA 3KZ7A 2DMVA 4IPXA 1J6YA 2MLXA 3RMEA 1JNTA 2JXWA 1SYTA 1W9UA 1X6NA 2AOSA 2ZQSA 2XP4A 3KAIA 1E9LA 1B6CA 1J4HA 2PI6A 4TW7A 3RFWA 1OGGA 1O6WA 4R5EA 1EDQA 3O5JA 1UR8A 1W9PA 3B9EA 1E6RA 2WM0A 1ZCNA 2YSIA 3ARWA 1FKGA 1GPFA 5HBFA 1EIBA 5DF0A 1TR8A 2RURA 1D2KA 1Q1CA 3O5EA 2RE3A 3CGMA 1ZBVA 2JMFA 1QPLA 2MNTA 2VCDA 2F2DA 3M7NA 2AWGA 5E66A 1PBKA 3FAPA 3KAGA 3JXVA 3ALFA 1F8AB 3ARPA 4U85A 5E62A 3PA7A 4GIVA 4L72B 4QZVB 1LL7A 1O6IA 4S3JA 3WD2A 1TFVA 1Q6IA 1WR7A 3H9RB 4Z2JA 2MLZA 3B7XA 1FKTA 4ODQA 5HW6A 1KT0A 3KAHA 1FKIA 1BL4A 1HJXA 5HTGA 4DRQA 2YSHA 2DG3A 1WB0A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1TCO C;  2RSE A;  4LAW A;  3LE4 A;  5DIT A;  3NI6 A;  4DRP A;  1FKB A;  4U84 A;  3GPK A;  2E45 A;  3TCZ A;  2M8J A;  1Y0O A;  2M8I A;  2ZR6 A;  3EY6 A;  3OOB A;  2ZQU A;  5CQ2 A;  2M2A A;  3I6C A;  3O5K A;  3PRB A;  4G2P A;  2XP8 A;  2IF4 A;  1Q6H A;  4JFK A;  2OFN A;  4LAV A;  5HWB A;  4W9O A;  1EQ3 A;  4DZ3 A;  2JV4 A;  2LGO A;  5DIV A;  1FKR A;  4U86 A;  4N19 A;  3UI4 A;  1FKS A;  3NRK A;  1L1P A;  1QZ2 A;  1F40 A;  1J4I A;  2KFW A;  2PV3 A;  5HW7 A;  1FKK A;  2DG9 A;  4DH0 A;  3TC5 A;  2MLY A;  2N87 A;  4ODP A;  2ZR5 A;  1FKJ A;  4JFL A;  2MDI A;  2ZR4 A;  2L4J A;  2PV2 A;  1M5Y A;  5HKG A;  2Q5A A;  3KAB A;  1I5H W;  4BF8 A;  2DK1 A;  1FJD A;  2KO7 A;  4MGV A;  4ODL A;  4DRN A;  1T11 A;  5BXJ A;  4QT3 A;  2YSB A;  4LAY A;  5HUA A;  1EG4 A;  2DK7 A;  3O5P A;  5D75 A;  4IQ2 A;  3O5F A;  4DZ2 A;  2XP7 A;  4ODR A;  3M85 A;  1P5Q A;  3O5G A;  4DRH A;  4W9Q A;  1ROU A;  3PRD A;  2XP6 A;  2JX8 A;  2Y78 A;  2ZQV A;  3IK8 A;  3NTP A;  3MDY B;  1FKF A;  2XP9 A;  4REX A;  4FN2 A;  3UI6 A;  3VAW A;  5HWC A;  2KE0 A;  1QPF A;  2ZQT A;  4TX0 A;  4R0X A;  5GPG A;  1JNS A;  5I98 A;  1D7J A;  2KXQ A;  4JFJ A;  1FD9 A;  4ODO A;  1WMV A;  1HXV A;  2MF9 A;  4TNS A;  1YW5 A;  4TYO A;  3UQB A;  3O5I A;  2BA1 A;  1N1A A;  1EYM A;  4IQC A;  4O2T A;  4QT2 A;  4TW6 A;  3KZ7 A;  2DMV A;  3KCE A;  1W26 A;  4IPX A;  2MLX A;  4DRO A;  1J6Y A;  1JNT A;  2JXW A;  2YSG A;  2RUQ A;  3JYM A;  2ITK A;  3CNG A;  1NMV A;  2XPB A;  2JZV A;  4GGQ A;  1J4R A;  4DIP A;  2XP4 A;  1R9H A;  3KAI A;  4MSP A;  4JYS A;  1B6C A;  3O5L A;  1J4H A;  2LPV A;  4ODK A;  4TW7 A;  3RFW A;  4DT4 A;  3WH0 A;  2FKE A;  3IHZ A;  3IKG A;  1O6W A;  3JYJ A;  3TDB A;  2XP3 A;  3O5J A;  3O5M A;  4TW8 A;  4JFI A;  2MPH A;  4ODN A;  2LKN A;  2KGJ A;  3KAC A;  1NMW A;  4G50 A;  3UQI A;  2K8I A;  2RUD A;  2XP5 A;  2F21 A;  1JMQ A;  1BKF A;  5DIU A;  1Q6U A;  1ZCN A;  2YSI A;  4QIB A;  1NSG A;  1FKG A;  2EZ5 W;  3KAF A;  2RUR A;  2F4E A;  3CGN A;  1Q1C A;  2DJY A;  1ROT A;  2RE3 A;  2RQS A;  1K9R A;  2RUC A;  3CGM A;  3O5E A;  2JMF A;  1D7I A;  1QPL A;  3UI5 A;  2PPP A;  2MNT A;  1FAP A;  1FKL A;  4DRK A;  2VCD A;  2F2D A;  3M7N A;  1ZK6 A;  2AWG A;  2M1I A;  1D6O A;  2VN1 A;  1A7X A;  2KI3 A;  1PIN A;  2PPO A;  1PBK A;  3O5O A;  3FAP A;  4DRM A;  5B8I C;  4C02 B;  2PPN A;  3O5Q A;  1TK7 A;  2KR7 A;  2DWV A;  2M08 A;  4J4N A;  4ODM A;  5HW8 A;  5J6E A;  3KAG A;  3JXV A;  4ITZ A;  2L2S A;  4J4O A;  5HT1 A;  3RGC A;  4FAP A;  3IKD A;  4DRI A;  1FKD A;  1F8A B;  4U85 A;  3PA7 A;  2XPA A;  1D7H A;  2D9F A;  2UZ5 A;  4GIV A;  2M3O W;  3UQA A;  2YSF A;  5AHT A;  1YAT A;  4LAX A;  2LJ4 A;  4E5R A;  2DG4 A;  3O5D A;  3LUO A;  1Q6I A;  1WR7 A;  2LAJ A;  3L4H A;  3H9R B;  4NNR A;  4DRJ A;  1EG3 A;  2MLZ A;  3B7X A;  4W9P A;  2PV1 A;  1FKT A;  1U79 A;  4ODQ A;  5HW6 A;  2ZAJ A;  1KT0 A;  4JFM A;  3UF8 A;  3KAH A;  1FKI A;  1KT1 A;  1BL4 A;  1JVW A;  5HTG A;  4DRQ A;  3KAD A;  2YSH A;  2FAP A;  1K9Q A;  1C9H A;  2PBC A;  2DG3 A;  1FKH A;  3O5R A;  2ZQS A;  3ODK A; 
#chains in the Genus database with same CATH topology
 4DRP A;  4LAW A;  3LE4 A;  1FKB A;  1E6N A;  1W1T A;  2M8J A;  3LKX A;  4Z2I A;  2ZR6 A;  3EY6 A;  4G2P A;  2ZQU A;  2M2A A;  1RP5 A;  1XRV A;  3I6C A;  5GQB A;  1EQ3 A;  5HWB A;  1ZB5 A;  1W9V A;  3G6M A;  4DZ3 A;  2JV4 A;  1ITX A;  4N19 A;  2DT3 A;  3CHF A;  1FKS A;  4ZPV R;  2DT0 A;  2WAD A;  3TC5 A;  2ZR5 A;  1FKJ A;  2O92 A;  5HKG A;  2DK1 A;  1FJD A;  1LL4 A;  4ODL A;  1T11 A;  2YSB A;  2DK7 A;  4GLX A;  1X6L A;  3WIJ A;  3RM4 A;  3M85 A;  4JFI A;  1CTN A;  3UI6 A;  3NTP A;  3OA5 A;  4FN2 A;  4P8X A;  1QPF A;  1FFQ A;  1OWQ A;  5DEZ A;  1WMV A;  2MF9 A;  1YW5 A;  4WKH A;  1IX5 A;  1OGB A;  1W26 A;  4DRO A;  5E64 A;  2RUQ A;  2ITK A;  1NMV A;  2XPB A;  2JZV A;  1K9T A;  4WK9 A;  4MSP A;  4JYS A;  3O5L A;  2YBU A;  2LPV A;  4LGX A;  3WH0 A;  2FKE A;  4DT4 A;  3IKG A;  5DO2 A;  3JYJ A;  4TW8 A;  2G8Z A;  1LQ0 A;  3AQU A;  4G50 A;  3UQI A;  2F21 A;  1HKM A;  5DIU A;  2DSZ A;  1HJV A;  1RD6 A;  4HBE A;  1ROT A;  3UI5 A;  4Z2L A;  4ML4 A;  4A0T A;  1ZK6 A;  4DWS A;  2KI3 A;  3O5O A;  3O5Q A;  1TK7 A;  5HW8 A;  1HKJ A;  4Q22 A;  3RGC A;  4FAP A;  1HKI A;  3UQA A;  4MNJ A;  1GUV A;  2UZ5 A;  2M3O W;  3PR9 A;  3PQH A;  2IUZ A;  4LAX A;  1NWU A;  3O5D A;  2DG4 A;  3LUO A;  1LL6 A;  4IT4 A;  2ETN A;  3W4R A;  2PV1 A;  3ALG A;  1U79 A;  3G6L A;  4JFM A;  3UF8 A;  2A3B A;  3ARY A;  3KAD A;  1K9Q A;  1C9H A;  2PBC A;  1EHN A;  3O5R A;  3BXW A;  3ODK A;  2RSE A;  3GPK A;  3ART A;  2M8I A;  3O5K A;  3OOB A;  3ARO A;  2QRV A;  2XP8 A;  1ZBC A;  4JFK A;  4LAV A;  4S3K A;  4W9O A;  2P4V A;  1LG1 A;  2LGO A;  4U86 A;  1L1P A;  3WL0 A;  2O9O A;  2PV3 A;  5HW7 A;  1LG2 A;  4UDM A;  1KFW A;  2DG9 A;  2N87 A;  2MLY A;  2MDI A;  1VF8 A;  2L4J A;  1I5H W;  3ARU A;  2KO7 A;  2WLY A;  4QT3 A;  1EG4 A;  4WKF A;  3AS3 A;  3WL1 A;  3O5F A;  4DZ2 A;  4ODR A;  2DSU A;  3WQV A;  1ROU A;  2XP6 A;  2B31 A;  2Y78 A;  2ZQV A;  3IK8 A;  3MDY B;  3WD0 A;  2XP9 A;  4REX A;  3ARR A;  2ZQT A;  3B9A A;  4R0X A;  5I98 A;  2KXQ A;  4ODO A;  3FSC A;  1HXV A;  3ARS A;  1E44 A;  4TYO A;  3O5I A;  2BA1 A;  5E65 A;  4IT6 A;  4QT2 A;  4DWS B;  5U47 A;  3ARX A;  3WD3 A;  2YSG A;  4DWS C;  3CNG A;  3AS0 A;  4GGQ A;  1J4R A;  1R9H A;  1NWS A;  1H0G A;  3IHZ A;  3FXY A;  1HJW A;  3TDB A;  2MPH A;  4ODN A;  2KGJ A;  1NMW A;  2XP5 A;  1JMQ A;  1BKF A;  4QIB A;  1NSG A;  2EZ5 W;  3KAF A;  4NZC A;  2F4E A;  3BMB A;  2DJY A;  1K9R A;  1D7I A;  2OWO A;  2PPP A;  1FAP A;  4WKA A;  1UR9 A;  4DRK A;  2M1I A;  1A7X A;  3B8S A;  2PPO A;  4DRM A;  5B8I C;  4C02 B;  2PPN A;  2KR7 A;  2DWV A;  2M08 A;  4J4N A;  4ODM A;  4HAR A;  2WAE A;  4DRI A;  3MCB A;  1FKD A;  3FY1 A;  2XPA A;  2YSF A;  2YBT A;  4URI A;  1W1Y A;  4E5R A;  3UQB A;  4W9P A;  3FS8 A;  1KT1 A;  1JVW A;  2FAP A;  1FLC A;  5GPR A;  5HT1 A;  1TCO C;  1XHG A;  4MAV A;  3CHD A;  5CQ2 A;  3CHE A;  4MNM A;  1Q6H A;  2OFN A;  4ZPW R;  1FKR A;  2DSW A;  3NRK A;  1QZ2 A;  4MNL A;  1JNE A;  4Z2H A;  1FKK A;  3PRA A;  4DH0 A;  2DT1 A;  4JFL A;  2FDM A;  1M5Y A;  3KAB A;  4BF8 A;  4MGV A;  1GOI A;  3FSB A;  4LAY A;  2QF8 A;  4XAK A;  2Y8N B;  1E15 A;  4IQ2 A;  4Q7N A;  2XP7 A;  3MCB B;  2B5U B;  3O5G A;  3WQW A;  4W9Q A;  4DRN A;  3PRD A;  3AS1 A;  3VAW A;  2KE0 A;  1ZU8 A;  5GPG A;  1JNS A;  1WNO A;  4JFJ A;  4MPK A;  1H0I A;  4TNS A;  1N1A A;  1EYM A;  4TW6 A;  3KCE A;  1LJY A;  4WIW A;  4PTM A;  3JYM A;  4P8V A;  2G41 A;  1W1P A;  1FFR A;  4DIP A;  2DPE A;  4ODK A;  4MNK A;  2XP3 A;  4A0U A;  3O5M A;  2ESC A;  2LKN A;  3KAC A;  1GRJ A;  1ZBW A;  2K8I A;  3ARQ A;  2RUD A;  4Z2K A;  1E6Z A;  1Q6U A;  4L3N A;  1ZL1 A;  3B9D A;  4Z2G A;  2WK2 A;  3CGN A;  2RQS A;  2RUC A;  1FKL A;  4P8W A;  1E6P A;  1SR0 A;  1D6O A;  2VN1 A;  1PIN A;  4MTV A;  3GU0 A;  4ZS6 A;  5J6E A;  4ITZ A;  4J4O A;  2L2S A;  4W5U A;  2WLZ A;  3IKD A;  2OLH A;  1D7H A;  1NH6 A;  2D9F A;  5AHT A;  3AS2 A;  1YAT A;  2LJ4 A;  4NNR A;  2LAJ A;  3L4H A;  2A3C A;  3QOK A;  4DRJ A;  1EG3 A;  4KQZ A;  3ARV A;  1JCH B;  5JH8 A;  2ZAJ A;  3CH9 A;  1NWT A;  2DSV A;  1FKH A;  2EUL A;  3EIP A;  5DIT A;  3NI6 A;  4U84 A;  2E45 A;  3TCZ A;  1Y0O A;  2PN0 A;  4P8U A;  3PRB A;  2IF4 A;  2F23 A;  4DWS D;  1W1V A;  5DIV A;  3UI4 A;  3WD1 A;  3MQG A;  3ARZ A;  1J4I A;  3RM9 A;  2KFW A;  3LKX B;  2A3A A;  2DT2 A;  4ODP A;  1JND A;  2ZR4 A;  2PV2 A;  3WKZ A;  2Q5A A;  5BXJ A;  4WJX A;  5HUA A;  3O5P A;  4HBO A;  5D75 A;  5E5W A;  1P5Q A;  4DRH A;  1ZBK A;  1F40 A;  2JX8 A;  5HWC A;  2YAJ B;  3MQH A;  1FKF A;  4AY1 A;  4KR0 B;  4TX0 A;  1HKK A;  4ZPT R;  1D7J A;  3WD4 A;  1NWR A;  1FD9 A;  3CZ8 A;  3RM8 A;  3CHC A;  2A3E A;  4IQC A;  4O2T A;  1WAW A;  4NSB A;  3KZ7 A;  2DMV A;  4IPX A;  1J6Y A;  2MLX A;  3RME A;  1JNT A;  2JXW A;  1SYT A;  1W9U A;  1X6N A;  2AOS A;  2ZQS A;  2XP4 A;  3KAI A;  1E9L A;  1B6C A;  1J4H A;  2PI6 A;  3GTY X;  4TW7 A;  3RFW A;  1OGG A;  1O6W A;  4R5E A;  1EDQ A;  3O5J A;  1UR8 A;  1W9P A;  3B9E A;  1E6R A;  2WM0 A;  1ZCN A;  2YSI A;  3ARW A;  1FKG A;  1GPF A;  5HBF A;  1EIB A;  5DF0 A;  1TR8 A;  2RUR A;  1D2K A;  1Q1C A;  3O5E A;  2RE3 A;  3CGM A;  1ZBV A;  2JMF A;  1QPL A;  2MNT A;  2VCD A;  2F2D A;  3M7N A;  2AWG A;  5E66 A;  1PBK A;  3FAP A;  3KAG A;  3JXV A;  3ALF A;  1F8A B;  3ARP A;  4U85 A;  5E62 A;  3PA7 A;  4GIV A;  4L72 B;  4QZV B;  1LL7 A;  1O6I A;  4S3J A;  3WD2 A;  1TFV A;  1Q6I A;  1WR7 A;  3H9R B;  4Z2J A;  2MLZ A;  3B7X A;  1FKT A;  4ODQ A;  5HW6 A;  1KT0 A;  3KAH A;  1FKI A;  1BL4 A;  1HJX A;  5HTG A;  4DRQ A;  2YSH A;  2DG3 A;  1WB0 A; 
#chains in the Genus database with same CATH homology
 4DRP A;  4LAW A;  3LE4 A;  1FKB A;  1E6N A;  1W1T A;  2M8J A;  3LKX A;  4Z2I A;  2ZR6 A;  3EY6 A;  4G2P A;  2ZQU A;  2M2A A;  1RP5 A;  1XRV A;  3I6C A;  5GQB A;  1EQ3 A;  5HWB A;  1ZB5 A;  1W9V A;  3G6M A;  4DZ3 A;  2JV4 A;  1ITX A;  4N19 A;  2DT3 A;  3CHF A;  1FKS A;  4ZPV R;  2DT0 A;  2WAD A;  3TC5 A;  2ZR5 A;  1FKJ A;  2O92 A;  5HKG A;  2DK1 A;  1FJD A;  1LL4 A;  4ODL A;  1T11 A;  2YSB A;  2DK7 A;  4GLX A;  1X6L A;  3WIJ A;  3RM4 A;  3M85 A;  4JFI A;  1CTN A;  3UI6 A;  3NTP A;  3OA5 A;  4FN2 A;  4P8X A;  1QPF A;  1FFQ A;  1OWQ A;  5DEZ A;  1WMV A;  2MF9 A;  1YW5 A;  4WKH A;  1IX5 A;  1OGB A;  1W26 A;  4DRO A;  5E64 A;  2RUQ A;  2ITK A;  1NMV A;  2XPB A;  2JZV A;  1K9T A;  4WK9 A;  4MSP A;  4JYS A;  3O5L A;  2YBU A;  2LPV A;  4LGX A;  3WH0 A;  2FKE A;  4DT4 A;  3IKG A;  5DO2 A;  3JYJ A;  4TW8 A;  2G8Z A;  1LQ0 A;  3AQU A;  4G50 A;  3UQI A;  2F21 A;  1HKM A;  5DIU A;  2DSZ A;  1HJV A;  1RD6 A;  4HBE A;  1ROT A;  3UI5 A;  4Z2L A;  4ML4 A;  4A0T A;  1ZK6 A;  4DWS A;  2KI3 A;  3O5O A;  3O5Q A;  1TK7 A;  5HW8 A;  1HKJ A;  4Q22 A;  3RGC A;  4FAP A;  1HKI A;  3UQA A;  4MNJ A;  1GUV A;  2UZ5 A;  2M3O W;  3PR9 A;  3PQH A;  2IUZ A;  4LAX A;  1NWU A;  3O5D A;  2DG4 A;  3LUO A;  1LL6 A;  4IT4 A;  3W4R A;  2PV1 A;  3ALG A;  1U79 A;  3G6L A;  4JFM A;  3UF8 A;  2A3B A;  3ARY A;  3KAD A;  1K9Q A;  1C9H A;  2PBC A;  1EHN A;  3O5R A;  3BXW A;  3ODK A;  2RSE A;  3GPK A;  3ART A;  2M8I A;  3O5K A;  3OOB A;  3ARO A;  2QRV A;  2XP8 A;  1ZBC A;  4JFK A;  4LAV A;  4S3K A;  4W9O A;  1LG1 A;  2LGO A;  4U86 A;  1L1P A;  3WL0 A;  2O9O A;  2PV3 A;  5HW7 A;  1LG2 A;  1KFW A;  2DG9 A;  2N87 A;  2MLY A;  2MDI A;  1VF8 A;  2L4J A;  1I5H W;  3ARU A;  2KO7 A;  2WLY A;  4QT3 A;  1EG4 A;  4WKF A;  3AS3 A;  3WL1 A;  3O5F A;  4DZ2 A;  4ODR A;  2DSU A;  3WQV A;  1ROU A;  2XP6 A;  2B31 A;  2Y78 A;  2ZQV A;  3IK8 A;  3MDY B;  3WD0 A;  2XP9 A;  4REX A;  3ARR A;  2ZQT A;  3B9A A;  4R0X A;  5I98 A;  2KXQ A;  4ODO A;  3FSC A;  1HXV A;  3ARS A;  4TYO A;  3O5I A;  2BA1 A;  5E65 A;  4IT6 A;  4QT2 A;  4DWS B;  5U47 A;  3ARX A;  3WD3 A;  2YSG A;  4DWS C;  3AS0 A;  3CNG A;  4GGQ A;  1J4R A;  1R9H A;  1NWS A;  1H0G A;  3IHZ A;  3FXY A;  1HJW A;  3TDB A;  2MPH A;  4ODN A;  2KGJ A;  1NMW A;  2XP5 A;  1JMQ A;  1BKF A;  4QIB A;  1NSG A;  2EZ5 W;  3KAF A;  4NZC A;  2F4E A;  2DJY A;  1K9R A;  1D7I A;  2OWO A;  2PPP A;  1FAP A;  4WKA A;  1UR9 A;  4DRK A;  2M1I A;  1A7X A;  3B8S A;  2PPO A;  4DRM A;  5B8I C;  4C02 B;  2PPN A;  2KR7 A;  2DWV A;  2M08 A;  4J4N A;  4ODM A;  4HAR A;  2WAE A;  4DRI A;  3MCB A;  1FKD A;  3FY1 A;  2XPA A;  2YSF A;  2YBT A;  4URI A;  1W1Y A;  4E5R A;  3UQB A;  4W9P A;  3FS8 A;  1KT1 A;  1JVW A;  2FAP A;  1FLC A;  5GPR A;  5HT1 A;  1TCO C;  1XHG A;  4MAV A;  3CHD A;  5CQ2 A;  3CHE A;  4MNM A;  1Q6H A;  2OFN A;  4ZPW R;  1FKR A;  2DSW A;  3NRK A;  1QZ2 A;  4MNL A;  1JNE A;  4Z2H A;  1FKK A;  3PRA A;  4DH0 A;  2DT1 A;  4JFL A;  2FDM A;  1M5Y A;  3KAB A;  4BF8 A;  4MGV A;  1GOI A;  3FSB A;  4LAY A;  2QF8 A;  4XAK A;  2Y8N B;  1E15 A;  4IQ2 A;  4Q7N A;  2XP7 A;  3MCB B;  3O5G A;  3WQW A;  4W9Q A;  4DRN A;  3PRD A;  3AS1 A;  3VAW A;  2KE0 A;  1ZU8 A;  5GPG A;  1JNS A;  1WNO A;  4JFJ A;  4MPK A;  1H0I A;  4TNS A;  1N1A A;  1EYM A;  4TW6 A;  3KCE A;  1LJY A;  4WIW A;  4PTM A;  3JYM A;  4P8V A;  2G41 A;  1W1P A;  1FFR A;  4DIP A;  2DPE A;  4ODK A;  4MNK A;  2XP3 A;  4A0U A;  3O5M A;  2ESC A;  2LKN A;  3KAC A;  1ZBW A;  2K8I A;  3ARQ A;  2RUD A;  4Z2K A;  1E6Z A;  1Q6U A;  4L3N A;  1ZL1 A;  3B9D A;  4Z2G A;  2WK2 A;  3CGN A;  2RQS A;  2RUC A;  1FKL A;  4P8W A;  1E6P A;  1SR0 A;  1D6O A;  2VN1 A;  1PIN A;  4MTV A;  4ZS6 A;  5J6E A;  4ITZ A;  4J4O A;  2L2S A;  4W5U A;  2WLZ A;  3IKD A;  2OLH A;  1D7H A;  1NH6 A;  2D9F A;  5AHT A;  3AS2 A;  1YAT A;  2LJ4 A;  4NNR A;  2LAJ A;  3L4H A;  2A3C A;  3QOK A;  4DRJ A;  1EG3 A;  4KQZ A;  3ARV A;  5JH8 A;  2ZAJ A;  3CH9 A;  1NWT A;  2DSV A;  1FKH A;  5DIT A;  3NI6 A;  4U84 A;  2E45 A;  3TCZ A;  1Y0O A;  4P8U A;  3PRB A;  2IF4 A;  4DWS D;  1W1V A;  5DIV A;  3UI4 A;  3WD1 A;  3MQG A;  3ARZ A;  1J4I A;  3RM9 A;  2KFW A;  3LKX B;  2A3A A;  2DT2 A;  4ODP A;  1JND A;  2ZR4 A;  2PV2 A;  3WKZ A;  2Q5A A;  5BXJ A;  4WJX A;  5HUA A;  3O5P A;  4HBO A;  5D75 A;  5E5W A;  1P5Q A;  4DRH A;  1ZBK A;  1F40 A;  2JX8 A;  5HWC A;  2YAJ B;  3MQH A;  1FKF A;  4AY1 A;  4KR0 B;  4TX0 A;  1HKK A;  4ZPT R;  1D7J A;  3WD4 A;  1NWR A;  1FD9 A;  3CZ8 A;  3RM8 A;  3CHC A;  2A3E A;  4IQC A;  4O2T A;  1WAW A;  4NSB A;  3KZ7 A;  2DMV A;  4IPX A;  1J6Y A;  2MLX A;  3RME A;  1JNT A;  2JXW A;  1SYT A;  1W9U A;  1X6N A;  2AOS A;  2ZQS A;  2XP4 A;  3KAI A;  1E9L A;  1B6C A;  1J4H A;  2PI6 A;  4TW7 A;  3RFW A;  1OGG A;  1O6W A;  4R5E A;  1EDQ A;  3O5J A;  1UR8 A;  1W9P A;  3B9E A;  1E6R A;  2WM0 A;  1ZCN A;  2YSI A;  3ARW A;  1FKG A;  1GPF A;  5HBF A;  1EIB A;  5DF0 A;  1TR8 A;  2RUR A;  1D2K A;  1Q1C A;  3O5E A;  2RE3 A;  3CGM A;  1ZBV A;  2JMF A;  1QPL A;  2MNT A;  2VCD A;  2F2D A;  3M7N A;  2AWG A;  5E66 A;  1PBK A;  3FAP A;  3KAG A;  3JXV A;  3ALF A;  1F8A B;  3ARP A;  4U85 A;  5E62 A;  3PA7 A;  4GIV A;  4L72 B;  4QZV B;  1LL7 A;  1O6I A;  4S3J A;  3WD2 A;  1TFV A;  1Q6I A;  1WR7 A;  3H9R B;  4Z2J A;  2MLZ A;  3B7X A;  1FKT A;  4ODQ A;  5HW6 A;  1KT0 A;  3KAH A;  1FKI A;  1BL4 A;  1HJX A;  5HTG A;  4DRQ A;  2YSH A;  2DG3 A;  1WB0 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...