3ODKA

Discovery of cell-active phenyl-imidazole pin1 inhibitors by structure-guided fragment evolution
Total Genus 42
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
42
sequence length
157
structure length
145
Chain Sequence
b'LPPGWEKAMSRSSGRVYYFNHITNASQWERPSEPARVRCSHLLVKHSQSRRPSSWRQEKITRTKEEALELINGYIQKIKSGEEDFESLASQFSDCSSAKARGDLGAFSRGQMQKPFEDASFALRTGEMSGPVFTDSGIHIILRTE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Peptidyl-prolyl cis-trans isomerase NIMA-interacting 1
publication title Discovery of cell-active phenyl-imidazole Pin1 inhibitors by structure-guided fragment evolution.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Isomerase
total genus 42
structure length 145
sequence length 157
ec nomenclature ec 5.2.1.8: Peptidylprolyl isomerase.
pdb deposition date 2010-08-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00397 WW WW domain
A PF00639 Rotamase PPIC-type PPIASE domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.20.70.10 Mainly Beta Single Sheet Ubiquitin Ligase Nedd4; Chain: W; Ubiquitin Ligase Nedd4; Chain: W; 3odkA01
3.10.50.40 Alpha Beta Roll Chitinase A; domain 3 Chitinase A; domain 3 3odkA02
2Y78A 2F2DA 4TYOA 2DG3A 1K9RA 1WMVA 3EY6A 4BF8A 2VN1A 1K9QA 3OOBA 1JNTA 5HW8A 5HT1A 4LAVA 3H9RB 3O5DA 3KABA 4JFMA 2PPOA 1Q6UA 4DROA 2L4JA 4QT3A 4DRIA 4DRMA 3TCZA 1JNSA 3KAGA 1O6WA 2M2AA 1D6OA 1L1PA 2LAJA 3GPKA 4QT2A 1J4IA 2F4EA 3UI6A 3JXVA 1TCOC 3LE4A 5B8IC 1EG4A 2RUCA 5HTGA 3O5FA 2DK7A 5HWBA 4TW6A 4U85A 3PRDA 2MLXA 4DRQA 1QPFA 2M1IA 1D7IA 2ZQTA 1KT0A 4DIPA 4DRJA 4DZ2A 4FAPA 2XP5A 3PA7A 2FKEA 5CQ2A 1EG3A 2E45A 1M5YA 2Q5AA 2PV2A 4JYSA 4C02B 2PPNA 4DRNA 2DG4A 4DRKA 1D7HA 2RURA 2YSFA 3KAHA 3O5RA 5HWCA 1FAPA 2LJ4A 3RFWA 2XP9A 4U84A 2ZAJA 4REXA 1ROUA 2OFNA 5DITA 1C9HA 5AHTA 1YW5A 2XPAA 1BKFA 3RGCA 1FKKA 2LPVA 4IQCA 2M08A 4ODNA 1FKLA 2YSHA 1NMWA 3JYJA 2KGJA 2RQSA 3KACA 2DG9A 2XPBA 3UI5A 2YSBA 3KAIA 3KAFA 5GPGA 3B7XA 2KI3A 3MDYB 1FKSA 3L4HA 1I5HW 3IHZA 4TX0A 3O5PA 2RUQA 1ZCNA 1J6YA 4ODRA 3O5GA 2XP8A 2FAPA 2ZR4A 3NI6A 1ZK6A 1HXVA 2JV4A 2MNTA 2YSGA 1ROTA 5DIVA 1F40A 4W9QA 1FJDA 4JFLA 3O5QA 1F8AB 3PRBA 2XP4A 4IQ2A 3IK8A 4MSPA 2ZQVA 2D9FA 2N87A 3KADA 3CGMA 3O5KA 3O5JA 4ITZA 1D7JA 4GGQA 3M7NA 1EQ3A 3UQBA 4ODQA 1NSGA 5J6EA 3JYMA 1N1AA 1JVWA 4NNRA 2XP6A 3O5MA 1BL4A 1QZ2A 1FKDA 1Q6HA 1FKJA 4QIBA 1KT1A 4G50A 2MDIA 5HKGA 1U79A 3NRKA 4J4NA 3UQIA 2KO7A 3M85A 2K8IA 2JMFA 1TK7A 4N19A 4DRPA 2F21A 2RE3A 1FKGA 4GIVA 1R9HA 5HUAA 2L2SA 4LAYA 1T11A 1FKIA 2DMVA 3KCEA 2XP3A 2M8JA 3UQAA 2MLYA 2ZR6A 3O5OA 2EZ5W 2RUDA 2PPPA 2KE0A 4W9OA 4LAXA 2AWGA 4J4OA 4JFJA 2M8IA 2M3OW 1WR7A 2ZQUA 2UZ5A 1NMVA 2JX8A 2JZVA 5BXJA 1PINA 2MF9A 1P5QA 4DZ3A 1A7XA 4JFKA 1Q1CA 4TW7A 2ZR5A 1YATA 2YSIA 1J4HA 4G2PA 3I6CA 3KZ7A 1W26A 3O5EA 1FKBA 1EYMA 2ZQSA 4O2TA 2KFWA 4ODLA 5DIUA 1JMQA 3CNGA 3NTPA 2JXWA 3IKDA 4ODOA 3TDBA 2PV3A 2LKNA 2MPHA 5HW6A 4ODMA 3LUOA 1FKHA 1FKTA 2ITKA 1FD9A 3UI4A 2PV1A 4DH0A 3VAWA 3O5IA 3ODKA 1J4RA 3FAPA 4ODPA 4TNSA 1B6CA 2XP7A 2MLZA 2IF4A 2KR7A 3IKGA 4IPXA 4JFIA 2BA1A 3O5LA 5D75A 2LGOA 2PBCA 3WH0A 4MGVA 1FKRA 2DWVA 2KXQA 3CGNA 4U86A 4DRHA 2VCDA 4E5RA 2DK1A 4W9PA 4FN2A 1Y0OA 5I98A 4LAWA 1QPLA 3TC5A 1PBKA 4DT4A 2RSEA 4TW8A 4R0XA 1FKFA 2DJYA 3UF8A 4ODKA 5HW7A 1Q6IA
chains in the Genus database with same CATH superfamily
2Y78A 2AOSA 2F2DA 4PTMA 3PR9A 1EIBA 4TYOA 2DG3A 1K9RA 1WMVA 3EY6A 4BF8A 2VN1A 1K9QA 2DT0A 3OOBA 1JNTA 4AY1A 5HW8A 5HT1A 3RM4A 4LAVA 3H9RB 1E44A 3O5DA 3KABA 1LJYA 4JFMA 2PPOA 3ARPA 1Q6UA 4DROA 2L4JA 4QT3A 2P4VA 4DRIA 4DRMA 2ESCA 3MCBA 4WKHA 3TCZA 3ARWA 1JNDA 3ARYA 1JNSA 3KAGA 1O6WA 1XHGA 2M2AA 1D6OA 3MCBB 1L1PA 2OLHA 2DSVA 2LAJA 1IX5A 3GPKA 4QT2A 1J4IA 2F4EA 3UI6A 3JXVA 1FFQA 1OGGA 1TCOC 3LE4A 2WK2A 1W1TA 5B8IC 1H0IA 2OWOA 5GQBA 3AS1A 1EG4A 1ZU8A 2RUCA 5HTGA 3O5FA 4LGXA 2DK7A 2DPEA 4TW6A 5HWBA 4U85A 2WLZA 3WD4A 3PRDA 3OA5A 4Z2HA 1ZBVA 1H0GA 2MLXA 4KQZA 4P8UA 4R5EA 4S3JA 4DRQA 1QPFA 1HJXA 1HKKA 2M1IA 5E62A 3WIJA 1D7IA 2PI6A 2EULA 4NZCA 4HBEA 2ZQTA 1FLCA 1KT0A 3ARRA 1UR9A 4UDMA 4DIPA 4DRJA 1GOIA 4ZPTR 4DZ2A 4S3KA 3ARUA 1HJVA 4FAPA 4DWSD 2XP5A 3PA7A 2FKEA 5CQ2A 3AS2A 1EG3A 3CHCA 3FS8A 2E45A 1M5YA 1EDQA 5E65A 2Q5AA 2PV2A 4JYSA 4C02B 1W9UA 2PPNA 4DRNA 2DG4A 4DRKA 1D7HA 1HJWA 3FSCA 2RURA 3B9DA 4MNJA 2YSFA 3KAHA 3O5RA 5HWCA 1LG1A 1FAPA 2LJ4A 3RFWA 1LL6A 2DT1A 3WKZA 2XP9A 4U84A 2ZAJA 4WKFA 4REXA 1W1VA 1ROUA 2OFNA 5DITA 1C9HA 5AHTA 4WIWA 1YW5A 2O9OA 2XPAA 1BKFA 1HKIA 2DT2A 3RGCA 4A0TA 3AQUA 2QF8A 5JH8A 4MNLA 1FKKA 2LPVA 4IQCA 1TFVA 2M08A 4ODNA 1FKLA 2YSHA 1NMWA 4P8XA 3JYJA 1GUVA 2KGJA 4Z2IA 2RQSA 3KACA 2DG9A 2XPBA 3UI5A 1JNEA 3MQHA 2YSBA 1NWSA 3KAIA 3KAFA 1E15A 5GPGA 1EHNA 4Z2LA 2A3CA 2PN0A 3B7XA 2KI3A 3MDYB 1FKSA 5U47A 3WD0A 3L4HA 1I5HW 3IHZA 4TX0A 4ZS6A 4GLXA 3O5PA 4Q22A 2RUQA 4L3NA 1ZCNA 1J6YA 4ODRA 2QRVA 2XP8A 3O5GA 2FAPA 1SYTA 3ALGA 2ZR4A 3AS3A 3B8SA 3NI6A 1ZK6A 5E5WA 3RM9A 1X6LA 3ARSA 1OGBA 1WNOA 1HXVA 2IUZA 2JV4A 2MNTA 2A3EA 2WAEA 1OWQA 2YSGA 3CHDA 1ROTA 5DIVA 1F40A 4W9QA 1RP5A 1FJDA 4JFLA 3O5QA 4IT4A 1F8AB 3PRBA 4HARA 1NWUA 2XP4A 3LKXA 2DSZA 5DO2A 3G6MA 4IQ2A 2YBTA 3LKXB 3IK8A 4MSPA 3PQHA 3AS0A 2ZQVA 3CZ8A 2D9FA 1WB0A 4MAVA 3CHFA 2N87A 3KADA 1UR8A 3CGMA 3O5KA 3O5JA 4QZVB 3WD2A 1LG2A 1ZL1A 4ITZA 1SR0A 4MNKA 3MQGA 1D7JA 4GGQA 3M7NA 1EQ3A 3FSBA 2YAJB 1GPFA 3UQBA 2B31A 4ODQA 1NSGA 4NSBA 3WD3A 5J6EA 2A3BA 1N1AA 3JYMA 3AROA 1JVWA 4P8WA 4NNRA 2XP6A 1W9PA 1FFRA 3O5MA 4HBOA 4URIA 3WD1A 1BL4A 3GTYX 1KFWA 1QZ2A 4WJXA 1FKDA 1HKMA 1NWTA 1Q6HA 1FKJA 4QIBA 1KT1A 2O92A 4G50A 4IT6A 2MDIA 5HKGA 1LL4A 1U79A 1K9TA 1ZBCA 3NRKA 4J4NA 5DF0A 1HKJA 4W5UA 3UQIA 5E66A 4XAKA 3ARXA 2KO7A 3M85A 3ARTA 1X6NA 1E6ZA 2K8IA 2JMFA 3RMEA 1TK7A 4ML4A 4N19A 4DRPA 1CTNA 2F21A 2RE3A 1FKGA 4GIVA 1R9HA 5HUAA 2L2SA 4LAYA 2DSUA 1T11A 1FKIA 1XRVA 5HBFA 2DMVA 3KCEA 2XP3A 2M8JA 1E6NA 3UQAA 2MLYA 2ZR6A 3O5OA 2EZ5W 3EIPA 2RUDA 3WQVA 5E64A 2PPPA 4WKAA 2WLYA 4DWSB 2KE0A 4A0UA 2WM0A 1NWRA 4W9OA 4LAXA 2Y8NB 2AWGA 4J4OA 4JFJA 2M8IA 2M3OW 1WR7A 2ZQUA 2UZ5A 1NMVA 3ALFA 2JX8A 2JZVA 1TR8A 5BXJA 1PINA 3W4RA 2MF9A 1P5QA 3BMBA 3QOKA 3G6LA 4DZ3A 1ZBWA 1A7XA 2G41A 2WADA 4JFKA 1Q1CA 4TW7A 2ZR5A 1ITXA 1YATA 2ETNA 2YSIA 1J4HA 1E6RA 4G2PA 3I6CA 3KZ7A 4MPKA 1W26A 4L72B 3O5EA 1FKBA 4ZPVR 5GPRA 1ZB5A 4Z2GA 1EYMA 4MNMA 2ZQSA 2DSWA 1O6IA 4O2TA 2KFWA 4ODLA 5DIUA 2G8ZA 1LL7A 3CNGA 1JMQA 3NTPA 2JXWA 2B5UB 3IKDA 4ODOA 3TDBA 1D2KA 1GRJA 2PV3A 2LKNA 2MPHA 5HW6A 1W9VA 4ODMA 3LUOA 4KR0B 4ZPWR 2DT3A 4Q7NA 1FKHA 1FKTA 1E9LA 2ITKA 4Z2KA 3CH9A 1FD9A 3RM8A 3UI4A 3BXWA 2PV1A 4DH0A 3VAWA 2FDMA 3O5IA 3ODKA 1J4RA 3FAPA 3ARQA 1W1PA 1ZBKA 4DWSC 2A3AA 3ARVA 4ODPA 4TNSA 1B6CA 2XP7A 2MLZA 2IF4A 2KR7A 3FY1A 3IKGA 4IPXA 4JFIA 2BA1A 3B9EA 3O5LA 4MTVA 5D75A 2LGOA 2PBCA 1E6PA 3WL0A 3CHEA 3WH0A 1RD6A 3GU0A 4MGVA 3PRAA 2DWVA 1FKRA 2KXQA 4WK9A 1VF8A 3CGNA 1LQ0A 4U86A 4DRHA 1NH6A 2VCDA 4E5RA 2DK1A 4W9PA 1W1YA 4FN2A 1Y0OA 4P8VA 5I98A 4LAWA 1QPLA 3ARZA 3TC5A 5DEZA 4Z2JA 1PBKA 2YBUA 2RSEA 4DT4A 2F23A 3B9AA 4TW8A 1JCHB 4R0XA 1FKFA 2DJYA 3UF8A 4DWSA 1WAWA 4ODKA 5HW7A 1Q6IA 3FXYA 3WQWA 3WL1A
chains in the Genus database with same CATH topology
2Y78A 2AOSA 2F2DA 4PTMA 3PR9A 1EIBA 4TYOA 2DG3A 1K9RA 1WMVA 3EY6A 4BF8A 2VN1A 1K9QA 2DT0A 3OOBA 1JNTA 4AY1A 5HW8A 5HT1A 3RM4A 4LAVA 3H9RB 3O5DA 3KABA 1LJYA 4JFMA 2PPOA 3ARPA 1Q6UA 4DROA 2L4JA 4QT3A 4DRIA 4DRMA 2ESCA 3MCBA 4WKHA 3TCZA 3ARWA 1JNDA 3ARYA 1JNSA 3KAGA 1O6WA 1XHGA 2M2AA 1D6OA 3MCBB 1L1PA 2OLHA 2DSVA 2LAJA 1IX5A 3GPKA 4QT2A 1J4IA 2F4EA 3UI6A 3JXVA 1FFQA 1OGGA 1TCOC 3LE4A 2WK2A 1W1TA 5B8IC 1H0IA 2OWOA 5GQBA 3AS1A 1EG4A 1ZU8A 2RUCA 5HTGA 3O5FA 4LGXA 2DK7A 2DPEA 4TW6A 5HWBA 4U85A 2WLZA 3WD4A 3PRDA 3OA5A 4Z2HA 1ZBVA 1H0GA 2MLXA 4KQZA 4P8UA 4R5EA 4S3JA 4DRQA 1QPFA 1HJXA 1HKKA 2M1IA 5E62A 3WIJA 1D7IA 2PI6A 4NZCA 4HBEA 2ZQTA 1FLCA 1KT0A 3ARRA 1UR9A 4DIPA 4DRJA 1GOIA 4ZPTR 4DZ2A 4S3KA 3ARUA 1HJVA 4FAPA 4DWSD 2XP5A 3PA7A 2FKEA 5CQ2A 3AS2A 1EG3A 3CHCA 3FS8A 2E45A 1M5YA 1EDQA 5E65A 2Q5AA 2PV2A 4JYSA 4C02B 1W9UA 2PPNA 4DRNA 2DG4A 4DRKA 1D7HA 1HJWA 3FSCA 2RURA 3B9DA 4MNJA 2YSFA 3KAHA 3O5RA 5HWCA 1LG1A 1FAPA 2LJ4A 3RFWA 1LL6A 2DT1A 3WKZA 2XP9A 4U84A 2ZAJA 4WKFA 4REXA 1W1VA 1ROUA 2OFNA 5DITA 1C9HA 5AHTA 4WIWA 1YW5A 2O9OA 2XPAA 1BKFA 1HKIA 2DT2A 3RGCA 4A0TA 3AQUA 2QF8A 5JH8A 4MNLA 1FKKA 2LPVA 4IQCA 1TFVA 2M08A 4ODNA 1FKLA 2YSHA 1NMWA 4P8XA 3JYJA 1GUVA 2KGJA 4Z2IA 2RQSA 3KACA 2DG9A 2XPBA 3UI5A 1JNEA 3MQHA 2YSBA 1NWSA 3KAIA 3KAFA 1E15A 5GPGA 1EHNA 4Z2LA 2A3CA 3B7XA 2KI3A 3MDYB 1FKSA 5U47A 3WD0A 3L4HA 1I5HW 3IHZA 4TX0A 4ZS6A 4GLXA 3O5PA 4Q22A 2RUQA 4L3NA 1ZCNA 1J6YA 4ODRA 2QRVA 2XP8A 3O5GA 2FAPA 1SYTA 3ALGA 2ZR4A 3AS3A 3B8SA 3NI6A 1ZK6A 5E5WA 3RM9A 1X6LA 3ARSA 1OGBA 1WNOA 1HXVA 2IUZA 2JV4A 2MNTA 2A3EA 2WAEA 1OWQA 2YSGA 3CHDA 1ROTA 5DIVA 1F40A 4W9QA 1RP5A 1FJDA 4JFLA 3O5QA 4IT4A 1F8AB 3PRBA 4HARA 1NWUA 2XP4A 3LKXA 2DSZA 5DO2A 3G6MA 4IQ2A 2YBTA 3LKXB 3IK8A 4MSPA 3PQHA 3AS0A 2ZQVA 3CZ8A 2D9FA 1WB0A 4MAVA 3CHFA 2N87A 3KADA 1UR8A 3CGMA 3O5KA 3O5JA 4QZVB 3WD2A 1LG2A 1ZL1A 4ITZA 1SR0A 4MNKA 3MQGA 1D7JA 4GGQA 3M7NA 1EQ3A 3FSBA 2YAJB 1GPFA 3UQBA 2B31A 4ODQA 1NSGA 4NSBA 3WD3A 5J6EA 2A3BA 1N1AA 3JYMA 3AROA 1JVWA 4P8WA 4NNRA 2XP6A 1W9PA 1FFRA 3O5MA 4HBOA 4URIA 3WD1A 1BL4A 1KFWA 1QZ2A 4WJXA 1FKDA 1HKMA 1NWTA 1Q6HA 1FKJA 4QIBA 1KT1A 2O92A 4G50A 4IT6A 2MDIA 5HKGA 1LL4A 1U79A 1K9TA 1ZBCA 3NRKA 4J4NA 5DF0A 1HKJA 4W5UA 3UQIA 5E66A 4XAKA 3ARXA 2KO7A 3M85A 3ARTA 1X6NA 1E6ZA 2K8IA 2JMFA 3RMEA 1TK7A 4ML4A 4N19A 4DRPA 1CTNA 2F21A 2RE3A 1FKGA 4GIVA 1R9HA 5HUAA 2L2SA 4LAYA 2DSUA 1T11A 1FKIA 1XRVA 5HBFA 2DMVA 3KCEA 2XP3A 2M8JA 1E6NA 3UQAA 2MLYA 2ZR6A 3O5OA 2EZ5W 2RUDA 3WQVA 5E64A 2PPPA 4WKAA 2WLYA 4DWSB 2KE0A 4A0UA 2WM0A 1NWRA 4W9OA 4LAXA 2Y8NB 2AWGA 4J4OA 4JFJA 2M8IA 2M3OW 1WR7A 2ZQUA 2UZ5A 1NMVA 3ALFA 2JX8A 2JZVA 1TR8A 5BXJA 1PINA 3W4RA 2MF9A 1P5QA 3QOKA 3G6LA 4DZ3A 1ZBWA 1A7XA 2G41A 2WADA 4JFKA 1Q1CA 4TW7A 2ZR5A 1ITXA 1YATA 2YSIA 1J4HA 1E6RA 4G2PA 3I6CA 3KZ7A 4MPKA 1W26A 4L72B 3O5EA 1FKBA 4ZPVR 5GPRA 1ZB5A 4Z2GA 1EYMA 4MNMA 2ZQSA 2DSWA 1O6IA 4O2TA 2KFWA 4ODLA 5DIUA 2G8ZA 1LL7A 3CNGA 1JMQA 3NTPA 2JXWA 3IKDA 4ODOA 3TDBA 1D2KA 2PV3A 2LKNA 2MPHA 5HW6A 1W9VA 4ODMA 3LUOA 4KR0B 4ZPWR 2DT3A 4Q7NA 1FKHA 1FKTA 1E9LA 2ITKA 4Z2KA 3CH9A 1FD9A 3RM8A 3UI4A 3BXWA 2PV1A 4DH0A 3VAWA 2FDMA 3O5IA 3ODKA 1J4RA 3FAPA 3ARQA 1W1PA 1ZBKA 4DWSC 2A3AA 3ARVA 4ODPA 4TNSA 1B6CA 2XP7A 2MLZA 2IF4A 2KR7A 3FY1A 3IKGA 4IPXA 4JFIA 2BA1A 3B9EA 3O5LA 4MTVA 5D75A 2LGOA 2PBCA 1E6PA 3WL0A 3CHEA 3WH0A 1RD6A 4MGVA 3PRAA 2DWVA 1FKRA 2KXQA 4WK9A 1VF8A 3CGNA 1LQ0A 4U86A 4DRHA 1NH6A 2VCDA 4E5RA 2DK1A 4W9PA 1W1YA 4FN2A 1Y0OA 4P8VA 5I98A 4LAWA 1QPLA 3ARZA 3TC5A 5DEZA 4Z2JA 1PBKA 2YBUA 2RSEA 4DT4A 3B9AA 4TW8A 4R0XA 1FKFA 2DJYA 3UF8A 4DWSA 1WAWA 4ODKA 5HW7A 1Q6IA 3FXYA 3WQWA 3WL1A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2Y78 A;  2F2D A;  4TYO A;  2DG3 A;  1K9R A;  1WMV A;  3EY6 A;  4BF8 A;  2VN1 A;  1K9Q A;  3OOB A;  1JNT A;  5HW8 A;  5HT1 A;  4LAV A;  3H9R B;  3O5D A;  3KAB A;  4JFM A;  2PPO A;  1Q6U A;  4DRO A;  2L4J A;  4QT3 A;  4DRI A;  4DRM A;  3TCZ A;  1JNS A;  3KAG A;  1O6W A;  2M2A A;  1D6O A;  1L1P A;  2LAJ A;  3GPK A;  4QT2 A;  1J4I A;  2F4E A;  3UI6 A;  3JXV A;  1TCO C;  3LE4 A;  5B8I C;  1EG4 A;  2RUC A;  5HTG A;  3O5F A;  2DK7 A;  5HWB A;  4TW6 A;  4U85 A;  3PRD A;  2MLX A;  4DRQ A;  1QPF A;  2M1I A;  1D7I A;  2ZQT A;  1KT0 A;  4DIP A;  4DRJ A;  4DZ2 A;  4FAP A;  2XP5 A;  3PA7 A;  2FKE A;  5CQ2 A;  1EG3 A;  2E45 A;  1M5Y A;  2Q5A A;  2PV2 A;  4JYS A;  4C02 B;  2PPN A;  4DRN A;  2DG4 A;  4DRK A;  1D7H A;  2RUR A;  2YSF A;  3KAH A;  3O5R A;  5HWC A;  1FAP A;  2LJ4 A;  3RFW A;  2XP9 A;  4U84 A;  2ZAJ A;  4REX A;  1ROU A;  2OFN A;  5DIT A;  1C9H A;  5AHT A;  1YW5 A;  2XPA A;  1BKF A;  3RGC A;  1FKK A;  2LPV A;  4IQC A;  2M08 A;  4ODN A;  1FKL A;  2YSH A;  1NMW A;  3JYJ A;  2KGJ A;  2RQS A;  3KAC A;  2DG9 A;  2XPB A;  3UI5 A;  2YSB A;  3KAI A;  3KAF A;  5GPG A;  3B7X A;  2KI3 A;  3MDY B;  1FKS A;  3L4H A;  1I5H W;  3IHZ A;  4TX0 A;  3O5P A;  2RUQ A;  1ZCN A;  1J6Y A;  4ODR A;  3O5G A;  2XP8 A;  2FAP A;  2ZR4 A;  3NI6 A;  1ZK6 A;  1HXV A;  2JV4 A;  2MNT A;  2YSG A;  1ROT A;  5DIV A;  1F40 A;  4W9Q A;  1FJD A;  4JFL A;  3O5Q A;  1F8A B;  3PRB A;  2XP4 A;  4IQ2 A;  3IK8 A;  4MSP A;  2ZQV A;  2D9F A;  2N87 A;  3KAD A;  3CGM A;  3O5K A;  3O5J A;  4ITZ A;  1D7J A;  4GGQ A;  3M7N A;  1EQ3 A;  3UQB A;  4ODQ A;  1NSG A;  5J6E A;  3JYM A;  1N1A A;  1JVW A;  4NNR A;  2XP6 A;  3O5M A;  1BL4 A;  1QZ2 A;  1FKD A;  1Q6H A;  1FKJ A;  4QIB A;  1KT1 A;  4G50 A;  2MDI A;  5HKG A;  1U79 A;  3NRK A;  4J4N A;  3UQI A;  2KO7 A;  3M85 A;  2K8I A;  2JMF A;  1TK7 A;  4N19 A;  4DRP A;  2F21 A;  2RE3 A;  1FKG A;  4GIV A;  1R9H A;  5HUA A;  2L2S A;  4LAY A;  1T11 A;  1FKI A;  2DMV A;  3KCE A;  2XP3 A;  2M8J A;  3UQA A;  2MLY A;  2ZR6 A;  3O5O A;  2EZ5 W;  2RUD A;  2PPP A;  2KE0 A;  4W9O A;  4LAX A;  2AWG A;  4J4O A;  4JFJ A;  2M8I A;  2M3O W;  1WR7 A;  2ZQU A;  2UZ5 A;  1NMV A;  2JX8 A;  2JZV A;  5BXJ A;  1PIN A;  2MF9 A;  1P5Q A;  4DZ3 A;  1A7X A;  4JFK A;  1Q1C A;  4TW7 A;  2ZR5 A;  1YAT A;  2YSI A;  1J4H A;  4G2P A;  3I6C A;  3KZ7 A;  1W26 A;  3O5E A;  1FKB A;  1EYM A;  2ZQS A;  4O2T A;  2KFW A;  4ODL A;  5DIU A;  1JMQ A;  3CNG A;  3NTP A;  2JXW A;  3IKD A;  4ODO A;  3TDB A;  2PV3 A;  2LKN A;  2MPH A;  5HW6 A;  4ODM A;  3LUO A;  1FKH A;  1FKT A;  2ITK A;  1FD9 A;  3UI4 A;  2PV1 A;  4DH0 A;  3VAW A;  3O5I A;  3ODK A;  1J4R A;  3FAP A;  4ODP A;  4TNS A;  1B6C A;  2XP7 A;  2MLZ A;  2IF4 A;  2KR7 A;  3IKG A;  4IPX A;  4JFI A;  2BA1 A;  3O5L A;  5D75 A;  2LGO A;  2PBC A;  3WH0 A;  4MGV A;  1FKR A;  2DWV A;  2KXQ A;  3CGN A;  4U86 A;  4DRH A;  2VCD A;  4E5R A;  2DK1 A;  4W9P A;  4FN2 A;  1Y0O A;  5I98 A;  4LAW A;  1QPL A;  3TC5 A;  1PBK A;  4DT4 A;  2RSE A;  4TW8 A;  4R0X A;  1FKF A;  2DJY A;  3UF8 A;  4ODK A;  5HW7 A;  1Q6I A; 
#chains in the Genus database with same CATH topology
 2Y78 A;  2AOS A;  2F2D A;  4PTM A;  3PR9 A;  1EIB A;  4TYO A;  2DG3 A;  1K9R A;  1WMV A;  3EY6 A;  4BF8 A;  2VN1 A;  1K9Q A;  2DT0 A;  3OOB A;  1JNT A;  4AY1 A;  5HW8 A;  5HT1 A;  3RM4 A;  4LAV A;  3H9R B;  1E44 A;  3O5D A;  3KAB A;  1LJY A;  4JFM A;  2PPO A;  3ARP A;  1Q6U A;  4DRO A;  2L4J A;  4QT3 A;  2P4V A;  4DRI A;  4DRM A;  2ESC A;  3MCB A;  4WKH A;  3TCZ A;  3ARW A;  1JND A;  3ARY A;  1JNS A;  3KAG A;  1O6W A;  1XHG A;  2M2A A;  1D6O A;  3MCB B;  1L1P A;  2OLH A;  2DSV A;  2LAJ A;  1IX5 A;  3GPK A;  4QT2 A;  1J4I A;  2F4E A;  3UI6 A;  3JXV A;  1FFQ A;  1OGG A;  1TCO C;  3LE4 A;  2WK2 A;  1W1T A;  5B8I C;  1H0I A;  2OWO A;  5GQB A;  3AS1 A;  1EG4 A;  1ZU8 A;  2RUC A;  5HTG A;  3O5F A;  4LGX A;  2DK7 A;  2DPE A;  4TW6 A;  5HWB A;  4U85 A;  2WLZ A;  3WD4 A;  3PRD A;  3OA5 A;  4Z2H A;  1ZBV A;  1H0G A;  2MLX A;  4KQZ A;  4P8U A;  4R5E A;  4S3J A;  4DRQ A;  1QPF A;  1HJX A;  1HKK A;  2M1I A;  5E62 A;  3WIJ A;  1D7I A;  2PI6 A;  2EUL A;  4NZC A;  4HBE A;  2ZQT A;  1FLC A;  1KT0 A;  3ARR A;  1UR9 A;  4UDM A;  4DIP A;  4DRJ A;  1GOI A;  4ZPT R;  4DZ2 A;  4S3K A;  3ARU A;  1HJV A;  4FAP A;  4DWS D;  2XP5 A;  3PA7 A;  2FKE A;  5CQ2 A;  3AS2 A;  1EG3 A;  3CHC A;  3FS8 A;  2E45 A;  1M5Y A;  1EDQ A;  5E65 A;  2Q5A A;  2PV2 A;  4JYS A;  4C02 B;  1W9U A;  2PPN A;  4DRN A;  2DG4 A;  4DRK A;  1D7H A;  1HJW A;  3FSC A;  2RUR A;  3B9D A;  4MNJ A;  2YSF A;  3KAH A;  3O5R A;  5HWC A;  1LG1 A;  1FAP A;  2LJ4 A;  3RFW A;  1LL6 A;  2DT1 A;  3WKZ A;  2XP9 A;  4U84 A;  2ZAJ A;  4WKF A;  4REX A;  1W1V A;  1ROU A;  2OFN A;  5DIT A;  1C9H A;  5AHT A;  4WIW A;  1YW5 A;  2O9O A;  2XPA A;  1BKF A;  1HKI A;  2DT2 A;  3RGC A;  4A0T A;  3AQU A;  2QF8 A;  5JH8 A;  4MNL A;  1FKK A;  2LPV A;  4IQC A;  1TFV A;  2M08 A;  4ODN A;  1FKL A;  2YSH A;  1NMW A;  4P8X A;  3JYJ A;  1GUV A;  2KGJ A;  4Z2I A;  2RQS A;  3KAC A;  2DG9 A;  2XPB A;  3UI5 A;  1JNE A;  3MQH A;  2YSB A;  1NWS A;  3KAI A;  3KAF A;  1E15 A;  5GPG A;  1EHN A;  4Z2L A;  2A3C A;  2PN0 A;  3B7X A;  2KI3 A;  3MDY B;  1FKS A;  5U47 A;  3WD0 A;  3L4H A;  1I5H W;  3IHZ A;  4TX0 A;  4ZS6 A;  4GLX A;  3O5P A;  4Q22 A;  2RUQ A;  4L3N A;  1ZCN A;  1J6Y A;  4ODR A;  2QRV A;  2XP8 A;  3O5G A;  2FAP A;  1SYT A;  3ALG A;  2ZR4 A;  3AS3 A;  3B8S A;  3NI6 A;  1ZK6 A;  5E5W A;  3RM9 A;  1X6L A;  3ARS A;  1OGB A;  1WNO A;  1HXV A;  2IUZ A;  2JV4 A;  2MNT A;  2A3E A;  2WAE A;  1OWQ A;  2YSG A;  3CHD A;  1ROT A;  5DIV A;  1F40 A;  4W9Q A;  1RP5 A;  1FJD A;  4JFL A;  3O5Q A;  4IT4 A;  1F8A B;  3PRB A;  4HAR A;  1NWU A;  2XP4 A;  3LKX A;  2DSZ A;  5DO2 A;  3G6M A;  4IQ2 A;  2YBT A;  3LKX B;  3IK8 A;  4MSP A;  3PQH A;  3AS0 A;  2ZQV A;  3CZ8 A;  2D9F A;  1WB0 A;  4MAV A;  3CHF A;  2N87 A;  3KAD A;  1UR8 A;  3CGM A;  3O5K A;  3O5J A;  4QZV B;  3WD2 A;  1LG2 A;  1ZL1 A;  4ITZ A;  1SR0 A;  4MNK A;  3MQG A;  1D7J A;  4GGQ A;  3M7N A;  1EQ3 A;  3FSB A;  2YAJ B;  1GPF A;  3UQB A;  2B31 A;  4ODQ A;  1NSG A;  4NSB A;  3WD3 A;  5J6E A;  2A3B A;  1N1A A;  3JYM A;  3ARO A;  1JVW A;  4P8W A;  4NNR A;  2XP6 A;  1W9P A;  1FFR A;  3O5M A;  4HBO A;  4URI A;  3WD1 A;  1BL4 A;  3GTY X;  1KFW A;  1QZ2 A;  4WJX A;  1FKD A;  1HKM A;  1NWT A;  1Q6H A;  1FKJ A;  4QIB A;  1KT1 A;  2O92 A;  4G50 A;  4IT6 A;  2MDI A;  5HKG A;  1LL4 A;  1U79 A;  1K9T A;  1ZBC A;  3NRK A;  4J4N A;  5DF0 A;  1HKJ A;  4W5U A;  3UQI A;  5E66 A;  4XAK A;  3ARX A;  2KO7 A;  3M85 A;  3ART A;  1X6N A;  1E6Z A;  2K8I A;  2JMF A;  3RME A;  1TK7 A;  4ML4 A;  4N19 A;  4DRP A;  1CTN A;  2F21 A;  2RE3 A;  1FKG A;  4GIV A;  1R9H A;  5HUA A;  2L2S A;  4LAY A;  2DSU A;  1T11 A;  1FKI A;  1XRV A;  5HBF A;  2DMV A;  3KCE A;  2XP3 A;  2M8J A;  1E6N A;  3UQA A;  2MLY A;  2ZR6 A;  3O5O A;  2EZ5 W;  3EIP A;  2RUD A;  3WQV A;  5E64 A;  2PPP A;  4WKA A;  2WLY A;  4DWS B;  2KE0 A;  4A0U A;  2WM0 A;  1NWR A;  4W9O A;  4LAX A;  2Y8N B;  2AWG A;  4J4O A;  4JFJ A;  2M8I A;  2M3O W;  1WR7 A;  2ZQU A;  2UZ5 A;  1NMV A;  3ALF A;  2JX8 A;  2JZV A;  1TR8 A;  5BXJ A;  1PIN A;  3W4R A;  2MF9 A;  1P5Q A;  3BMB A;  3QOK A;  3G6L A;  4DZ3 A;  1ZBW A;  1A7X A;  2G41 A;  2WAD A;  4JFK A;  1Q1C A;  4TW7 A;  2ZR5 A;  1ITX A;  1YAT A;  2ETN A;  2YSI A;  1J4H A;  1E6R A;  4G2P A;  3I6C A;  3KZ7 A;  4MPK A;  1W26 A;  4L72 B;  3O5E A;  1FKB A;  4ZPV R;  5GPR A;  1ZB5 A;  4Z2G A;  1EYM A;  4MNM A;  2ZQS A;  2DSW A;  1O6I A;  4O2T A;  2KFW A;  4ODL A;  5DIU A;  2G8Z A;  1LL7 A;  3CNG A;  1JMQ A;  3NTP A;  2JXW A;  2B5U B;  3IKD A;  4ODO A;  3TDB A;  1D2K A;  1GRJ A;  2PV3 A;  2LKN A;  2MPH A;  5HW6 A;  1W9V A;  4ODM A;  3LUO A;  4KR0 B;  4ZPW R;  2DT3 A;  4Q7N A;  1FKH A;  1FKT A;  1E9L A;  2ITK A;  4Z2K A;  3CH9 A;  1FD9 A;  3RM8 A;  3UI4 A;  3BXW A;  2PV1 A;  4DH0 A;  3VAW A;  2FDM A;  3O5I A;  3ODK A;  1J4R A;  3FAP A;  3ARQ A;  1W1P A;  1ZBK A;  4DWS C;  2A3A A;  3ARV A;  4ODP A;  4TNS A;  1B6C A;  2XP7 A;  2MLZ A;  2IF4 A;  2KR7 A;  3FY1 A;  3IKG A;  4IPX A;  4JFI A;  2BA1 A;  3B9E A;  3O5L A;  4MTV A;  5D75 A;  2LGO A;  2PBC A;  1E6P A;  3WL0 A;  3CHE A;  3WH0 A;  1RD6 A;  3GU0 A;  4MGV A;  3PRA A;  2DWV A;  1FKR A;  2KXQ A;  4WK9 A;  1VF8 A;  3CGN A;  1LQ0 A;  4U86 A;  4DRH A;  1NH6 A;  2VCD A;  4E5R A;  2DK1 A;  4W9P A;  1W1Y A;  4FN2 A;  1Y0O A;  4P8V A;  5I98 A;  4LAW A;  1QPL A;  3ARZ A;  3TC5 A;  5DEZ A;  4Z2J A;  1PBK A;  2YBU A;  2RSE A;  4DT4 A;  2F23 A;  3B9A A;  4TW8 A;  1JCH B;  4R0X A;  1FKF A;  2DJY A;  3UF8 A;  4DWS A;  1WAW A;  4ODK A;  5HW7 A;  1Q6I A;  3FXY A;  3WQW A;  3WL1 A; 
#chains in the Genus database with same CATH homology
 2Y78 A;  2AOS A;  2F2D A;  4PTM A;  3PR9 A;  1EIB A;  4TYO A;  2DG3 A;  1K9R A;  1WMV A;  3EY6 A;  4BF8 A;  2VN1 A;  1K9Q A;  2DT0 A;  3OOB A;  1JNT A;  4AY1 A;  5HW8 A;  5HT1 A;  3RM4 A;  4LAV A;  3H9R B;  3O5D A;  3KAB A;  1LJY A;  4JFM A;  2PPO A;  3ARP A;  1Q6U A;  4DRO A;  2L4J A;  4QT3 A;  4DRI A;  4DRM A;  2ESC A;  3MCB A;  4WKH A;  3TCZ A;  3ARW A;  1JND A;  3ARY A;  1JNS A;  3KAG A;  1O6W A;  1XHG A;  2M2A A;  1D6O A;  3MCB B;  1L1P A;  2OLH A;  2DSV A;  2LAJ A;  1IX5 A;  3GPK A;  4QT2 A;  1J4I A;  2F4E A;  3UI6 A;  3JXV A;  1FFQ A;  1OGG A;  1TCO C;  3LE4 A;  2WK2 A;  1W1T A;  5B8I C;  1H0I A;  2OWO A;  5GQB A;  3AS1 A;  1EG4 A;  1ZU8 A;  2RUC A;  5HTG A;  3O5F A;  4LGX A;  2DK7 A;  2DPE A;  4TW6 A;  5HWB A;  4U85 A;  2WLZ A;  3WD4 A;  3PRD A;  3OA5 A;  4Z2H A;  1ZBV A;  1H0G A;  2MLX A;  4KQZ A;  4P8U A;  4R5E A;  4S3J A;  4DRQ A;  1QPF A;  1HJX A;  1HKK A;  2M1I A;  5E62 A;  3WIJ A;  1D7I A;  2PI6 A;  4NZC A;  4HBE A;  2ZQT A;  1FLC A;  1KT0 A;  3ARR A;  1UR9 A;  4DIP A;  4DRJ A;  1GOI A;  4ZPT R;  4DZ2 A;  4S3K A;  3ARU A;  1HJV A;  4FAP A;  4DWS D;  2XP5 A;  3PA7 A;  2FKE A;  5CQ2 A;  3AS2 A;  1EG3 A;  3CHC A;  3FS8 A;  2E45 A;  1M5Y A;  1EDQ A;  5E65 A;  2Q5A A;  2PV2 A;  4JYS A;  4C02 B;  1W9U A;  2PPN A;  4DRN A;  2DG4 A;  4DRK A;  1D7H A;  1HJW A;  3FSC A;  2RUR A;  3B9D A;  4MNJ A;  2YSF A;  3KAH A;  3O5R A;  5HWC A;  1LG1 A;  1FAP A;  2LJ4 A;  3RFW A;  1LL6 A;  2DT1 A;  3WKZ A;  2XP9 A;  4U84 A;  2ZAJ A;  4WKF A;  4REX A;  1W1V A;  1ROU A;  2OFN A;  5DIT A;  1C9H A;  5AHT A;  4WIW A;  1YW5 A;  2O9O A;  2XPA A;  1BKF A;  1HKI A;  2DT2 A;  3RGC A;  4A0T A;  3AQU A;  2QF8 A;  5JH8 A;  4MNL A;  1FKK A;  2LPV A;  4IQC A;  1TFV A;  2M08 A;  4ODN A;  1FKL A;  2YSH A;  1NMW A;  4P8X A;  3JYJ A;  1GUV A;  2KGJ A;  4Z2I A;  2RQS A;  3KAC A;  2DG9 A;  2XPB A;  3UI5 A;  1JNE A;  3MQH A;  2YSB A;  1NWS A;  3KAI A;  3KAF A;  1E15 A;  5GPG A;  1EHN A;  4Z2L A;  2A3C A;  3B7X A;  2KI3 A;  3MDY B;  1FKS A;  5U47 A;  3WD0 A;  3L4H A;  1I5H W;  3IHZ A;  4TX0 A;  4ZS6 A;  4GLX A;  3O5P A;  4Q22 A;  2RUQ A;  4L3N A;  1ZCN A;  1J6Y A;  4ODR A;  2QRV A;  2XP8 A;  3O5G A;  2FAP A;  1SYT A;  3ALG A;  2ZR4 A;  3AS3 A;  3B8S A;  3NI6 A;  1ZK6 A;  5E5W A;  3RM9 A;  1X6L A;  3ARS A;  1OGB A;  1WNO A;  1HXV A;  2IUZ A;  2JV4 A;  2MNT A;  2A3E A;  2WAE A;  1OWQ A;  2YSG A;  3CHD A;  1ROT A;  5DIV A;  1F40 A;  4W9Q A;  1RP5 A;  1FJD A;  4JFL A;  3O5Q A;  4IT4 A;  1F8A B;  3PRB A;  4HAR A;  1NWU A;  2XP4 A;  3LKX A;  2DSZ A;  5DO2 A;  3G6M A;  4IQ2 A;  2YBT A;  3LKX B;  3IK8 A;  4MSP A;  3PQH A;  3AS0 A;  2ZQV A;  3CZ8 A;  2D9F A;  1WB0 A;  4MAV A;  3CHF A;  2N87 A;  3KAD A;  1UR8 A;  3CGM A;  3O5K A;  3O5J A;  4QZV B;  3WD2 A;  1LG2 A;  1ZL1 A;  4ITZ A;  1SR0 A;  4MNK A;  3MQG A;  1D7J A;  4GGQ A;  3M7N A;  1EQ3 A;  3FSB A;  2YAJ B;  1GPF A;  3UQB A;  2B31 A;  4ODQ A;  1NSG A;  4NSB A;  3WD3 A;  5J6E A;  2A3B A;  1N1A A;  3JYM A;  3ARO A;  1JVW A;  4P8W A;  4NNR A;  2XP6 A;  1W9P A;  1FFR A;  3O5M A;  4HBO A;  4URI A;  3WD1 A;  1BL4 A;  1KFW A;  1QZ2 A;  4WJX A;  1FKD A;  1HKM A;  1NWT A;  1Q6H A;  1FKJ A;  4QIB A;  1KT1 A;  2O92 A;  4G50 A;  4IT6 A;  2MDI A;  5HKG A;  1LL4 A;  1U79 A;  1K9T A;  1ZBC A;  3NRK A;  4J4N A;  5DF0 A;  1HKJ A;  4W5U A;  3UQI A;  5E66 A;  4XAK A;  3ARX A;  2KO7 A;  3M85 A;  3ART A;  1X6N A;  1E6Z A;  2K8I A;  2JMF A;  3RME A;  1TK7 A;  4ML4 A;  4N19 A;  4DRP A;  1CTN A;  2F21 A;  2RE3 A;  1FKG A;  4GIV A;  1R9H A;  5HUA A;  2L2S A;  4LAY A;  2DSU A;  1T11 A;  1FKI A;  1XRV A;  5HBF A;  2DMV A;  3KCE A;  2XP3 A;  2M8J A;  1E6N A;  3UQA A;  2MLY A;  2ZR6 A;  3O5O A;  2EZ5 W;  2RUD A;  3WQV A;  5E64 A;  2PPP A;  4WKA A;  2WLY A;  4DWS B;  2KE0 A;  4A0U A;  2WM0 A;  1NWR A;  4W9O A;  4LAX A;  2Y8N B;  2AWG A;  4J4O A;  4JFJ A;  2M8I A;  2M3O W;  1WR7 A;  2ZQU A;  2UZ5 A;  1NMV A;  3ALF A;  2JX8 A;  2JZV A;  1TR8 A;  5BXJ A;  1PIN A;  3W4R A;  2MF9 A;  1P5Q A;  3QOK A;  3G6L A;  4DZ3 A;  1ZBW A;  1A7X A;  2G41 A;  2WAD A;  4JFK A;  1Q1C A;  4TW7 A;  2ZR5 A;  1ITX A;  1YAT A;  2YSI A;  1J4H A;  1E6R A;  4G2P A;  3I6C A;  3KZ7 A;  4MPK A;  1W26 A;  4L72 B;  3O5E A;  1FKB A;  4ZPV R;  5GPR A;  1ZB5 A;  4Z2G A;  1EYM A;  4MNM A;  2ZQS A;  2DSW A;  1O6I A;  4O2T A;  2KFW A;  4ODL A;  5DIU A;  2G8Z A;  1LL7 A;  3CNG A;  1JMQ A;  3NTP A;  2JXW A;  3IKD A;  4ODO A;  3TDB A;  1D2K A;  2PV3 A;  2LKN A;  2MPH A;  5HW6 A;  1W9V A;  4ODM A;  3LUO A;  4KR0 B;  4ZPW R;  2DT3 A;  4Q7N A;  1FKH A;  1FKT A;  1E9L A;  2ITK A;  4Z2K A;  3CH9 A;  1FD9 A;  3RM8 A;  3UI4 A;  3BXW A;  2PV1 A;  4DH0 A;  3VAW A;  2FDM A;  3O5I A;  3ODK A;  1J4R A;  3FAP A;  3ARQ A;  1W1P A;  1ZBK A;  4DWS C;  2A3A A;  3ARV A;  4ODP A;  4TNS A;  1B6C A;  2XP7 A;  2MLZ A;  2IF4 A;  2KR7 A;  3FY1 A;  3IKG A;  4IPX A;  4JFI A;  2BA1 A;  3B9E A;  3O5L A;  4MTV A;  5D75 A;  2LGO A;  2PBC A;  1E6P A;  3WL0 A;  3CHE A;  3WH0 A;  1RD6 A;  4MGV A;  3PRA A;  2DWV A;  1FKR A;  2KXQ A;  4WK9 A;  1VF8 A;  3CGN A;  1LQ0 A;  4U86 A;  4DRH A;  1NH6 A;  2VCD A;  4E5R A;  2DK1 A;  4W9P A;  1W1Y A;  4FN2 A;  1Y0O A;  4P8V A;  5I98 A;  4LAW A;  1QPL A;  3ARZ A;  3TC5 A;  5DEZ A;  4Z2J A;  1PBK A;  2YBU A;  2RSE A;  4DT4 A;  3B9A A;  4TW8 A;  4R0X A;  1FKF A;  2DJY A;  3UF8 A;  4DWS A;  1WAW A;  4ODK A;  5HW7 A;  1Q6I A;  3FXY A;  3WQW A;  3WL1 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...