3ODKA

Discovery of cell-active phenyl-imidazole pin1 inhibitors by structure-guided fragment evolution
Total Genus 42
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
42
sequence length
157
structure length
145
Chain Sequence
LPPGWEKAMSRSSGRVYYFNHITNASQWERPSEPARVRCSHLLVKHSQSRRPSSWRQEKITRTKEEALELINGYIQKIKSGEEDFESLASQFSDCSSAKARGDLGAFSRGQMQKPFEDASFALRTGEMSGPVFTDSGIHIILRTE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Isomerase
molecule keywords Peptidyl-prolyl cis-trans isomerase NIMA-interacting 1
publication title Discovery of cell-active phenyl-imidazole Pin1 inhibitors by structure-guided fragment evolution.
pubmed doi rcsb
source organism Homo sapiens
total genus 42
structure length 145
sequence length 157
ec nomenclature ec 5.2.1.8: Peptidylprolyl isomerase.
pdb deposition date 2010-08-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00397 WW WW domain
A PF00639 Rotamase PPIC-type PPIASE domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.20.70.10 Mainly Beta Single Sheet Ubiquitin Ligase Nedd4; Chain: W; Ubiquitin Ligase Nedd4; Chain: W; 3odkA01
3.10.50.40 Alpha Beta Roll Chitinase A; domain 3 Chitinase A; domain 3 3odkA02
3TDBA 2KR7A 2UZ5A 3I6CA 4ODQA 2L4JA 1QPFA 3KADA 1EG3A 3H9RB 2IF4A 4QT3A 1PBKA 1Y0OA 4LAWA 4IPXA 3M85A 2KE0A 2DK1A 5HWCA 3VAWA 1T11A 3RFWA 1EYMA 1W26A 2MF9A 1FKKA 2MPHA 3UI5A 4IQ2A 4JYSA 4DRKA 4R0XA 1C9HA 4TYOA 2XPBA 4TW7A 1FKDA 2D9FA 4O2TA 3O5IA 2XP9A 2PV2A 3O5EA 3PA7A 4MSPA 5BXJA 3EY6A 4G2PA 3UF8A 1K9RA 1FKTA 4DRQA 4U85A 3M7NA 2MLXA 2FAPA 2N87A 1L1PA 5HUAA 1FKGA 2KGJA 3UI4A 1ROTA 1NSGA 1J4IA 4BF8A 2F4EA 3KCEA 2PPOA 4QT2A 4TX0A 1ROUA 3UQIA 4ODOA 2LKNA 2KFWA 3JYMA 3KABA 2XP7A 1FAPA 2LJ4A 2RUQA 1D7JA 2ZQTA 1YW5A 4W9QA 3JYJA 3O5LA 2RSEA 1EQ3A 3ODKA 2XP6A 2L2SA 5GPGA 4QIBA 3O5RA 2XPAA 4W9OA 4DRJA 2MNTA 2F2DA 1N1AA 2JV4A 1FKRA 1J6YA 1K9QA 3OOBA 2DWVA 2DG3A 1D7HA 2M1IA 4J4NA 1A7XA 2AWGA 2M08A 2ZAJA 5D75A 4MGVA 3NRKA 3UQBA 3L4HA 1BL4A 1FKFA 3KAGA 3O5MA 3IHZA 2XP5A 3O5OA 4ODNA 1J4RA 1TCOC 4LAYA 1FKBA 2KO7A 2BA1A 2PPNA 1HXVA 1B6CA 5CQ2A 3MDYB 2XP4A 1WMVA 2YSGA 4ODMA 3CGMA 4ODPA 1R9HA 2ITKA 3PRDA 3UQAA 3NTPA 2M3OW 4E5RA 1I5HW 3O5KA 4ODLA 4GIVA 4W9PA 4ODRA 1J4HA 4IQCA 3KAHA 2DJYA 4G50A 2YSHA 2DG9A 5J6EA 1FKSA 3CNGA 3LUOA 4DROA 1KT1A 4JFLA 1Q6HA 2DK7A 1ZCNA 5HKGA 4N19A 1NMWA 1FJDA 2LPVA 5AHTA 4C02B 3TCZA 3LE4A 2DMVA 1WR7A 4DZ3A 3WH0A 2VN1A 4DH0A 4U84A 2MDIA 4LAVA 5DITA 1YATA 3CGNA 1FKIA 5HTGA 4FAPA 1Q6UA 3PRBA 1O6WA 3KACA 3B7XA 4DRIA 2ZR4A 4DRHA 2M8IA 5HW7A 1FD9A 1JVWA 2KI3A 4GGQA 2LGOA 1Q1CA 1BKFA 4DRPA 2XP8A 2M2AA 4FN2A 2JMFA 1F8AB 4DRMA 2RQSA 5HW6A 2KXQA 2ZR6A 1NMVA 1JMQA 1FKJA 2EZ5W 2YSBA 4JFKA 4JFMA 4REXA 2JZVA 3O5JA 4ODKA 3O5GA 4DIPA 5HWBA 2XP3A 5DIUA 4U86A 2M8JA 2PPPA 2MLZA 3KZ7A 2ZR5A 2JXWA 2PV3A 1M5YA 3TC5A 4LAXA 2LAJA 1JNSA 2ZQSA 3KAIA 3JXVA 4DT4A 1Q6IA 2OFNA 1QZ2A 1FKHA 2RUCA 3O5QA 4TW8A 3O5PA 1JNTA 1FKLA 1KT0A 2K8IA 2FKEA 1QPLA 2RUDA 2DG4A 4ITZA 4TW6A 3FAPA 3UI6A 3KAFA 2RURA 2PV1A 3IKGA 2MLYA 3IK8A 2ZQUA 4NNRA 5HT1A 1U79A 5I98A 4J4OA 1TK7A 3RGCA 3O5FA 4TNSA 4DZ2A 2YSIA 2RE3A 1D7IA 2ZQVA 2JX8A 1F40A 2VCDA 5B8IC 1ZK6A 3GPKA 2E45A 2F21A 2YSFA 1EG4A 3IKDA 1PINA 3O5DA 1D6OA 4JFIA 3NI6A 2Q5AA 4DRNA 2PBCA 4JFJA 5HW8A 5DIVA 1P5QA 2Y78A
chains in the Genus database with same CATH superfamily
4Z2IA 3ALGA 3TDBA 2WAEA 1ZBCA 2KR7A 2UZ5A 3I6CA 4ODQA 2L4JA 1QPFA 3ARUA 4P8VA 3KADA 4NSBA 3ARYA 1EG3A 3H9RB 2IF4A 4QT3A 1PBKA 1Y0OA 2OWOA 3CH9A 4LAWA 4IPXA 3M85A 1W9VA 2KE0A 2DK1A 3B8SA 3VAWA 5HWCA 4IT4A 1T11A 3RFWA 2O9OA 1NH6A 1KFWA 3WD4A 1EYMA 4HBEA 3FSBA 1ZL1A 1W26A 1E44A 1HJVA 2MF9A 3ARWA 1FKKA 2MPHA 1ITXA 3UI5A 3FY1A 4LGXA 2DT2A 4IQ2A 4JYSA 4DRKA 1W1PA 4R0XA 1C9HA 4TYOA 2AOSA 4XAKA 2XPBA 4TW7A 1FKDA 2D9FA 4O2TA 1RD6A 3O5IA 4QZVB 2XP9A 2PV2A 3O5EA 3PA7A 4MSPA 4L3NA 5BXJA 2B5UB 3ARPA 3EY6A 4AY1A 4G2PA 1LL7A 3UF8A 3LKXA 1K9RA 4PTMA 1FKTA 4DRQA 4U85A 3M7NA 5DO2A 2MLXA 2FAPA 3AQUA 5E65A 5E64A 3ARXA 2N87A 4MNKA 1L1PA 5HUAA 1FKGA 1WNOA 2KGJA 3UI4A 1OWQA 1ROTA 1ZU8A 4KQZA 2O92A 3ARTA 2DPEA 1NSGA 1J4IA 1W9UA 4BF8A 2P4VA 2F4EA 3KCEA 2PPOA 4URIA 1GOIA 4QT2A 4W5UA 4TX0A 1ROUA 3UQIA 3WD3A 4ODOA 1E6PA 2LKNA 1HKIA 2KFWA 3KABA 2XP7A 3JYMA 3WIJA 1FAPA 1EHNA 1JNDA 2LJ4A 2RUQA 3G6LA 1D7JA 2ZQTA 3CZ8A 1NWSA 1YW5A 4DWSA 4W9QA 3JYJA 3O5LA 2RSEA 2G41A 3ARVA 2Y8NB 1EQ3A 1GPFA 3ODKA 5DEZA 1LG2A 4A0UA 2EULA 2WM0A 2XP6A 2L2SA 5GPGA 4QIBA 3O5RA 1OGGA 2XPAA 4W9OA 4DRJA 2MNTA 2F2DA 1N1AA 2PI6A 2JV4A 2PN0A 1FKRA 1J6YA 2FDMA 1K9QA 3OOBA 4A0TA 2DWVA 2DG3A 1D7HA 2M1IA 4WKAA 2ETNA 4J4NA 1A7XA 1H0GA 2YBUA 4WKHA 2AWGA 2M08A 2ZAJA 5D75A 4MGVA 3NRKA 5GQBA 1HKMA 2QRVA 1LL4A 3UQBA 3FSCA 5HBFA 1HKKA 3L4HA 3FS8A 1BL4A 4ZPTR 1FKFA 1XRVA 3KAGA 3O5MA 3IHZA 2XP5A 4Q22A 3O5OA 4ODNA 1J4RA 1TCOC 4MNLA 4ZS6A 1SR0A 2WK2A 4LAYA 4MNMA 1FKBA 2KO7A 2BA1A 2F23A 2PPNA 1HXVA 1B6CA 1H0IA 5CQ2A 1E6RA 3AROA 3MDYB 5E62A 2XP4A 1WMVA 2YSGA 4ODMA 3CGMA 4ODPA 1R9HA 3B9AA 3ARQA 2ITKA 1W1VA 1JCHB 3PRDA 4Z2JA 4Q7NA 3UQAA 1W9PA 3NTPA 1E6ZA 2M3OW 4E5RA 1I5HW 3O5KA 3AS3A 4ODLA 4GIVA 4W9PA 2DT1A 4WJXA 4ODRA 1J4HA 4IQCA 3LKXB 3KAHA 4L72B 4WKFA 1FFRA 2DJYA 4G50A 2YSHA 2DG9A 5J6EA 1FKSA 3CNGA 3LUOA 1KT1A 4DROA 4JFLA 3FXYA 2DSZA 3PRAA 1Q6HA 2DK7A 2YAJB 4NZCA 5U47A 1ZCNA 5HKGA 1TR8A 4N19A 1NMWA 1GUVA 1FJDA 2G8ZA 2LPVA 5AHTA 4C02B 3GU0A 2OLHA 4P8UA 3TCZA 3LE4A 2DMVA 3WQWA 1LG1A 3MQHA 1XHGA 1WR7A 4DZ3A 3WH0A 2VN1A 4DH0A 1VF8A 4U84A 2MDIA 4MNJA 5E5WA 3WKZA 4LAVA 5DITA 4DWSC 2DSWA 1ZBKA 3WD1A 4Z2HA 3MCBA 3CHDA 1YATA 1HJXA 3CHCA 4DWSB 3ALFA 1WB0A 3CGNA 1UR9A 2ESCA 2A3EA 4KR0B 4DWSD 1FKIA 3BXWA 4Z2KA 3B9DA 5HTGA 3WL1A 5JH8A 3AS2A 1LL6A 4FAPA 1Q6UA 2WLYA 2IUZA 1RP5A 1TFVA 1OGBA 4ML4A 3PRBA 1O6WA 3KACA 3B7XA 4DRIA 2ZR4A 1ZBVA 2M8IA 2YBTA 1FFQA 1FD9A 4DRHA 5HW7A 2DSUA 1D2KA 1JVWA 4ZPWR 4ZPVR 2KI3A 4GLXA 2WADA 4GGQA 2LGOA 1FLCA 1Q1CA 1BKFA 4P8WA 4DRPA 2DSVA 5GPRA 4MAVA 4R5EA 2XP8A 2M2AA 4FN2A 2JMFA 4MTVA 1F8AB 4DRMA 2RQSA 5HW6A 2KXQA 2ZR6A 1IX5A 1NMVA 1JMQA 1FKJA 2EZ5W 1K9TA 3QOKA 2YSBA 4JFKA 4JFMA 4REXA 2JZVA 3O5JA 3WD2A 4ODKA 3RM4A 4Z2LA 1X6LA 3O5GA 4DIPA 5HWBA 2XP3A 5DIUA 3ARRA 4U86A 1O6IA 2M8JA 2PPPA 1LQ0A 3ARSA 1SYTA 2MLZA 3PR9A 3KZ7A 3WD0A 2ZR5A 2JXWA 2PV3A 1M5YA 3TC5A 1EIBA 4LAXA 2LAJA 1LJYA 3AS1A 1JNSA 2ZQSA 3CHEA 1X6NA 1E9LA 4S3JA 3KAIA 3JXVA 4DT4A 2A3AA 1Q6IA 2OFNA 1QZ2A 3CHFA 1WAWA 1FKHA 2RUCA 3O5QA 4TW8A 3O5PA 5E66A 1JNTA 3OA5A 1FKLA 1HKJA 1KT0A 2K8IA 2FKEA 3ARZA 1QPLA 2WLZA 2RUDA 2DG4A 4ITZA 3BMBA 4IT6A 2DT3A 4TW6A 3FAPA 3UI6A 3WL0A 3KAFA 2B31A 4WIWA 5DF0A 2RURA 2PV1A 3IKGA 2MLYA 2QF8A 2A3BA 3G6MA 3IK8A 1W1YA 4P8XA 3RM8A 3MQGA 3B9EA 2ZQUA 4NNRA 3EIPA 5HT1A 1U79A 5I98A 1W1TA 4J4OA 1UR8A 1TK7A 3RGCA 3O5FA 3WQVA 4TNSA 1ZBWA 3AS0A 4HARA 2YSIA 4DZ2A 2RE3A 1D7IA 2ZQVA 2JX8A 3MCBB 2VCDA 1F40A 1HJWA 3RMEA 3GTYX 1CTNA 1E6NA 1JNEA 5B8IC 3RM9A 4HBOA 1ZK6A 3GPKA 4Z2GA 2E45A 2F21A 2YSFA 1E15A 1EDQA 3PQHA 1EG4A 3IKDA 4S3KA 1PINA 2DT0A 3O5DA 1D6OA 2A3CA 4JFIA 4WK9A 3NI6A 2Q5AA 4DRNA 2PBCA 4JFJA 1NWTA 1NWRA 4UDMA 1GRJA 5HW8A 5DIVA 1ZB5A 4MPKA 1P5QA 3W4RA 2Y78A 1NWUA
chains in the Genus database with same CATH topology
4Z2IA 3ALGA 3TDBA 2WAEA 1ZBCA 2KR7A 2UZ5A 3I6CA 4ODQA 2L4JA 1QPFA 3ARUA 4P8VA 3KADA 4NSBA 3ARYA 1EG3A 3H9RB 2IF4A 4QT3A 1PBKA 1Y0OA 2OWOA 3CH9A 4LAWA 4IPXA 3M85A 1W9VA 2KE0A 2DK1A 3B8SA 3VAWA 5HWCA 4IT4A 1T11A 3RFWA 2O9OA 1NH6A 1KFWA 3WD4A 1EYMA 4HBEA 3FSBA 1ZL1A 1W26A 1HJVA 2MF9A 3ARWA 1FKKA 2MPHA 1ITXA 3UI5A 3FY1A 4LGXA 2DT2A 4IQ2A 4JYSA 4DRKA 1W1PA 4R0XA 1C9HA 4TYOA 2AOSA 4XAKA 2XPBA 4TW7A 1FKDA 2D9FA 4O2TA 1RD6A 3O5IA 4QZVB 2XP9A 2PV2A 3O5EA 3PA7A 4MSPA 4L3NA 5BXJA 3ARPA 3EY6A 4AY1A 4G2PA 1LL7A 3UF8A 3LKXA 1K9RA 4PTMA 1FKTA 4DRQA 4U85A 3M7NA 5DO2A 2MLXA 2FAPA 3AQUA 5E65A 5E64A 3ARXA 2N87A 4MNKA 1L1PA 5HUAA 1FKGA 1WNOA 2KGJA 3UI4A 1OWQA 1ROTA 1ZU8A 4KQZA 2O92A 3ARTA 2DPEA 1NSGA 1J4IA 1W9UA 4BF8A 2F4EA 3KCEA 2PPOA 4URIA 1GOIA 4QT2A 4W5UA 4TX0A 1ROUA 3UQIA 3WD3A 4ODOA 1E6PA 2LKNA 1HKIA 2KFWA 3KABA 2XP7A 3JYMA 3WIJA 1FAPA 1EHNA 1JNDA 2LJ4A 2RUQA 3G6LA 1D7JA 2ZQTA 3CZ8A 1NWSA 1YW5A 4DWSA 4W9QA 3JYJA 3O5LA 2RSEA 2G41A 3ARVA 2Y8NB 1EQ3A 1GPFA 3ODKA 5DEZA 1LG2A 4A0UA 2WM0A 2XP6A 2L2SA 5GPGA 4QIBA 3O5RA 1OGGA 2XPAA 4W9OA 4DRJA 2MNTA 2F2DA 1N1AA 2PI6A 2JV4A 1FKRA 1J6YA 2FDMA 1K9QA 3OOBA 4A0TA 2DWVA 2DG3A 1D7HA 2M1IA 4WKAA 4J4NA 1A7XA 1H0GA 2YBUA 4WKHA 2AWGA 2M08A 2ZAJA 5D75A 4MGVA 3NRKA 5GQBA 1HKMA 2QRVA 1LL4A 3UQBA 3FSCA 5HBFA 1HKKA 3L4HA 3FS8A 1BL4A 4ZPTR 1FKFA 1XRVA 3KAGA 3O5MA 3IHZA 2XP5A 4Q22A 3O5OA 4ODNA 1J4RA 1TCOC 4MNLA 4ZS6A 1SR0A 2WK2A 4LAYA 4MNMA 1FKBA 2KO7A 2BA1A 2PPNA 1HXVA 1B6CA 1H0IA 5CQ2A 1E6RA 3AROA 3MDYB 5E62A 2XP4A 1WMVA 2YSGA 4ODMA 3CGMA 4ODPA 1R9HA 3B9AA 3ARQA 2ITKA 1W1VA 3PRDA 4Z2JA 4Q7NA 3UQAA 1W9PA 3NTPA 1E6ZA 2M3OW 4E5RA 1I5HW 3O5KA 3AS3A 4ODLA 4GIVA 4W9PA 2DT1A 4WJXA 4ODRA 1J4HA 4IQCA 3LKXB 3KAHA 4L72B 4WKFA 1FFRA 2DJYA 4G50A 2YSHA 2DG9A 5J6EA 1FKSA 3CNGA 3LUOA 1KT1A 4DROA 4JFLA 3FXYA 2DSZA 3PRAA 1Q6HA 2DK7A 2YAJB 4NZCA 5U47A 1ZCNA 5HKGA 1TR8A 4N19A 1NMWA 1GUVA 1FJDA 2G8ZA 2LPVA 5AHTA 4C02B 2OLHA 4P8UA 3TCZA 3LE4A 2DMVA 3WQWA 1LG1A 3MQHA 1XHGA 1WR7A 4DZ3A 3WH0A 2VN1A 4DH0A 1VF8A 4U84A 2MDIA 4MNJA 5E5WA 3WKZA 4LAVA 5DITA 4DWSC 2DSWA 1ZBKA 3WD1A 4Z2HA 3MCBA 3CHDA 1YATA 1HJXA 3CHCA 4DWSB 3ALFA 1WB0A 3CGNA 1UR9A 2ESCA 2A3EA 4KR0B 4DWSD 1FKIA 3BXWA 4Z2KA 3B9DA 5HTGA 3WL1A 5JH8A 3AS2A 1LL6A 4FAPA 1Q6UA 2WLYA 2IUZA 1RP5A 1TFVA 1OGBA 4ML4A 3PRBA 1O6WA 3KACA 3B7XA 4DRIA 2ZR4A 1ZBVA 2M8IA 2YBTA 1FFQA 1FD9A 4DRHA 5HW7A 2DSUA 1D2KA 1JVWA 4ZPWR 4ZPVR 2KI3A 4GLXA 2WADA 4GGQA 2LGOA 1FLCA 1Q1CA 1BKFA 4P8WA 4DRPA 2DSVA 5GPRA 4MAVA 4R5EA 2XP8A 2M2AA 4FN2A 2JMFA 4MTVA 1F8AB 4DRMA 2RQSA 5HW6A 2KXQA 2ZR6A 1IX5A 1NMVA 1JMQA 1FKJA 2EZ5W 1K9TA 3QOKA 2YSBA 4JFKA 4JFMA 4REXA 2JZVA 3O5JA 3WD2A 4ODKA 3RM4A 4Z2LA 1X6LA 3O5GA 4DIPA 5HWBA 2XP3A 5DIUA 3ARRA 4U86A 1O6IA 2M8JA 2PPPA 1LQ0A 3ARSA 1SYTA 2MLZA 3PR9A 3KZ7A 3WD0A 2ZR5A 2JXWA 2PV3A 1M5YA 3TC5A 1EIBA 4LAXA 2LAJA 1LJYA 3AS1A 1JNSA 2ZQSA 3CHEA 1X6NA 1E9LA 4S3JA 3KAIA 3JXVA 4DT4A 2A3AA 1Q6IA 2OFNA 1QZ2A 3CHFA 1WAWA 1FKHA 2RUCA 3O5QA 4TW8A 3O5PA 5E66A 1JNTA 3OA5A 1FKLA 1HKJA 1KT0A 2K8IA 2FKEA 3ARZA 1QPLA 2WLZA 2RUDA 2DG4A 4ITZA 4IT6A 2DT3A 4TW6A 3FAPA 3UI6A 3WL0A 3KAFA 2B31A 4WIWA 5DF0A 2RURA 2PV1A 3IKGA 2MLYA 2QF8A 2A3BA 3G6MA 3IK8A 1W1YA 4P8XA 3RM8A 3MQGA 3B9EA 2ZQUA 4NNRA 5HT1A 1U79A 5I98A 1W1TA 4J4OA 1UR8A 1TK7A 3RGCA 3O5FA 3WQVA 4TNSA 1ZBWA 3AS0A 4HARA 2YSIA 4DZ2A 2RE3A 1D7IA 2ZQVA 2JX8A 3MCBB 2VCDA 1F40A 1HJWA 3RMEA 1CTNA 1E6NA 1JNEA 5B8IC 3RM9A 4HBOA 1ZK6A 3GPKA 4Z2GA 2E45A 2F21A 2YSFA 1E15A 1EDQA 3PQHA 1EG4A 3IKDA 4S3KA 1PINA 2DT0A 3O5DA 1D6OA 2A3CA 4JFIA 4WK9A 3NI6A 2Q5AA 4DRNA 2PBCA 4JFJA 1NWTA 1NWRA 5HW8A 5DIVA 1ZB5A 4MPKA 1P5QA 3W4RA 2Y78A 1NWUA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3TDB A;  2KR7 A;  2UZ5 A;  3I6C A;  4ODQ A;  2L4J A;  1QPF A;  3KAD A;  1EG3 A;  3H9R B;  2IF4 A;  4QT3 A;  1PBK A;  1Y0O A;  4LAW A;  4IPX A;  3M85 A;  2KE0 A;  2DK1 A;  5HWC A;  3VAW A;  1T11 A;  3RFW A;  1EYM A;  1W26 A;  2MF9 A;  1FKK A;  2MPH A;  3UI5 A;  4IQ2 A;  4JYS A;  4DRK A;  4R0X A;  1C9H A;  4TYO A;  2XPB A;  4TW7 A;  1FKD A;  2D9F A;  4O2T A;  3O5I A;  2XP9 A;  2PV2 A;  3O5E A;  3PA7 A;  4MSP A;  5BXJ A;  3EY6 A;  4G2P A;  3UF8 A;  1K9R A;  1FKT A;  4DRQ A;  4U85 A;  3M7N A;  2MLX A;  2FAP A;  2N87 A;  1L1P A;  5HUA A;  1FKG A;  2KGJ A;  3UI4 A;  1ROT A;  1NSG A;  1J4I A;  4BF8 A;  2F4E A;  3KCE A;  2PPO A;  4QT2 A;  4TX0 A;  1ROU A;  3UQI A;  4ODO A;  2LKN A;  2KFW A;  3JYM A;  3KAB A;  2XP7 A;  1FAP A;  2LJ4 A;  2RUQ A;  1D7J A;  2ZQT A;  1YW5 A;  4W9Q A;  3JYJ A;  3O5L A;  2RSE A;  1EQ3 A;  3ODK A;  2XP6 A;  2L2S A;  5GPG A;  4QIB A;  3O5R A;  2XPA A;  4W9O A;  4DRJ A;  2MNT A;  2F2D A;  1N1A A;  2JV4 A;  1FKR A;  1J6Y A;  1K9Q A;  3OOB A;  2DWV A;  2DG3 A;  1D7H A;  2M1I A;  4J4N A;  1A7X A;  2AWG A;  2M08 A;  2ZAJ A;  5D75 A;  4MGV A;  3NRK A;  3UQB A;  3L4H A;  1BL4 A;  1FKF A;  3KAG A;  3O5M A;  3IHZ A;  2XP5 A;  3O5O A;  4ODN A;  1J4R A;  1TCO C;  4LAY A;  1FKB A;  2KO7 A;  2BA1 A;  2PPN A;  1HXV A;  1B6C A;  5CQ2 A;  3MDY B;  2XP4 A;  1WMV A;  2YSG A;  4ODM A;  3CGM A;  4ODP A;  1R9H A;  2ITK A;  3PRD A;  3UQA A;  3NTP A;  2M3O W;  4E5R A;  1I5H W;  3O5K A;  4ODL A;  4GIV A;  4W9P A;  4ODR A;  1J4H A;  4IQC A;  3KAH A;  2DJY A;  4G50 A;  2YSH A;  2DG9 A;  5J6E A;  1FKS A;  3CNG A;  3LUO A;  4DRO A;  1KT1 A;  4JFL A;  1Q6H A;  2DK7 A;  1ZCN A;  5HKG A;  4N19 A;  1NMW A;  1FJD A;  2LPV A;  5AHT A;  4C02 B;  3TCZ A;  3LE4 A;  2DMV A;  1WR7 A;  4DZ3 A;  3WH0 A;  2VN1 A;  4DH0 A;  4U84 A;  2MDI A;  4LAV A;  5DIT A;  1YAT A;  3CGN A;  1FKI A;  5HTG A;  4FAP A;  1Q6U A;  3PRB A;  1O6W A;  3KAC A;  3B7X A;  4DRI A;  2ZR4 A;  4DRH A;  2M8I A;  5HW7 A;  1FD9 A;  1JVW A;  2KI3 A;  4GGQ A;  2LGO A;  1Q1C A;  1BKF A;  4DRP A;  2XP8 A;  2M2A A;  4FN2 A;  2JMF A;  1F8A B;  4DRM A;  2RQS A;  5HW6 A;  2KXQ A;  2ZR6 A;  1NMV A;  1JMQ A;  1FKJ A;  2EZ5 W;  2YSB A;  4JFK A;  4JFM A;  4REX A;  2JZV A;  3O5J A;  4ODK A;  3O5G A;  4DIP A;  5HWB A;  2XP3 A;  5DIU A;  4U86 A;  2M8J A;  2PPP A;  2MLZ A;  3KZ7 A;  2ZR5 A;  2JXW A;  2PV3 A;  1M5Y A;  3TC5 A;  4LAX A;  2LAJ A;  1JNS A;  2ZQS A;  3KAI A;  3JXV A;  4DT4 A;  1Q6I A;  2OFN A;  1QZ2 A;  1FKH A;  2RUC A;  3O5Q A;  4TW8 A;  3O5P A;  1JNT A;  1FKL A;  1KT0 A;  2K8I A;  2FKE A;  1QPL A;  2RUD A;  2DG4 A;  4ITZ A;  4TW6 A;  3FAP A;  3UI6 A;  3KAF A;  2RUR A;  2PV1 A;  3IKG A;  2MLY A;  3IK8 A;  2ZQU A;  4NNR A;  5HT1 A;  1U79 A;  5I98 A;  4J4O A;  1TK7 A;  3RGC A;  3O5F A;  4TNS A;  4DZ2 A;  2YSI A;  2RE3 A;  1D7I A;  2ZQV A;  2JX8 A;  1F40 A;  2VCD A;  5B8I C;  1ZK6 A;  3GPK A;  2E45 A;  2F21 A;  2YSF A;  1EG4 A;  3IKD A;  1PIN A;  3O5D A;  1D6O A;  4JFI A;  3NI6 A;  2Q5A A;  4DRN A;  2PBC A;  4JFJ A;  5HW8 A;  5DIV A;  1P5Q A;  2Y78 A; 
#chains in the Genus database with same CATH topology
 4Z2I A;  3ALG A;  3TDB A;  2WAE A;  1ZBC A;  2KR7 A;  2UZ5 A;  3I6C A;  4ODQ A;  2L4J A;  1QPF A;  3ARU A;  4P8V A;  3KAD A;  4NSB A;  3ARY A;  1EG3 A;  3H9R B;  2IF4 A;  4QT3 A;  1PBK A;  1Y0O A;  2OWO A;  3CH9 A;  4LAW A;  4IPX A;  3M85 A;  1W9V A;  2KE0 A;  2DK1 A;  3B8S A;  3VAW A;  5HWC A;  4IT4 A;  1T11 A;  3RFW A;  2O9O A;  1NH6 A;  1KFW A;  3WD4 A;  1EYM A;  4HBE A;  3FSB A;  1ZL1 A;  1W26 A;  1E44 A;  1HJV A;  2MF9 A;  3ARW A;  1FKK A;  2MPH A;  1ITX A;  3UI5 A;  3FY1 A;  4LGX A;  2DT2 A;  4IQ2 A;  4JYS A;  4DRK A;  1W1P A;  4R0X A;  1C9H A;  4TYO A;  2AOS A;  4XAK A;  2XPB A;  4TW7 A;  1FKD A;  2D9F A;  4O2T A;  1RD6 A;  3O5I A;  4QZV B;  2XP9 A;  2PV2 A;  3O5E A;  3PA7 A;  4MSP A;  4L3N A;  5BXJ A;  2B5U B;  3ARP A;  3EY6 A;  4AY1 A;  4G2P A;  1LL7 A;  3UF8 A;  3LKX A;  1K9R A;  4PTM A;  1FKT A;  4DRQ A;  4U85 A;  3M7N A;  5DO2 A;  2MLX A;  2FAP A;  3AQU A;  5E65 A;  5E64 A;  3ARX A;  2N87 A;  4MNK A;  1L1P A;  5HUA A;  1FKG A;  1WNO A;  2KGJ A;  3UI4 A;  1OWQ A;  1ROT A;  1ZU8 A;  4KQZ A;  2O92 A;  3ART A;  2DPE A;  1NSG A;  1J4I A;  1W9U A;  4BF8 A;  2P4V A;  2F4E A;  3KCE A;  2PPO A;  4URI A;  1GOI A;  4QT2 A;  4W5U A;  4TX0 A;  1ROU A;  3UQI A;  3WD3 A;  4ODO A;  1E6P A;  2LKN A;  1HKI A;  2KFW A;  3KAB A;  2XP7 A;  3JYM A;  3WIJ A;  1FAP A;  1EHN A;  1JND A;  2LJ4 A;  2RUQ A;  3G6L A;  1D7J A;  2ZQT A;  3CZ8 A;  1NWS A;  1YW5 A;  4DWS A;  4W9Q A;  3JYJ A;  3O5L A;  2RSE A;  2G41 A;  3ARV A;  2Y8N B;  1EQ3 A;  1GPF A;  3ODK A;  5DEZ A;  1LG2 A;  4A0U A;  2EUL A;  2WM0 A;  2XP6 A;  2L2S A;  5GPG A;  4QIB A;  3O5R A;  1OGG A;  2XPA A;  4W9O A;  4DRJ A;  2MNT A;  2F2D A;  1N1A A;  2PI6 A;  2JV4 A;  2PN0 A;  1FKR A;  1J6Y A;  2FDM A;  1K9Q A;  3OOB A;  4A0T A;  2DWV A;  2DG3 A;  1D7H A;  2M1I A;  4WKA A;  2ETN A;  4J4N A;  1A7X A;  1H0G A;  2YBU A;  4WKH A;  2AWG A;  2M08 A;  2ZAJ A;  5D75 A;  4MGV A;  3NRK A;  5GQB A;  1HKM A;  2QRV A;  1LL4 A;  3UQB A;  3FSC A;  5HBF A;  1HKK A;  3L4H A;  3FS8 A;  1BL4 A;  4ZPT R;  1FKF A;  1XRV A;  3KAG A;  3O5M A;  3IHZ A;  2XP5 A;  4Q22 A;  3O5O A;  4ODN A;  1J4R A;  1TCO C;  4MNL A;  4ZS6 A;  1SR0 A;  2WK2 A;  4LAY A;  4MNM A;  1FKB A;  2KO7 A;  2BA1 A;  2F23 A;  2PPN A;  1HXV A;  1B6C A;  1H0I A;  5CQ2 A;  1E6R A;  3ARO A;  3MDY B;  5E62 A;  2XP4 A;  1WMV A;  2YSG A;  4ODM A;  3CGM A;  4ODP A;  1R9H A;  3B9A A;  3ARQ A;  2ITK A;  1W1V A;  1JCH B;  3PRD A;  4Z2J A;  4Q7N A;  3UQA A;  1W9P A;  3NTP A;  1E6Z A;  2M3O W;  4E5R A;  1I5H W;  3O5K A;  3AS3 A;  4ODL A;  4GIV A;  4W9P A;  2DT1 A;  4WJX A;  4ODR A;  1J4H A;  4IQC A;  3LKX B;  3KAH A;  4L72 B;  4WKF A;  1FFR A;  2DJY A;  4G50 A;  2YSH A;  2DG9 A;  5J6E A;  1FKS A;  3CNG A;  3LUO A;  1KT1 A;  4DRO A;  4JFL A;  3FXY A;  2DSZ A;  3PRA A;  1Q6H A;  2DK7 A;  2YAJ B;  4NZC A;  5U47 A;  1ZCN A;  5HKG A;  1TR8 A;  4N19 A;  1NMW A;  1GUV A;  1FJD A;  2G8Z A;  2LPV A;  5AHT A;  4C02 B;  3GU0 A;  2OLH A;  4P8U A;  3TCZ A;  3LE4 A;  2DMV A;  3WQW A;  1LG1 A;  3MQH A;  1XHG A;  1WR7 A;  4DZ3 A;  3WH0 A;  2VN1 A;  4DH0 A;  1VF8 A;  4U84 A;  2MDI A;  4MNJ A;  5E5W A;  3WKZ A;  4LAV A;  5DIT A;  4DWS C;  2DSW A;  1ZBK A;  3WD1 A;  4Z2H A;  3MCB A;  3CHD A;  1YAT A;  1HJX A;  3CHC A;  4DWS B;  3ALF A;  1WB0 A;  3CGN A;  1UR9 A;  2ESC A;  2A3E A;  4KR0 B;  4DWS D;  1FKI A;  3BXW A;  4Z2K A;  3B9D A;  5HTG A;  3WL1 A;  5JH8 A;  3AS2 A;  1LL6 A;  4FAP A;  1Q6U A;  2WLY A;  2IUZ A;  1RP5 A;  1TFV A;  1OGB A;  4ML4 A;  3PRB A;  1O6W A;  3KAC A;  3B7X A;  4DRI A;  2ZR4 A;  1ZBV A;  2M8I A;  2YBT A;  1FFQ A;  1FD9 A;  4DRH A;  5HW7 A;  2DSU A;  1D2K A;  1JVW A;  4ZPW R;  4ZPV R;  2KI3 A;  4GLX A;  2WAD A;  4GGQ A;  2LGO A;  1FLC A;  1Q1C A;  1BKF A;  4P8W A;  4DRP A;  2DSV A;  5GPR A;  4MAV A;  4R5E A;  2XP8 A;  2M2A A;  4FN2 A;  2JMF A;  4MTV A;  1F8A B;  4DRM A;  2RQS A;  5HW6 A;  2KXQ A;  2ZR6 A;  1IX5 A;  1NMV A;  1JMQ A;  1FKJ A;  2EZ5 W;  1K9T A;  3QOK A;  2YSB A;  4JFK A;  4JFM A;  4REX A;  2JZV A;  3O5J A;  3WD2 A;  4ODK A;  3RM4 A;  4Z2L A;  1X6L A;  3O5G A;  4DIP A;  5HWB A;  2XP3 A;  5DIU A;  3ARR A;  4U86 A;  1O6I A;  2M8J A;  2PPP A;  1LQ0 A;  3ARS A;  1SYT A;  2MLZ A;  3PR9 A;  3KZ7 A;  3WD0 A;  2ZR5 A;  2JXW A;  2PV3 A;  1M5Y A;  3TC5 A;  1EIB A;  4LAX A;  2LAJ A;  1LJY A;  3AS1 A;  1JNS A;  2ZQS A;  3CHE A;  1X6N A;  1E9L A;  4S3J A;  3KAI A;  3JXV A;  4DT4 A;  2A3A A;  1Q6I A;  2OFN A;  1QZ2 A;  3CHF A;  1WAW A;  1FKH A;  2RUC A;  3O5Q A;  4TW8 A;  3O5P A;  5E66 A;  1JNT A;  3OA5 A;  1FKL A;  1HKJ A;  1KT0 A;  2K8I A;  2FKE A;  3ARZ A;  1QPL A;  2WLZ A;  2RUD A;  2DG4 A;  4ITZ A;  3BMB A;  4IT6 A;  2DT3 A;  4TW6 A;  3FAP A;  3UI6 A;  3WL0 A;  3KAF A;  2B31 A;  4WIW A;  5DF0 A;  2RUR A;  2PV1 A;  3IKG A;  2MLY A;  2QF8 A;  2A3B A;  3G6M A;  3IK8 A;  1W1Y A;  4P8X A;  3RM8 A;  3MQG A;  3B9E A;  2ZQU A;  4NNR A;  3EIP A;  5HT1 A;  1U79 A;  5I98 A;  1W1T A;  4J4O A;  1UR8 A;  1TK7 A;  3RGC A;  3O5F A;  3WQV A;  4TNS A;  1ZBW A;  3AS0 A;  4HAR A;  2YSI A;  4DZ2 A;  2RE3 A;  1D7I A;  2ZQV A;  2JX8 A;  3MCB B;  2VCD A;  1F40 A;  1HJW A;  3RME A;  3GTY X;  1CTN A;  1E6N A;  1JNE A;  5B8I C;  3RM9 A;  4HBO A;  1ZK6 A;  3GPK A;  4Z2G A;  2E45 A;  2F21 A;  2YSF A;  1E15 A;  1EDQ A;  3PQH A;  1EG4 A;  3IKD A;  4S3K A;  1PIN A;  2DT0 A;  3O5D A;  1D6O A;  2A3C A;  4JFI A;  4WK9 A;  3NI6 A;  2Q5A A;  4DRN A;  2PBC A;  4JFJ A;  1NWT A;  1NWR A;  4UDM A;  1GRJ A;  5HW8 A;  5DIV A;  1ZB5 A;  4MPK A;  1P5Q A;  3W4R A;  2Y78 A;  1NWU A; 
#chains in the Genus database with same CATH homology
 4Z2I A;  3ALG A;  3TDB A;  2WAE A;  1ZBC A;  2KR7 A;  2UZ5 A;  3I6C A;  4ODQ A;  2L4J A;  1QPF A;  3ARU A;  4P8V A;  3KAD A;  4NSB A;  3ARY A;  1EG3 A;  3H9R B;  2IF4 A;  4QT3 A;  1PBK A;  1Y0O A;  2OWO A;  3CH9 A;  4LAW A;  4IPX A;  3M85 A;  1W9V A;  2KE0 A;  2DK1 A;  3B8S A;  3VAW A;  5HWC A;  4IT4 A;  1T11 A;  3RFW A;  2O9O A;  1NH6 A;  1KFW A;  3WD4 A;  1EYM A;  4HBE A;  3FSB A;  1ZL1 A;  1W26 A;  1HJV A;  2MF9 A;  3ARW A;  1FKK A;  2MPH A;  1ITX A;  3UI5 A;  3FY1 A;  4LGX A;  2DT2 A;  4IQ2 A;  4JYS A;  4DRK A;  1W1P A;  4R0X A;  1C9H A;  4TYO A;  2AOS A;  4XAK A;  2XPB A;  4TW7 A;  1FKD A;  2D9F A;  4O2T A;  1RD6 A;  3O5I A;  4QZV B;  2XP9 A;  2PV2 A;  3O5E A;  3PA7 A;  4MSP A;  4L3N A;  5BXJ A;  3ARP A;  3EY6 A;  4AY1 A;  4G2P A;  1LL7 A;  3UF8 A;  3LKX A;  1K9R A;  4PTM A;  1FKT A;  4DRQ A;  4U85 A;  3M7N A;  5DO2 A;  2MLX A;  2FAP A;  3AQU A;  5E65 A;  5E64 A;  3ARX A;  2N87 A;  4MNK A;  1L1P A;  5HUA A;  1FKG A;  1WNO A;  2KGJ A;  3UI4 A;  1OWQ A;  1ROT A;  1ZU8 A;  4KQZ A;  2O92 A;  3ART A;  2DPE A;  1NSG A;  1J4I A;  1W9U A;  4BF8 A;  2F4E A;  3KCE A;  2PPO A;  4URI A;  1GOI A;  4QT2 A;  4W5U A;  4TX0 A;  1ROU A;  3UQI A;  3WD3 A;  4ODO A;  1E6P A;  2LKN A;  1HKI A;  2KFW A;  3KAB A;  2XP7 A;  3JYM A;  3WIJ A;  1FAP A;  1EHN A;  1JND A;  2LJ4 A;  2RUQ A;  3G6L A;  1D7J A;  2ZQT A;  3CZ8 A;  1NWS A;  1YW5 A;  4DWS A;  4W9Q A;  3JYJ A;  3O5L A;  2RSE A;  2G41 A;  3ARV A;  2Y8N B;  1EQ3 A;  1GPF A;  3ODK A;  5DEZ A;  1LG2 A;  4A0U A;  2WM0 A;  2XP6 A;  2L2S A;  5GPG A;  4QIB A;  3O5R A;  1OGG A;  2XPA A;  4W9O A;  4DRJ A;  2MNT A;  2F2D A;  1N1A A;  2PI6 A;  2JV4 A;  1FKR A;  1J6Y A;  2FDM A;  1K9Q A;  3OOB A;  4A0T A;  2DWV A;  2DG3 A;  1D7H A;  2M1I A;  4WKA A;  4J4N A;  1A7X A;  1H0G A;  2YBU A;  4WKH A;  2AWG A;  2M08 A;  2ZAJ A;  5D75 A;  4MGV A;  3NRK A;  5GQB A;  1HKM A;  2QRV A;  1LL4 A;  3UQB A;  3FSC A;  5HBF A;  1HKK A;  3L4H A;  3FS8 A;  1BL4 A;  4ZPT R;  1FKF A;  1XRV A;  3KAG A;  3O5M A;  3IHZ A;  2XP5 A;  4Q22 A;  3O5O A;  4ODN A;  1J4R A;  1TCO C;  4MNL A;  4ZS6 A;  1SR0 A;  2WK2 A;  4LAY A;  4MNM A;  1FKB A;  2KO7 A;  2BA1 A;  2PPN A;  1HXV A;  1B6C A;  1H0I A;  5CQ2 A;  1E6R A;  3ARO A;  3MDY B;  5E62 A;  2XP4 A;  1WMV A;  2YSG A;  4ODM A;  3CGM A;  4ODP A;  1R9H A;  3B9A A;  3ARQ A;  2ITK A;  1W1V A;  3PRD A;  4Z2J A;  4Q7N A;  3UQA A;  1W9P A;  3NTP A;  1E6Z A;  2M3O W;  4E5R A;  1I5H W;  3O5K A;  3AS3 A;  4ODL A;  4GIV A;  4W9P A;  2DT1 A;  4WJX A;  4ODR A;  1J4H A;  4IQC A;  3LKX B;  3KAH A;  4L72 B;  4WKF A;  1FFR A;  2DJY A;  4G50 A;  2YSH A;  2DG9 A;  5J6E A;  1FKS A;  3CNG A;  3LUO A;  1KT1 A;  4DRO A;  4JFL A;  3FXY A;  2DSZ A;  3PRA A;  1Q6H A;  2DK7 A;  2YAJ B;  4NZC A;  5U47 A;  1ZCN A;  5HKG A;  1TR8 A;  4N19 A;  1NMW A;  1GUV A;  1FJD A;  2G8Z A;  2LPV A;  5AHT A;  4C02 B;  2OLH A;  4P8U A;  3TCZ A;  3LE4 A;  2DMV A;  3WQW A;  1LG1 A;  3MQH A;  1XHG A;  1WR7 A;  4DZ3 A;  3WH0 A;  2VN1 A;  4DH0 A;  1VF8 A;  4U84 A;  2MDI A;  4MNJ A;  5E5W A;  3WKZ A;  4LAV A;  5DIT A;  4DWS C;  2DSW A;  1ZBK A;  3WD1 A;  4Z2H A;  3MCB A;  3CHD A;  1YAT A;  1HJX A;  3CHC A;  4DWS B;  3ALF A;  1WB0 A;  3CGN A;  1UR9 A;  2ESC A;  2A3E A;  4KR0 B;  4DWS D;  1FKI A;  3BXW A;  4Z2K A;  3B9D A;  5HTG A;  3WL1 A;  5JH8 A;  3AS2 A;  1LL6 A;  4FAP A;  1Q6U A;  2WLY A;  2IUZ A;  1RP5 A;  1TFV A;  1OGB A;  4ML4 A;  3PRB A;  1O6W A;  3KAC A;  3B7X A;  4DRI A;  2ZR4 A;  1ZBV A;  2M8I A;  2YBT A;  1FFQ A;  1FD9 A;  4DRH A;  5HW7 A;  2DSU A;  1D2K A;  1JVW A;  4ZPW R;  4ZPV R;  2KI3 A;  4GLX A;  2WAD A;  4GGQ A;  2LGO A;  1FLC A;  1Q1C A;  1BKF A;  4P8W A;  4DRP A;  2DSV A;  5GPR A;  4MAV A;  4R5E A;  2XP8 A;  2M2A A;  4FN2 A;  2JMF A;  4MTV A;  1F8A B;  4DRM A;  2RQS A;  5HW6 A;  2KXQ A;  2ZR6 A;  1IX5 A;  1NMV A;  1JMQ A;  1FKJ A;  2EZ5 W;  1K9T A;  3QOK A;  2YSB A;  4JFK A;  4JFM A;  4REX A;  2JZV A;  3O5J A;  3WD2 A;  4ODK A;  3RM4 A;  4Z2L A;  1X6L A;  3O5G A;  4DIP A;  5HWB A;  2XP3 A;  5DIU A;  3ARR A;  4U86 A;  1O6I A;  2M8J A;  2PPP A;  1LQ0 A;  3ARS A;  1SYT A;  2MLZ A;  3PR9 A;  3KZ7 A;  3WD0 A;  2ZR5 A;  2JXW A;  2PV3 A;  1M5Y A;  3TC5 A;  1EIB A;  4LAX A;  2LAJ A;  1LJY A;  3AS1 A;  1JNS A;  2ZQS A;  3CHE A;  1X6N A;  1E9L A;  4S3J A;  3KAI A;  3JXV A;  4DT4 A;  2A3A A;  1Q6I A;  2OFN A;  1QZ2 A;  3CHF A;  1WAW A;  1FKH A;  2RUC A;  3O5Q A;  4TW8 A;  3O5P A;  5E66 A;  1JNT A;  3OA5 A;  1FKL A;  1HKJ A;  1KT0 A;  2K8I A;  2FKE A;  3ARZ A;  1QPL A;  2WLZ A;  2RUD A;  2DG4 A;  4ITZ A;  4IT6 A;  2DT3 A;  4TW6 A;  3FAP A;  3UI6 A;  3WL0 A;  3KAF A;  2B31 A;  4WIW A;  5DF0 A;  2RUR A;  2PV1 A;  3IKG A;  2MLY A;  2QF8 A;  2A3B A;  3G6M A;  3IK8 A;  1W1Y A;  4P8X A;  3RM8 A;  3MQG A;  3B9E A;  2ZQU A;  4NNR A;  5HT1 A;  1U79 A;  5I98 A;  1W1T A;  4J4O A;  1UR8 A;  1TK7 A;  3RGC A;  3O5F A;  3WQV A;  4TNS A;  1ZBW A;  3AS0 A;  4HAR A;  2YSI A;  4DZ2 A;  2RE3 A;  1D7I A;  2ZQV A;  2JX8 A;  3MCB B;  2VCD A;  1F40 A;  1HJW A;  3RME A;  1CTN A;  1E6N A;  1JNE A;  5B8I C;  3RM9 A;  4HBO A;  1ZK6 A;  3GPK A;  4Z2G A;  2E45 A;  2F21 A;  2YSF A;  1E15 A;  1EDQ A;  3PQH A;  1EG4 A;  3IKD A;  4S3K A;  1PIN A;  2DT0 A;  3O5D A;  1D6O A;  2A3C A;  4JFI A;  4WK9 A;  3NI6 A;  2Q5A A;  4DRN A;  2PBC A;  4JFJ A;  1NWT A;  1NWR A;  5HW8 A;  5DIV A;  1ZB5 A;  4MPK A;  1P5Q A;  3W4R A;  2Y78 A;  1NWU A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...