2XP3A

Discovery of cell-active phenyl-imidazole pin1 inhibitors by structure-guided fragment evolution
Total Genus 46
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
46
sequence length
157
structure length
145
Chain Sequence
b'LPPGWEKAMSRSSGRVYYFNHITNASQWERPSEPARVRCSHLLVKHSQSRRPSSWRQEKITRTKEEALELINGYIQKIKSGEEDFESLASQFSDCSSAKARGDLGAFSRGQMQKPFEDASFALRTGEMSGPVFTDSGIHIILRTE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PEPTIDYL-PROLYL CIS-TRANS ISOMERASE NIMA-INTERACTING 1
publication title Discovery of Cell-Active Phenyl-Imidazole Pin1 Inhibitors by Structure-Guided Fragment Evolution.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Isomerase
total genus 46
structure length 145
sequence length 157
ec nomenclature ec 5.2.1.8: Peptidylprolyl isomerase.
pdb deposition date 2010-08-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00397 WW WW domain
A PF00639 Rotamase PPIC-type PPIASE domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.20.70.10 Mainly Beta Single Sheet Ubiquitin Ligase Nedd4; Chain: W; Ubiquitin Ligase Nedd4; Chain: W; 2xp3A01
3.10.50.40 Alpha Beta Roll Chitinase A; domain 3 Chitinase A; domain 3 2xp3A02
5DIVA 3H9RB 3UQAA 1JMQA 2JZVA 4R0XA 2ZQUA 3EY6A 2RSEA 2RUQA 2XP4A 1FKKA 5HUAA 2KO7A 1ROTA 2DMVA 1F40A 1FKIA 2MLXA 3IKDA 1BKFA 2YSGA 4ODLA 3UI4A 4LAWA 2M2AA 4ODRA 3UI5A 4IPXA 3PRBA 4LAVA 1FKDA 4NNRA 2DG3A 4TW7A 1TCOC 4J4OA 4W9PA 3M7NA 2PV1A 2YSBA 4ODOA 1EQ3A 2D9FA 4TYOA 2DG9A 1ZCNA 3RGCA 2ZAJA 2M8JA 2KI3A 3CGNA 1Q6UA 2PBCA 2XP5A 2M8IA 4DRIA 2F2DA 2L2SA 4G2PA 3PA7A 2M08A 3O5EA 1M5YA 5HT1A 1ROUA 3KABA 3JYMA 2KR7A 2AWGA 4W9OA 1FD9A 1FKLA 3O5FA 3TDBA 4JFMA 2Y78A 5BXJA 1FKFA 4MSPA 2ITKA 4TX0A 2M1IA 2BA1A 4IQ2A 4LAXA 3KACA 2YSIA 2KXQA 3KZ7A 1ZK6A 1O6WA 2LJ4A 3KAIA 2JX8A 5DITA 5HKGA 3KCEA 2YSHA 1HXVA 2VCDA 4REXA 4DRNA 1YW5A 4JFIA 1D7HA 4ITZA 3O5RA 2PPPA 2MNTA 3O5JA 1D7JA 4MGVA 2N87A 5HWBA 2K8IA 1FKBA 3M85A 3L4HA 1FKRA 1JNSA 4U84A 2KGJA 4TW8A 4DH0A 2PPNA 3LE4A 1J4IA 4C02B 4ODMA 1FKSA 3IK8A 1J4RA 2PV2A 3O5IA 4GIVA 1FKJA 3NI6A 3NRKA 2RE3A 4TNSA 1WMVA 1FKGA 5HW6A 1L1PA 4FN2A 5DIUA 3NTPA 2LKNA 2F21A 1K9RA 2RUDA 5J6EA 5HWCA 2DG4A 2DWVA 3KAGA 4FAPA 2RUCA 3KADA 1Q6HA 2JXWA 2MLYA 5HW7A 2ZR4A 3TC5A 3O5OA 4G50A 1B6CA 2F4EA 4IQCA 4W9QA 1J4HA 1Q6IA 4QT3A 1WR7A 3IHZA 1U79A 1FKTA 5HTGA 2ZR5A 4N19A 1FKHA 3RFWA 2ZR6A 2DK1A 1NSGA 1KT1A 2LAJA 2EZ5W 2XP7A 2RURA 4DZ3A 2UZ5A 2JMFA 1PBKA 3IKGA 2MLZA 2JV4A 3CNGA 1TK7A 2KFWA 2IF4A 3TCZA 1YATA 2XP9A 1W26A 2Q5AA 4TW6A 3UF8A 1F8AB 1EYMA 1EG3A 2LGOA 1KT0A 1NMVA 3O5LA 4DZ2A 5D75A 2MDIA 3JXVA 4ODQA 4JYSA 3O5MA 2ZQTA 3WH0A 3O5PA 2XP6A 2PV3A 5AHTA 3FAPA 2XP8A 4DRHA 1QZ2A 1NMWA 4DROA 2L4JA 4LAYA 4DRQA 1P5QA 1R9HA 4DT4A 2DJYA 1QPLA 3PRDA 3KAFA 4J4NA 4QT2A 1JNTA 2OFNA 2XPBA 4DRKA 3MDYB 1FAPA 4JFLA 1FJDA 4O2TA 2ZQVA 1D6OA 2VN1A 4QIBA 3UI6A 2KE0A 5I98A 1BL4A 2LPVA 4ODNA 5CQ2A 2ZQSA 4DRPA 1JVWA 2XP3A 2DK7A 3O5DA 2RQSA 1Y0OA 5GPGA 5B8IC 4ODKA 2FKEA 3LUOA 3ODKA 1EG4A 1N1AA 4ODPA 3UQBA 3JYJA 3O5GA 1QPFA 4U86A 3VAWA 1K9QA 4BF8A 3O5KA 2MF9A 1Q1CA 4JFKA 3I6CA 5HW8A 1C9HA 4DRJA 1A7XA 2MPHA 2E45A 4E5RA 2PPOA 3OOBA 4GGQA 3KAHA 1I5HW 1T11A 2FAPA 3UQIA 3GPKA 4JFJA 1D7IA 4DRMA 1J6YA 4U85A 1PINA 4DIPA 3O5QA 3B7XA 2M3OW 3CGMA 2XPAA 2YSFA
chains in the Genus database with same CATH superfamily
5DIVA 3QOKA 3H9RB 3UQAA 1JMQA 5E66A 2JZVA 4R0XA 2ZQUA 3EY6A 4MPKA 2RSEA 3CZ8A 1HKKA 2RUQA 4AY1A 2XP4A 1FKKA 5HUAA 4LGXA 4R5EA 4HBOA 2KO7A 1ROTA 2DMVA 1F40A 3ARPA 3CHFA 1FKIA 2MLXA 3IKDA 4Z2GA 4KQZA 1D2KA 1BKFA 4WJXA 1W1YA 2YSGA 4ODLA 3UI4A 4LAWA 2YAJB 2M2AA 1ZBCA 4ODRA 3UI5A 4IPXA 3PRBA 4LAVA 5E62A 1FKDA 4NNRA 2DG3A 1W9PA 4TW7A 1TCOC 1HKIA 4J4OA 4W9PA 1ZBKA 3FXYA 3M7NA 2PV1A 2YSBA 4ODOA 1EQ3A 2D9FA 1FFRA 4TYOA 1FFQA 1JNEA 5GQBA 2DG9A 4MNKA 1ZCNA 3RGCA 2ZAJA 2M8JA 2KI3A 3CGNA 1Q6UA 2PBCA 2XP5A 2M8IA 4DRIA 2F2DA 2L2SA 3MCBA 4G2PA 3MQGA 2YBUA 4Z2KA 3PA7A 2M08A 3O5EA 1LL7A 2DPEA 1M5YA 5HT1A 1ROUA 4P8VA 4W5UA 3KABA 3JYMA 2KR7A 4ZPTR 4MNJA 3B8SA 2AWGA 4W9OA 1FD9A 2DT0A 1TR8A 1FKLA 3O5FA 1E6PA 4MNLA 4Z2HA 3TDBA 4JFMA 1GRJA 1LJYA 2Y78A 5BXJA 1FKFA 2B31A 3ALFA 3WL1A 4GLXA 4MSPA 2ITKA 4TX0A 1ZB5A 3ARRA 5E5WA 4NSBA 2A3AA 1RP5A 2M1IA 5E64A 2BA1A 3CHCA 4IQ2A 4DWSD 2OWOA 4LAXA 2A3EA 3KACA 1HJWA 2WAEA 3AROA 2YSIA 2KXQA 3ARQA 3KZ7A 1XRVA 1ZK6A 4MNMA 1O6WA 2LJ4A 3ALGA 3EIPA 3KAIA 1W1PA 2JX8A 3RM9A 1W1VA 5DITA 5HKGA 3AS3A 1OGBA 3OA5A 1EHNA 3KCEA 2O92A 1NWSA 1E6NA 2YSHA 1HXVA 2G41A 2VCDA 4REXA 3ARZA 3BMBA 5GPRA 4DRNA 4Z2LA 1YW5A 2WM0A 4JFIA 1D7HA 4ITZA 3O5RA 2PPPA 1ZL1A 2MNTA 4P8XA 3O5JA 1D7JA 3LKXA 4MGVA 2N87A 5HWBA 2K8IA 4ZPVR 3G6MA 1FKBA 3M85A 1OGGA 4Z2IA 2WLYA 3L4HA 3MCBB 1E6RA 3WD1A 1FKRA 1HJVA 1JNSA 2KGJA 4U84A 2DT3A 4TW8A 4DH0A 2PPNA 1X6LA 3LE4A 1E15A 5JH8A 1J4IA 4P8WA 5DEZA 4Q22A 2ETNA 3WQWA 4P8UA 4C02B 4ZPWR 3WD3A 4ODMA 1FKSA 2OLHA 3IK8A 3FY1A 4ML4A 5DF0A 1J4RA 2PV2A 1FLCA 3O5IA 5DO2A 4GIVA 2Y8NB 3MQHA 1FKJA 1LL4A 3NI6A 2RE3A 3NRKA 2DSZA 4TNSA 1WMVA 1FKGA 1GUVA 5HW6A 2G8ZA 2DSUA 1RD6A 3B9AA 3RMEA 1L1PA 4MTVA 4FN2A 5DIUA 4XAKA 3NTPA 2LKNA 2F21A 1K9RA 2RUDA 5J6EA 4L3NA 5HWCA 3GU0A 2DG4A 2DWVA 3KAGA 4FAPA 1E9LA 2O9OA 2RUCA 2WADA 3KADA 1Q6HA 5E65A 4L72B 2AOSA 3LKXB 2JXWA 2MLYA 1SYTA 2P4VA 5HW7A 2ESCA 1WB0A 1OWQA 2ZR4A 3AS2A 3TC5A 1JNDA 3O5OA 4G50A 3FS8A 1B6CA 2F4EA 3WD4A 4IQCA 4W9QA 1J4HA 1Q6IA 4QT3A 3AQUA 2A3BA 1CTNA 1WR7A 3IHZA 2DSVA 3WD0A 1U79A 1ZBVA 1FKTA 5HTGA 2ZR5A 4N19A 1UR8A 1FKHA 3AS0A 3RFWA 2ZR6A 2QRVA 2DK1A 1NSGA 1KT1A 1W9UA 4WKFA 3CH9A 2LAJA 2EZ5W 2XP7A 2RURA 4DZ3A 1ITXA 2UZ5A 2JMFA 4URIA 1E6ZA 1PBKA 3IKGA 2MLZA 2JV4A 4Q7NA 3CNGA 5HBFA 1TK7A 2KFWA 3AS1A 3WKZA 2IF4A 4NZCA 3TCZA 1YATA 2XP9A 1W26A 3FSBA 2Q5AA 4DWSA 4MAVA 2WLZA 4TW6A 3UF8A 1F8AB 1EYMA 1EG3A 1NH6A 2LGOA 4WKHA 1KT0A 1NMVA 3O5LA 2QF8A 4DZ2A 5D75A 1NWTA 4PTMA 3PR9A 2MDIA 4WK9A 3PRAA 3JXVA 1X6NA 4ODQA 4JYSA 3O5MA 3G6LA 2ZQTA 3WH0A 4WIWA 3O5PA 2XP6A 2PV3A 1LG1A 3WL0A 5AHTA 1EIBA 1LL6A 3FAPA 2XP8A 4DRHA 1QZ2A 1NMWA 3BXWA 4DROA 2L4JA 2YBTA 3RM8A 4LAYA 4DRQA 1P5QA 4A0UA 1R9HA 4DT4A 2DJYA 1QPLA 3PRDA 3KAFA 4J4NA 4QT2A 1JNTA 2OFNA 1GOIA 5U47A 1UR9A 1XHGA 2WK2A 1LG2A 2XPBA 1SR0A 4DRKA 4Z2JA 3MDYB 1FAPA 1ZU8A 2A3CA 1WNOA 3WIJA 1NWUA 2DT1A 1IX5A 3PQHA 3WD2A 3ARUA 2EULA 4JFLA 1E44A 1FJDA 4ZS6A 4O2TA 2ZQVA 1O6IA 1D6OA 2FDMA 2VN1A 4QIBA 1HKMA 3UI6A 2KE0A 1W9VA 4DWSB 2PN0A 4HARA 5I98A 3ARWA 1VF8A 4DWSC 1WAWA 1BL4A 4S3KA 2LPVA 4ODNA 5CQ2A 3ARSA 4HBEA 4S3JA 2ZQSA 4DRPA 1JVWA 2XP3A 2DK7A 3W4RA 3O5DA 2RQSA 1LQ0A 1Y0OA 3ARXA 4UDMA 5GPGA 4WKAA 5B8IC 2IUZA 1K9TA 4IT4A 1ZBWA 4IT6A 4ODKA 2FKEA 3LUOA 1EG4A 3ODKA 3CHDA 1N1AA 4ODPA 3UQBA 3JYJA 3O5GA 1QPFA 4U86A 3VAWA 1K9QA 2B5UB 4BF8A 3O5KA 3FSCA 2MF9A 1Q1CA 3B9DA 4JFKA 3I6CA 2PI6A 5HW8A 4A0TA 2DSWA 1C9HA 1GPFA 4DRJA 1HJXA 1TFVA 1A7XA 1JCHB 2DT2A 2MPHA 2E45A 4E5RA 2PPOA 1NWRA 3OOBA 4GGQA 1H0IA 3KAHA 1EDQA 1I5HW 1T11A 2FAPA 3ARTA 3B9EA 3UQIA 1W1TA 3GPKA 4JFJA 1D7IA 4DRMA 3ARVA 2F23A 3ARYA 4KR0B 1KFWA 1J6YA 4U85A 1PINA 3GTYX 4DIPA 3O5QA 3CHEA 3RM4A 3WQVA 3B7XA 4QZVB 1HKJA 2M3OW 3CGMA 2XPAA 2YSFA 1H0GA
chains in the Genus database with same CATH topology
5DIVA 3QOKA 3H9RB 3UQAA 1JMQA 5E66A 2JZVA 4R0XA 2ZQUA 3EY6A 4MPKA 2RSEA 3CZ8A 1HKKA 2RUQA 4AY1A 2XP4A 1FKKA 5HUAA 4LGXA 4R5EA 4HBOA 2KO7A 1ROTA 2DMVA 1F40A 3ARPA 3CHFA 1FKIA 2MLXA 3IKDA 4Z2GA 4KQZA 1D2KA 1BKFA 4WJXA 1W1YA 2YSGA 4ODLA 3UI4A 4LAWA 2YAJB 2M2AA 1ZBCA 4ODRA 3UI5A 4IPXA 3PRBA 4LAVA 5E62A 1FKDA 4NNRA 2DG3A 1W9PA 4TW7A 1TCOC 1HKIA 4J4OA 4W9PA 1ZBKA 3FXYA 3M7NA 2PV1A 2YSBA 4ODOA 1EQ3A 2D9FA 1FFRA 4TYOA 1FFQA 1JNEA 5GQBA 2DG9A 4MNKA 1ZCNA 3RGCA 2ZAJA 2M8JA 2KI3A 3CGNA 1Q6UA 2PBCA 2XP5A 2M8IA 4DRIA 2F2DA 2L2SA 3MCBA 4G2PA 3MQGA 2YBUA 4Z2KA 3PA7A 2M08A 3O5EA 1LL7A 2DPEA 1M5YA 5HT1A 1ROUA 4P8VA 4W5UA 3KABA 3JYMA 2KR7A 4ZPTR 4MNJA 3B8SA 2AWGA 4W9OA 1FD9A 2DT0A 1TR8A 1FKLA 3O5FA 1E6PA 4MNLA 4Z2HA 3TDBA 4JFMA 1LJYA 2Y78A 5BXJA 1FKFA 2B31A 3ALFA 3WL1A 4GLXA 4MSPA 2ITKA 4TX0A 1ZB5A 3ARRA 5E5WA 4NSBA 2A3AA 1RP5A 2M1IA 5E64A 2BA1A 3CHCA 4IQ2A 4DWSD 2OWOA 4LAXA 2A3EA 3KACA 1HJWA 2WAEA 3AROA 2YSIA 2KXQA 3ARQA 3KZ7A 1XRVA 1ZK6A 4MNMA 1O6WA 2LJ4A 3ALGA 3KAIA 1W1PA 2JX8A 3RM9A 1W1VA 5DITA 5HKGA 3AS3A 1OGBA 3OA5A 1EHNA 3KCEA 2O92A 1NWSA 1E6NA 2YSHA 1HXVA 2G41A 2VCDA 4REXA 3ARZA 5GPRA 4DRNA 4Z2LA 1YW5A 2WM0A 4JFIA 1D7HA 4ITZA 3O5RA 2PPPA 1ZL1A 2MNTA 4P8XA 3O5JA 1D7JA 3LKXA 4MGVA 2N87A 5HWBA 2K8IA 4ZPVR 3G6MA 1FKBA 3M85A 1OGGA 4Z2IA 2WLYA 3L4HA 3MCBB 1E6RA 3WD1A 1FKRA 1HJVA 1JNSA 2KGJA 4U84A 2DT3A 4TW8A 4DH0A 2PPNA 1X6LA 3LE4A 1E15A 5JH8A 1J4IA 4P8WA 5DEZA 4Q22A 3WQWA 4P8UA 4C02B 4ZPWR 3WD3A 4ODMA 1FKSA 2OLHA 3IK8A 3FY1A 4ML4A 5DF0A 1J4RA 2PV2A 1FLCA 3O5IA 5DO2A 4GIVA 2Y8NB 3MQHA 1FKJA 1LL4A 3NI6A 2RE3A 3NRKA 2DSZA 4TNSA 1WMVA 1FKGA 1GUVA 5HW6A 2G8ZA 2DSUA 1RD6A 3B9AA 3RMEA 1L1PA 4MTVA 4FN2A 5DIUA 4XAKA 3NTPA 2LKNA 2F21A 1K9RA 2RUDA 5J6EA 4L3NA 5HWCA 2DG4A 2DWVA 3KAGA 4FAPA 1E9LA 2O9OA 2RUCA 2WADA 3KADA 1Q6HA 5E65A 4L72B 2AOSA 3LKXB 2JXWA 2MLYA 1SYTA 5HW7A 2ESCA 1WB0A 1OWQA 2ZR4A 3AS2A 3TC5A 1JNDA 3O5OA 4G50A 3FS8A 1B6CA 2F4EA 3WD4A 4IQCA 4W9QA 1J4HA 1Q6IA 4QT3A 3AQUA 2A3BA 1CTNA 1WR7A 3IHZA 2DSVA 3WD0A 1U79A 1ZBVA 1FKTA 5HTGA 2ZR5A 4N19A 1UR8A 1FKHA 3AS0A 3RFWA 2ZR6A 2QRVA 2DK1A 1NSGA 1KT1A 1W9UA 4WKFA 3CH9A 2LAJA 2EZ5W 2XP7A 2RURA 4DZ3A 1ITXA 2UZ5A 2JMFA 4URIA 1E6ZA 1PBKA 3IKGA 2MLZA 2JV4A 4Q7NA 3CNGA 5HBFA 1TK7A 2KFWA 3AS1A 3WKZA 2IF4A 4NZCA 3TCZA 1YATA 2XP9A 1W26A 3FSBA 2Q5AA 4DWSA 4MAVA 2WLZA 4TW6A 3UF8A 1F8AB 1EYMA 1EG3A 1NH6A 2LGOA 4WKHA 1KT0A 1NMVA 3O5LA 2QF8A 4DZ2A 5D75A 1NWTA 4PTMA 3PR9A 2MDIA 4WK9A 3PRAA 3JXVA 1X6NA 4ODQA 4JYSA 3O5MA 3G6LA 2ZQTA 3WH0A 4WIWA 3O5PA 2XP6A 2PV3A 1LG1A 3WL0A 5AHTA 1EIBA 1LL6A 3FAPA 2XP8A 4DRHA 1QZ2A 1NMWA 3BXWA 4DROA 2L4JA 2YBTA 3RM8A 4LAYA 4DRQA 1P5QA 4A0UA 1R9HA 4DT4A 2DJYA 1QPLA 3PRDA 3KAFA 4J4NA 4QT2A 1JNTA 2OFNA 1GOIA 5U47A 1UR9A 1XHGA 2WK2A 1LG2A 2XPBA 1SR0A 4DRKA 4Z2JA 3MDYB 1FAPA 1ZU8A 2A3CA 1WNOA 3WIJA 1NWUA 2DT1A 1IX5A 3PQHA 3WD2A 3ARUA 4JFLA 1FJDA 4ZS6A 4O2TA 2ZQVA 1O6IA 1D6OA 2FDMA 2VN1A 4QIBA 1HKMA 3UI6A 2KE0A 1W9VA 4DWSB 4HARA 5I98A 3ARWA 1VF8A 4DWSC 1WAWA 1BL4A 4S3KA 2LPVA 4ODNA 5CQ2A 3ARSA 4HBEA 4S3JA 2ZQSA 4DRPA 1JVWA 2XP3A 2DK7A 3W4RA 3O5DA 2RQSA 1LQ0A 1Y0OA 3ARXA 5GPGA 4WKAA 5B8IC 2IUZA 1K9TA 4IT4A 1ZBWA 4IT6A 4ODKA 2FKEA 3LUOA 1EG4A 3ODKA 3CHDA 1N1AA 4ODPA 3UQBA 3JYJA 3O5GA 1QPFA 4U86A 3VAWA 1K9QA 4BF8A 3O5KA 3FSCA 2MF9A 1Q1CA 3B9DA 4JFKA 3I6CA 2PI6A 5HW8A 4A0TA 2DSWA 1C9HA 1GPFA 4DRJA 1HJXA 1TFVA 1A7XA 2DT2A 2MPHA 2E45A 4E5RA 2PPOA 1NWRA 3OOBA 4GGQA 1H0IA 3KAHA 1EDQA 1I5HW 1T11A 2FAPA 3ARTA 3B9EA 3UQIA 1W1TA 3GPKA 4JFJA 1D7IA 4DRMA 3ARVA 4KR0B 3ARYA 1J6YA 1KFWA 4U85A 1PINA 4DIPA 3O5QA 3CHEA 3RM4A 3WQVA 3B7XA 4QZVB 1HKJA 2M3OW 3CGMA 2XPAA 2YSFA 1H0GA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5DIV A;  3H9R B;  3UQA A;  1JMQ A;  2JZV A;  4R0X A;  2ZQU A;  3EY6 A;  2RSE A;  2RUQ A;  2XP4 A;  1FKK A;  5HUA A;  2KO7 A;  1ROT A;  2DMV A;  1F40 A;  1FKI A;  2MLX A;  3IKD A;  1BKF A;  2YSG A;  4ODL A;  3UI4 A;  4LAW A;  2M2A A;  4ODR A;  3UI5 A;  4IPX A;  3PRB A;  4LAV A;  1FKD A;  4NNR A;  2DG3 A;  4TW7 A;  1TCO C;  4J4O A;  4W9P A;  3M7N A;  2PV1 A;  2YSB A;  4ODO A;  1EQ3 A;  2D9F A;  4TYO A;  2DG9 A;  1ZCN A;  3RGC A;  2ZAJ A;  2M8J A;  2KI3 A;  3CGN A;  1Q6U A;  2PBC A;  2XP5 A;  2M8I A;  4DRI A;  2F2D A;  2L2S A;  4G2P A;  3PA7 A;  2M08 A;  3O5E A;  1M5Y A;  5HT1 A;  1ROU A;  3KAB A;  3JYM A;  2KR7 A;  2AWG A;  4W9O A;  1FD9 A;  1FKL A;  3O5F A;  3TDB A;  4JFM A;  2Y78 A;  5BXJ A;  1FKF A;  4MSP A;  2ITK A;  4TX0 A;  2M1I A;  2BA1 A;  4IQ2 A;  4LAX A;  3KAC A;  2YSI A;  2KXQ A;  3KZ7 A;  1ZK6 A;  1O6W A;  2LJ4 A;  3KAI A;  2JX8 A;  5DIT A;  5HKG A;  3KCE A;  2YSH A;  1HXV A;  2VCD A;  4REX A;  4DRN A;  1YW5 A;  4JFI A;  1D7H A;  4ITZ A;  3O5R A;  2PPP A;  2MNT A;  3O5J A;  1D7J A;  4MGV A;  2N87 A;  5HWB A;  2K8I A;  1FKB A;  3M85 A;  3L4H A;  1FKR A;  1JNS A;  4U84 A;  2KGJ A;  4TW8 A;  4DH0 A;  2PPN A;  3LE4 A;  1J4I A;  4C02 B;  4ODM A;  1FKS A;  3IK8 A;  1J4R A;  2PV2 A;  3O5I A;  4GIV A;  1FKJ A;  3NI6 A;  3NRK A;  2RE3 A;  4TNS A;  1WMV A;  1FKG A;  5HW6 A;  1L1P A;  4FN2 A;  5DIU A;  3NTP A;  2LKN A;  2F21 A;  1K9R A;  2RUD A;  5J6E A;  5HWC A;  2DG4 A;  2DWV A;  3KAG A;  4FAP A;  2RUC A;  3KAD A;  1Q6H A;  2JXW A;  2MLY A;  5HW7 A;  2ZR4 A;  3TC5 A;  3O5O A;  4G50 A;  1B6C A;  2F4E A;  4IQC A;  4W9Q A;  1J4H A;  1Q6I A;  4QT3 A;  1WR7 A;  3IHZ A;  1U79 A;  1FKT A;  5HTG A;  2ZR5 A;  4N19 A;  1FKH A;  3RFW A;  2ZR6 A;  2DK1 A;  1NSG A;  1KT1 A;  2LAJ A;  2EZ5 W;  2XP7 A;  2RUR A;  4DZ3 A;  2UZ5 A;  2JMF A;  1PBK A;  3IKG A;  2MLZ A;  2JV4 A;  3CNG A;  1TK7 A;  2KFW A;  2IF4 A;  3TCZ A;  1YAT A;  2XP9 A;  1W26 A;  2Q5A A;  4TW6 A;  3UF8 A;  1F8A B;  1EYM A;  1EG3 A;  2LGO A;  1KT0 A;  1NMV A;  3O5L A;  4DZ2 A;  5D75 A;  2MDI A;  3JXV A;  4ODQ A;  4JYS A;  3O5M A;  2ZQT A;  3WH0 A;  3O5P A;  2XP6 A;  2PV3 A;  5AHT A;  3FAP A;  2XP8 A;  4DRH A;  1QZ2 A;  1NMW A;  4DRO A;  2L4J A;  4LAY A;  4DRQ A;  1P5Q A;  1R9H A;  4DT4 A;  2DJY A;  1QPL A;  3PRD A;  3KAF A;  4J4N A;  4QT2 A;  1JNT A;  2OFN A;  2XPB A;  4DRK A;  3MDY B;  1FAP A;  4JFL A;  1FJD A;  4O2T A;  2ZQV A;  1D6O A;  2VN1 A;  4QIB A;  3UI6 A;  2KE0 A;  5I98 A;  1BL4 A;  2LPV A;  4ODN A;  5CQ2 A;  2ZQS A;  4DRP A;  1JVW A;  2XP3 A;  2DK7 A;  3O5D A;  2RQS A;  1Y0O A;  5GPG A;  5B8I C;  4ODK A;  2FKE A;  3LUO A;  3ODK A;  1EG4 A;  1N1A A;  4ODP A;  3UQB A;  3JYJ A;  3O5G A;  1QPF A;  4U86 A;  3VAW A;  1K9Q A;  4BF8 A;  3O5K A;  2MF9 A;  1Q1C A;  4JFK A;  3I6C A;  5HW8 A;  1C9H A;  4DRJ A;  1A7X A;  2MPH A;  2E45 A;  4E5R A;  2PPO A;  3OOB A;  4GGQ A;  3KAH A;  1I5H W;  1T11 A;  2FAP A;  3UQI A;  3GPK A;  4JFJ A;  1D7I A;  4DRM A;  1J6Y A;  4U85 A;  1PIN A;  4DIP A;  3O5Q A;  3B7X A;  2M3O W;  3CGM A;  2XPA A;  2YSF A; 
#chains in the Genus database with same CATH topology
 5DIV A;  3QOK A;  3H9R B;  3UQA A;  1JMQ A;  5E66 A;  2JZV A;  4R0X A;  2ZQU A;  3EY6 A;  4MPK A;  2RSE A;  3CZ8 A;  1HKK A;  2RUQ A;  4AY1 A;  2XP4 A;  1FKK A;  5HUA A;  4LGX A;  4R5E A;  4HBO A;  2KO7 A;  1ROT A;  2DMV A;  1F40 A;  3ARP A;  3CHF A;  1FKI A;  2MLX A;  3IKD A;  4Z2G A;  4KQZ A;  1D2K A;  1BKF A;  4WJX A;  1W1Y A;  2YSG A;  4ODL A;  3UI4 A;  4LAW A;  2YAJ B;  2M2A A;  1ZBC A;  4ODR A;  3UI5 A;  4IPX A;  3PRB A;  4LAV A;  5E62 A;  1FKD A;  4NNR A;  2DG3 A;  1W9P A;  4TW7 A;  1TCO C;  1HKI A;  4J4O A;  4W9P A;  1ZBK A;  3FXY A;  3M7N A;  2PV1 A;  2YSB A;  4ODO A;  1EQ3 A;  2D9F A;  1FFR A;  4TYO A;  1FFQ A;  1JNE A;  5GQB A;  2DG9 A;  4MNK A;  1ZCN A;  3RGC A;  2ZAJ A;  2M8J A;  2KI3 A;  3CGN A;  1Q6U A;  2PBC A;  2XP5 A;  2M8I A;  4DRI A;  2F2D A;  2L2S A;  3MCB A;  4G2P A;  3MQG A;  2YBU A;  4Z2K A;  3PA7 A;  2M08 A;  3O5E A;  1LL7 A;  2DPE A;  1M5Y A;  5HT1 A;  1ROU A;  4P8V A;  4W5U A;  3KAB A;  3JYM A;  2KR7 A;  4ZPT R;  4MNJ A;  3B8S A;  2AWG A;  4W9O A;  1FD9 A;  2DT0 A;  1TR8 A;  1FKL A;  3O5F A;  1E6P A;  4MNL A;  4Z2H A;  3TDB A;  4JFM A;  1GRJ A;  1LJY A;  2Y78 A;  5BXJ A;  1FKF A;  2B31 A;  3ALF A;  3WL1 A;  4GLX A;  4MSP A;  2ITK A;  4TX0 A;  1ZB5 A;  3ARR A;  5E5W A;  4NSB A;  2A3A A;  1RP5 A;  2M1I A;  5E64 A;  2BA1 A;  3CHC A;  4IQ2 A;  4DWS D;  2OWO A;  4LAX A;  2A3E A;  3KAC A;  1HJW A;  2WAE A;  3ARO A;  2YSI A;  2KXQ A;  3ARQ A;  3KZ7 A;  1XRV A;  1ZK6 A;  4MNM A;  1O6W A;  2LJ4 A;  3ALG A;  3EIP A;  3KAI A;  1W1P A;  2JX8 A;  3RM9 A;  1W1V A;  5DIT A;  5HKG A;  3AS3 A;  1OGB A;  3OA5 A;  1EHN A;  3KCE A;  2O92 A;  1NWS A;  1E6N A;  2YSH A;  1HXV A;  2G41 A;  2VCD A;  4REX A;  3ARZ A;  3BMB A;  5GPR A;  4DRN A;  4Z2L A;  1YW5 A;  2WM0 A;  4JFI A;  1D7H A;  4ITZ A;  3O5R A;  2PPP A;  1ZL1 A;  2MNT A;  4P8X A;  3O5J A;  1D7J A;  3LKX A;  4MGV A;  2N87 A;  5HWB A;  2K8I A;  4ZPV R;  3G6M A;  1FKB A;  3M85 A;  1OGG A;  4Z2I A;  2WLY A;  3L4H A;  3MCB B;  1E6R A;  3WD1 A;  1FKR A;  1HJV A;  1JNS A;  2KGJ A;  4U84 A;  2DT3 A;  4TW8 A;  4DH0 A;  2PPN A;  1X6L A;  3LE4 A;  1E15 A;  5JH8 A;  1J4I A;  4P8W A;  5DEZ A;  4Q22 A;  2ETN A;  3WQW A;  4P8U A;  4C02 B;  4ZPW R;  3WD3 A;  4ODM A;  1FKS A;  2OLH A;  3IK8 A;  3FY1 A;  4ML4 A;  5DF0 A;  1J4R A;  2PV2 A;  1FLC A;  3O5I A;  5DO2 A;  4GIV A;  2Y8N B;  3MQH A;  1FKJ A;  1LL4 A;  3NI6 A;  2RE3 A;  3NRK A;  2DSZ A;  4TNS A;  1WMV A;  1FKG A;  1GUV A;  5HW6 A;  2G8Z A;  2DSU A;  1RD6 A;  3B9A A;  3RME A;  1L1P A;  4MTV A;  4FN2 A;  5DIU A;  4XAK A;  3NTP A;  2LKN A;  2F21 A;  1K9R A;  2RUD A;  5J6E A;  4L3N A;  5HWC A;  3GU0 A;  2DG4 A;  2DWV A;  3KAG A;  4FAP A;  1E9L A;  2O9O A;  2RUC A;  2WAD A;  3KAD A;  1Q6H A;  5E65 A;  4L72 B;  2AOS A;  3LKX B;  2JXW A;  2MLY A;  1SYT A;  2P4V A;  5HW7 A;  2ESC A;  1WB0 A;  1OWQ A;  2ZR4 A;  3AS2 A;  3TC5 A;  1JND A;  3O5O A;  4G50 A;  3FS8 A;  1B6C A;  2F4E A;  3WD4 A;  4IQC A;  4W9Q A;  1J4H A;  1Q6I A;  4QT3 A;  3AQU A;  2A3B A;  1CTN A;  1WR7 A;  3IHZ A;  2DSV A;  3WD0 A;  1U79 A;  1ZBV A;  1FKT A;  5HTG A;  2ZR5 A;  4N19 A;  1UR8 A;  1FKH A;  3AS0 A;  3RFW A;  2ZR6 A;  2QRV A;  2DK1 A;  1NSG A;  1KT1 A;  1W9U A;  4WKF A;  3CH9 A;  2LAJ A;  2EZ5 W;  2XP7 A;  2RUR A;  4DZ3 A;  1ITX A;  2UZ5 A;  2JMF A;  4URI A;  1E6Z A;  1PBK A;  3IKG A;  2MLZ A;  2JV4 A;  4Q7N A;  3CNG A;  5HBF A;  1TK7 A;  2KFW A;  3AS1 A;  3WKZ A;  2IF4 A;  4NZC A;  3TCZ A;  1YAT A;  2XP9 A;  1W26 A;  3FSB A;  2Q5A A;  4DWS A;  4MAV A;  2WLZ A;  4TW6 A;  3UF8 A;  1F8A B;  1EYM A;  1EG3 A;  1NH6 A;  2LGO A;  4WKH A;  1KT0 A;  1NMV A;  3O5L A;  2QF8 A;  4DZ2 A;  5D75 A;  1NWT A;  4PTM A;  3PR9 A;  2MDI A;  4WK9 A;  3PRA A;  3JXV A;  1X6N A;  4ODQ A;  4JYS A;  3O5M A;  3G6L A;  2ZQT A;  3WH0 A;  4WIW A;  3O5P A;  2XP6 A;  2PV3 A;  1LG1 A;  3WL0 A;  5AHT A;  1EIB A;  1LL6 A;  3FAP A;  2XP8 A;  4DRH A;  1QZ2 A;  1NMW A;  3BXW A;  4DRO A;  2L4J A;  2YBT A;  3RM8 A;  4LAY A;  4DRQ A;  1P5Q A;  4A0U A;  1R9H A;  4DT4 A;  2DJY A;  1QPL A;  3PRD A;  3KAF A;  4J4N A;  4QT2 A;  1JNT A;  2OFN A;  1GOI A;  5U47 A;  1UR9 A;  1XHG A;  2WK2 A;  1LG2 A;  2XPB A;  1SR0 A;  4DRK A;  4Z2J A;  3MDY B;  1FAP A;  1ZU8 A;  2A3C A;  1WNO A;  3WIJ A;  1NWU A;  2DT1 A;  1IX5 A;  3PQH A;  3WD2 A;  3ARU A;  2EUL A;  4JFL A;  1E44 A;  1FJD A;  4ZS6 A;  4O2T A;  2ZQV A;  1O6I A;  1D6O A;  2FDM A;  2VN1 A;  4QIB A;  1HKM A;  3UI6 A;  2KE0 A;  1W9V A;  4DWS B;  2PN0 A;  4HAR A;  5I98 A;  3ARW A;  1VF8 A;  4DWS C;  1WAW A;  1BL4 A;  4S3K A;  2LPV A;  4ODN A;  5CQ2 A;  3ARS A;  4HBE A;  4S3J A;  2ZQS A;  4DRP A;  1JVW A;  2XP3 A;  2DK7 A;  3W4R A;  3O5D A;  2RQS A;  1LQ0 A;  1Y0O A;  3ARX A;  4UDM A;  5GPG A;  4WKA A;  5B8I C;  2IUZ A;  1K9T A;  4IT4 A;  1ZBW A;  4IT6 A;  4ODK A;  2FKE A;  3LUO A;  1EG4 A;  3ODK A;  3CHD A;  1N1A A;  4ODP A;  3UQB A;  3JYJ A;  3O5G A;  1QPF A;  4U86 A;  3VAW A;  1K9Q A;  2B5U B;  4BF8 A;  3O5K A;  3FSC A;  2MF9 A;  1Q1C A;  3B9D A;  4JFK A;  3I6C A;  2PI6 A;  5HW8 A;  4A0T A;  2DSW A;  1C9H A;  1GPF A;  4DRJ A;  1HJX A;  1TFV A;  1A7X A;  1JCH B;  2DT2 A;  2MPH A;  2E45 A;  4E5R A;  2PPO A;  1NWR A;  3OOB A;  4GGQ A;  1H0I A;  3KAH A;  1EDQ A;  1I5H W;  1T11 A;  2FAP A;  3ART A;  3B9E A;  3UQI A;  1W1T A;  3GPK A;  4JFJ A;  1D7I A;  4DRM A;  3ARV A;  2F23 A;  3ARY A;  4KR0 B;  1KFW A;  1J6Y A;  4U85 A;  1PIN A;  3GTY X;  4DIP A;  3O5Q A;  3CHE A;  3RM4 A;  3WQV A;  3B7X A;  4QZV B;  1HKJ A;  2M3O W;  3CGM A;  2XPA A;  2YSF A;  1H0G A; 
#chains in the Genus database with same CATH homology
 5DIV A;  3QOK A;  3H9R B;  3UQA A;  1JMQ A;  5E66 A;  2JZV A;  4R0X A;  2ZQU A;  3EY6 A;  4MPK A;  2RSE A;  3CZ8 A;  1HKK A;  2RUQ A;  4AY1 A;  2XP4 A;  1FKK A;  5HUA A;  4LGX A;  4R5E A;  4HBO A;  2KO7 A;  1ROT A;  2DMV A;  1F40 A;  3ARP A;  3CHF A;  1FKI A;  2MLX A;  3IKD A;  4Z2G A;  4KQZ A;  1D2K A;  1BKF A;  4WJX A;  1W1Y A;  2YSG A;  4ODL A;  3UI4 A;  4LAW A;  2YAJ B;  2M2A A;  1ZBC A;  4ODR A;  3UI5 A;  4IPX A;  3PRB A;  4LAV A;  5E62 A;  1FKD A;  4NNR A;  2DG3 A;  1W9P A;  4TW7 A;  1TCO C;  1HKI A;  4J4O A;  4W9P A;  1ZBK A;  3FXY A;  3M7N A;  2PV1 A;  2YSB A;  4ODO A;  1EQ3 A;  2D9F A;  1FFR A;  4TYO A;  1FFQ A;  1JNE A;  5GQB A;  2DG9 A;  4MNK A;  1ZCN A;  3RGC A;  2ZAJ A;  2M8J A;  2KI3 A;  3CGN A;  1Q6U A;  2PBC A;  2XP5 A;  2M8I A;  4DRI A;  2F2D A;  2L2S A;  3MCB A;  4G2P A;  3MQG A;  2YBU A;  4Z2K A;  3PA7 A;  2M08 A;  3O5E A;  1LL7 A;  2DPE A;  1M5Y A;  5HT1 A;  1ROU A;  4P8V A;  4W5U A;  3KAB A;  3JYM A;  2KR7 A;  4ZPT R;  4MNJ A;  3B8S A;  2AWG A;  4W9O A;  1FD9 A;  2DT0 A;  1TR8 A;  1FKL A;  3O5F A;  1E6P A;  4MNL A;  4Z2H A;  3TDB A;  4JFM A;  1LJY A;  2Y78 A;  5BXJ A;  1FKF A;  2B31 A;  3ALF A;  3WL1 A;  4GLX A;  4MSP A;  2ITK A;  4TX0 A;  1ZB5 A;  3ARR A;  5E5W A;  4NSB A;  2A3A A;  1RP5 A;  2M1I A;  5E64 A;  2BA1 A;  3CHC A;  4IQ2 A;  4DWS D;  2OWO A;  4LAX A;  2A3E A;  3KAC A;  1HJW A;  2WAE A;  3ARO A;  2YSI A;  2KXQ A;  3ARQ A;  3KZ7 A;  1XRV A;  1ZK6 A;  4MNM A;  1O6W A;  2LJ4 A;  3ALG A;  3KAI A;  1W1P A;  2JX8 A;  3RM9 A;  1W1V A;  5DIT A;  5HKG A;  3AS3 A;  1OGB A;  3OA5 A;  1EHN A;  3KCE A;  2O92 A;  1NWS A;  1E6N A;  2YSH A;  1HXV A;  2G41 A;  2VCD A;  4REX A;  3ARZ A;  5GPR A;  4DRN A;  4Z2L A;  1YW5 A;  2WM0 A;  4JFI A;  1D7H A;  4ITZ A;  3O5R A;  2PPP A;  1ZL1 A;  2MNT A;  4P8X A;  3O5J A;  1D7J A;  3LKX A;  4MGV A;  2N87 A;  5HWB A;  2K8I A;  4ZPV R;  3G6M A;  1FKB A;  3M85 A;  1OGG A;  4Z2I A;  2WLY A;  3L4H A;  3MCB B;  1E6R A;  3WD1 A;  1FKR A;  1HJV A;  1JNS A;  2KGJ A;  4U84 A;  2DT3 A;  4TW8 A;  4DH0 A;  2PPN A;  1X6L A;  3LE4 A;  1E15 A;  5JH8 A;  1J4I A;  4P8W A;  5DEZ A;  4Q22 A;  3WQW A;  4P8U A;  4C02 B;  4ZPW R;  3WD3 A;  4ODM A;  1FKS A;  2OLH A;  3IK8 A;  3FY1 A;  4ML4 A;  5DF0 A;  1J4R A;  2PV2 A;  1FLC A;  3O5I A;  5DO2 A;  4GIV A;  2Y8N B;  3MQH A;  1FKJ A;  1LL4 A;  3NI6 A;  2RE3 A;  3NRK A;  2DSZ A;  4TNS A;  1WMV A;  1FKG A;  1GUV A;  5HW6 A;  2G8Z A;  2DSU A;  1RD6 A;  3B9A A;  3RME A;  1L1P A;  4MTV A;  4FN2 A;  5DIU A;  4XAK A;  3NTP A;  2LKN A;  2F21 A;  1K9R A;  2RUD A;  5J6E A;  4L3N A;  5HWC A;  2DG4 A;  2DWV A;  3KAG A;  4FAP A;  1E9L A;  2O9O A;  2RUC A;  2WAD A;  3KAD A;  1Q6H A;  5E65 A;  4L72 B;  2AOS A;  3LKX B;  2JXW A;  2MLY A;  1SYT A;  5HW7 A;  2ESC A;  1WB0 A;  1OWQ A;  2ZR4 A;  3AS2 A;  3TC5 A;  1JND A;  3O5O A;  4G50 A;  3FS8 A;  1B6C A;  2F4E A;  3WD4 A;  4IQC A;  4W9Q A;  1J4H A;  1Q6I A;  4QT3 A;  3AQU A;  2A3B A;  1CTN A;  1WR7 A;  3IHZ A;  2DSV A;  3WD0 A;  1U79 A;  1ZBV A;  1FKT A;  5HTG A;  2ZR5 A;  4N19 A;  1UR8 A;  1FKH A;  3AS0 A;  3RFW A;  2ZR6 A;  2QRV A;  2DK1 A;  1NSG A;  1KT1 A;  1W9U A;  4WKF A;  3CH9 A;  2LAJ A;  2EZ5 W;  2XP7 A;  2RUR A;  4DZ3 A;  1ITX A;  2UZ5 A;  2JMF A;  4URI A;  1E6Z A;  1PBK A;  3IKG A;  2MLZ A;  2JV4 A;  4Q7N A;  3CNG A;  5HBF A;  1TK7 A;  2KFW A;  3AS1 A;  3WKZ A;  2IF4 A;  4NZC A;  3TCZ A;  1YAT A;  2XP9 A;  1W26 A;  3FSB A;  2Q5A A;  4DWS A;  4MAV A;  2WLZ A;  4TW6 A;  3UF8 A;  1F8A B;  1EYM A;  1EG3 A;  1NH6 A;  2LGO A;  4WKH A;  1KT0 A;  1NMV A;  3O5L A;  2QF8 A;  4DZ2 A;  5D75 A;  1NWT A;  4PTM A;  3PR9 A;  2MDI A;  4WK9 A;  3PRA A;  3JXV A;  1X6N A;  4ODQ A;  4JYS A;  3O5M A;  3G6L A;  2ZQT A;  3WH0 A;  4WIW A;  3O5P A;  2XP6 A;  2PV3 A;  1LG1 A;  3WL0 A;  5AHT A;  1EIB A;  1LL6 A;  3FAP A;  2XP8 A;  4DRH A;  1QZ2 A;  1NMW A;  3BXW A;  4DRO A;  2L4J A;  2YBT A;  3RM8 A;  4LAY A;  4DRQ A;  1P5Q A;  4A0U A;  1R9H A;  4DT4 A;  2DJY A;  1QPL A;  3PRD A;  3KAF A;  4J4N A;  4QT2 A;  1JNT A;  2OFN A;  1GOI A;  5U47 A;  1UR9 A;  1XHG A;  2WK2 A;  1LG2 A;  2XPB A;  1SR0 A;  4DRK A;  4Z2J A;  3MDY B;  1FAP A;  1ZU8 A;  2A3C A;  1WNO A;  3WIJ A;  1NWU A;  2DT1 A;  1IX5 A;  3PQH A;  3WD2 A;  3ARU A;  4JFL A;  1FJD A;  4ZS6 A;  4O2T A;  2ZQV A;  1O6I A;  1D6O A;  2FDM A;  2VN1 A;  4QIB A;  1HKM A;  3UI6 A;  2KE0 A;  1W9V A;  4DWS B;  4HAR A;  5I98 A;  3ARW A;  1VF8 A;  4DWS C;  1WAW A;  1BL4 A;  4S3K A;  2LPV A;  4ODN A;  5CQ2 A;  3ARS A;  4HBE A;  4S3J A;  2ZQS A;  4DRP A;  1JVW A;  2XP3 A;  2DK7 A;  3W4R A;  3O5D A;  2RQS A;  1LQ0 A;  1Y0O A;  3ARX A;  5GPG A;  4WKA A;  5B8I C;  2IUZ A;  1K9T A;  4IT4 A;  1ZBW A;  4IT6 A;  4ODK A;  2FKE A;  3LUO A;  1EG4 A;  3ODK A;  3CHD A;  1N1A A;  4ODP A;  3UQB A;  3JYJ A;  3O5G A;  1QPF A;  4U86 A;  3VAW A;  1K9Q A;  4BF8 A;  3O5K A;  3FSC A;  2MF9 A;  1Q1C A;  3B9D A;  4JFK A;  3I6C A;  2PI6 A;  5HW8 A;  4A0T A;  2DSW A;  1C9H A;  1GPF A;  4DRJ A;  1HJX A;  1TFV A;  1A7X A;  2DT2 A;  2MPH A;  2E45 A;  4E5R A;  2PPO A;  1NWR A;  3OOB A;  4GGQ A;  1H0I A;  3KAH A;  1EDQ A;  1I5H W;  1T11 A;  2FAP A;  3ART A;  3B9E A;  3UQI A;  1W1T A;  3GPK A;  4JFJ A;  1D7I A;  4DRM A;  3ARV A;  4KR0 B;  3ARY A;  1J6Y A;  1KFW A;  4U85 A;  1PIN A;  4DIP A;  3O5Q A;  3CHE A;  3RM4 A;  3WQV A;  3B7X A;  4QZV B;  1HKJ A;  2M3O W;  3CGM A;  2XPA A;  2YSF A;  1H0G A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...