3ODKA

Discovery of cell-active phenyl-imidazole pin1 inhibitors by structure-guided fragment evolution
Total Genus 42
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
42
sequence length
157
structure length
145
Chain Sequence
LPPGWEKAMSRSSGRVYYFNHITNASQWERPSEPARVRCSHLLVKHSQSRRPSSWRQEKITRTKEEALELINGYIQKIKSGEEDFESLASQFSDCSSAKARGDLGAFSRGQMQKPFEDASFALRTGEMSGPVFTDSGIHIILRTE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Peptidyl-prolyl cis-trans isomerase NIMA-interacting 1
publication title Discovery of cell-active phenyl-imidazole Pin1 inhibitors by structure-guided fragment evolution.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Isomerase
total genus 42
structure length 145
sequence length 157
ec nomenclature ec 5.2.1.8: Peptidylprolyl isomerase.
pdb deposition date 2010-08-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00397 WW WW domain
A PF00639 Rotamase PPIC-type PPIASE domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.20.70.10 Mainly Beta Single Sheet Ubiquitin Ligase Nedd4; Chain: W; Ubiquitin Ligase Nedd4; Chain: W; 3odkA01
3.10.50.40 Alpha Beta Roll Chitinase A; domain 3 Chitinase A; domain 3 3odkA02
3EY6A 1FKGA 3NRKA 1R9HA 5AHTA 5DIUA 1YW5A 4LAWA 1ZK6A 3MDYB 3H9RB 4MGVA 1I5HW 3M7NA 3M85A 1WMVA 2YSIA 4DH0A 3KCEA 2OFNA 4DRQA 1W26A 3FAPA 1FKIA 5I98A 4TNSA 5HWBA 1D6OA 1ROUA 4N19A 2RSEA 2N87A 1WR7A 1C9HA 3IHZA 3KABA 1J4RA 2KR7A 2LGOA 2ZQUA 4LAYA 3O5IA 4GIVA 3RFWA 2PPPA 2VN1A 2KFWA 2YSGA 2VCDA 2DG4A 3KAGA 4JFKA 2BA1A 4TW8A 1QPFA 3O5QA 1FKRA 4DRMA 2MDIA 3NI6A 1A7XA 1ROTA 2LJ4A 3O5RA 2AWGA 3IKDA 2PV3A 3PA7A 4TX0A 2LAJA 5DITA 2ITKA 1U79A 3JYMA 4DZ3A 4FAPA 3L4HA 4IPXA 1D7HA 3IKGA 2XPAA 3KAHA 2XP5A 3NTPA 1PINA 4U85A 2JV4A 3UQBA 4ODMA 2RUQA 2DG9A 2XP9A 3UQIA 5B8IC 4MSPA 4J4NA 2PV2A 2Y78A 1EYMA 2F2DA 4W9PA 1N1AA 5HW7A 4GGQA 2PV1A 2L2SA 4ODRA 1TK7A 3I6CA 5HKGA 1Q6IA 3RGCA 1K9RA 4LAVA 4ITZA 3O5LA 3CNGA 3KZ7A 2XP6A 1QPLA 3OOBA 1FD9A 1BL4A 4IQCA 4ODKA 4LAXA 4ODQA 3LE4A 3O5PA 3JYJA 4QIBA 3GPKA 2DMVA 5HW6A 4QT3A 2ZQSA 5HWCA 4JFMA 3CGNA 2UZ5A 4REXA 1Y0OA 3UI5A 1O6WA 2KI3A 1FAPA 4DROA 2M08A 3VAWA 2M3OW 5HT1A 1JMQA 2XPBA 2MLYA 4ODPA 2MLZA 3TCZA 2RUDA 2MF9A 2M2AA 1FKJA 4IQ2A 2LKNA 3PRBA 2DG3A 3KAFA 2JZVA 4JYSA 4ODNA 1PBKA 2L4JA 2ZAJA 4JFLA 2MLXA 4O2TA 2YSHA 4DRNA 5GPGA 3WH0A 1D7IA 1JNTA 4U84A 3O5JA 3UI4A 4R0XA 3LUOA 2LPVA 4C02B 1F8AB 2DK7A 4DIPA 2FAPA 3TC5A 1Q6UA 5J6EA 2ZR6A 3CGMA 3ODKA 3O5EA 4W9OA 5CQ2A 3KAIA 3UI6A 1FKSA 2DWVA 2MPHA 2KE0A 4TW7A 3TDBA 3JXVA 2KXQA 2XP3A 1FKTA 2ZR4A 4QT2A 2D9FA 4G2PA 1Q1CA 1FJDA 2PBCA 5D75A 3IK8A 1NMVA 2DK1A 1FKHA 4ODLA 1B6CA 1L1PA 1M5YA 2XP8A 2ZQTA 4JFIA 3UF8A 3O5KA 3O5FA 2DJYA 2Q5AA 3UQAA 2FKEA 2JXWA 2M8IA 2RE3A 1F40A 3KADA 4W9QA 2JMFA 1J4IA 2ZR5A 3O5GA 5HW8A 4DZ2A 5HUAA 4DRIA 4U86A 2M1IA 1T11A 1ZCNA 2RURA 4DRKA 1EQ3A 2ZQVA 4DRJA 2YSFA 1Q6HA 1K9QA 2IF4A 2YSBA 4TYOA 3O5DA 4ODOA 3PRDA 1FKBA 1D7JA 1P5QA 4BF8A 2PPNA 1FKKA 1EG3A 2PPOA 1QZ2A 2F21A 3O5OA 1NMWA 4FN2A 2KO7A 2RQSA 4DRPA 2KGJA 1JVWA 2XP7A 5HTGA 1JNSA 1KT0A 1FKLA 1FKFA 1TCOC 4TW6A 4JFJA 1BKFA 2K8IA 2RUCA 1EG4A 1J4HA 1NSGA 1J6YA 5DIVA 4NNRA 2F4EA 4J4OA 1YATA 2M8JA 4DRHA 2JX8A 4DT4A 3O5MA 2EZ5W 4E5RA 2XP4A 5BXJA 3KACA 1KT1A 1HXVA 2E45A 2MNTA 4G50A 1FKDA 3B7XA
chains in the Genus database with same CATH superfamily
1LL7A 3ARXA 2DT0A 3EY6A 1FKGA 1W1TA 3CZ8A 3CH9A 3NRKA 1R9HA 3W4RA 5AHTA 1JNDA 4Z2IA 4Z2KA 4Z2GA 1GOIA 4WIWA 5DIUA 1E6PA 1YW5A 4LAWA 1W9VA 1HKKA 4HARA 1UR8A 1ZK6A 3MDYB 4GLXA 3H9RB 4S3KA 4MGVA 4Z2JA 1NWUA 4DWSD 3WIJA 1I5HW 2Y8NB 2OWOA 3M7NA 3M85A 1WMVA 2YSIA 4LGXA 4DH0A 3KCEA 2A3CA 1CTNA 1D2KA 2OFNA 1SYTA 1W1YA 2WLYA 4DRQA 4DWSB 1W26A 3FAPA 3AROA 2DPEA 1FKIA 2YBUA 5I98A 4TNSA 1W9PA 5HWBA 1D6OA 1ROUA 4N19A 2RSEA 2N87A 1WR7A 2G8ZA 1C9HA 3IHZA 5E5WA 2DSUA 3ARVA 4UDMA 3AQUA 3KABA 1J4RA 2KR7A 1NWSA 1ZU8A 3B9AA 4Q7NA 2LGOA 2ZQUA 4LAYA 3RM8A 3O5IA 4GIVA 3RFWA 1RP5A 3G6MA 3WD2A 2PPPA 2VN1A 2DT2A 2KFWA 2YSGA 2P4VA 2VCDA 2DG4A 2DSWA 3KAGA 3AS1A 2YBTA 4URIA 3B9DA 4ZPVR 3MQHA 3ARUA 5JH8A 1IX5A 4JFKA 2BA1A 1X6NA 4P8VA 3EIPA 3PR9A 4TW8A 5U47A 1QPFA 3O5QA 1FKRA 4MNKA 3GU0A 1HJVA 4DRMA 1WAWA 2MDIA 3NI6A 1A7XA 1ROTA 2LJ4A 3O5RA 1RD6A 2AWGA 3IKDA 4XAKA 2PV3A 3PA7A 1OGGA 1LG1A 4TX0A 1E6RA 2LAJA 5E62A 5DITA 2ITKA 3GTYX 1U79A 3JYMA 2DT3A 4DZ3A 4FAPA 3L4HA 4IPXA 1HKMA 1D7HA 1LJYA 3IKGA 1NWRA 2XPAA 3KAHA 2XP5A 3NTPA 1OWQA 4Z2LA 1PINA 4U85A 2JV4A 1GUVA 3UQBA 4ODMA 2RUQA 2DG9A 2XP9A 3UQIA 5B8IC 1TR8A 4NSBA 3BMBA 4MSPA 4J4NA 2PV2A 4KQZA 2Y78A 1EYMA 1VF8A 2F2DA 4W9PA 1N1AA 5HW7A 4GGQA 3CHFA 2PV1A 2L2SA 1E6NA 4ODRA 1ZL1A 1ITXA 3AS3A 3ALFA 4S3JA 1TK7A 3I6CA 5HKGA 1Q6IA 1H0GA 1NH6A 1XHGA 1K9RA 2YAJB 4LAVA 1WB0A 4W5UA 4ITZA 3O5LA 3RGCA 3CNGA 4WJXA 1JNEA 3KZ7A 2XP6A 1QPLA 5GPRA 3WD1A 3ARYA 3OOBA 1FD9A 2A3EA 1BL4A 1ZBWA 4IQCA 3FXYA 4WKHA 4ODKA 1NWTA 4LAXA 3WD0A 4ODQA 1JCHB 3LE4A 1SR0A 1WNOA 3O5PA 3JYJA 2EULA 4QIBA 4Q22A 3MCBA 4MAVA 5DEZA 3GPKA 2DMVA 3PQHA 5HW6A 1EHNA 4QT3A 2ZQSA 1XRVA 5HWCA 4JFMA 3CGNA 2UZ5A 3ARTA 2DT1A 3FSBA 1FLCA 4REXA 1Y0OA 3UI5A 4HBEA 2WADA 1O6WA 2KI3A 1FAPA 4NZCA 4DROA 2M08A 3VAWA 1ZBVA 3LKXA 4QZVB 2M3OW 3CHEA 5HT1A 1JMQA 3WD4A 2XPBA 2MLYA 1EDQA 4ODPA 1W1VA 2B5UB 3WL1A 4DWSC 2MLZA 4IT6A 3TCZA 1ZBKA 2RUDA 2MF9A 2F23A 2M2AA 1FKJA 4IQ2A 2LKNA 3PRBA 4P8UA 4A0TA 2DG3A 1GPFA 3KAFA 2JZVA 4JYSA 4ODNA 1PBKA 2L4JA 2WAEA 2ZAJA 4JFLA 2MLXA 4O2TA 2YSHA 4DRNA 1O6IA 2PN0A 2AOSA 5GPGA 2OLHA 3WH0A 2A3BA 4MNLA 1D7IA 4WK9A 1JNTA 4U84A 3O5JA 1TFVA 2PI6A 3UI4A 3WQWA 3ARQA 4R0XA 3LUOA 2LPVA 2DSZA 4C02B 3AS2A 3WKZA 1F8AB 3RMEA 3CHDA 2DK7A 4DIPA 2FAPA 3TC5A 1Q6UA 5J6EA 3ARWA 2ZR6A 3CGMA 3ODKA 2IUZA 3O5EA 4W9OA 3FSCA 5CQ2A 3KAIA 1ZB5A 3UI6A 1FKSA 3WD3A 2DWVA 1LQ0A 2MPHA 1HJWA 5E65A 2KE0A 4TW7A 3MCBB 4ZS6A 3RM9A 3TDBA 3ARSA 3JXVA 1H0IA 2QF8A 2KXQA 2XP3A 3MQGA 1FKTA 4PTMA 3ALGA 2ZR4A 4QT2A 1FFRA 2ETNA 2D9FA 4MTVA 1GRJA 4G2PA 1Q1CA 1FJDA 2PBCA 4AY1A 5D75A 1W9UA 3IK8A 1NMVA 2DK1A 3LKXB 1FKHA 2G41A 4ODLA 1B6CA 3CHCA 1L1PA 1M5YA 1FFQA 2XP8A 2ZQTA 4JFIA 4KR0B 3UF8A 3O5KA 3O5FA 2DJYA 2Q5AA 3UQAA 2FKEA 4L3NA 5E66A 2JXWA 2O92A 3ARPA 5E64A 4HBOA 1X6LA 2M8IA 1K9TA 4L72B 2RE3A 1F40A 1E6ZA 2FDMA 2WLZA 3BXWA 3KADA 4P8WA 1LG2A 3FY1A 4W9QA 3ARZA 2JMFA 3ARRA 3AS0A 1J4IA 2ZR5A 3O5GA 5HW8A 4DZ2A 5HUAA 4IT4A 4DRIA 5GQBA 4U86A 2M1IA 3WQVA 1T11A 5HBFA 4MPKA 4ZPWR 1ZCNA 4A0UA 4ZPTR 2RURA 4DRKA 4ML4A 1EQ3A 2ZQVA 4DRJA 2YSFA 1Q6HA 3FS8A 2QRVA 2B31A 1K9QA 5DO2A 2IF4A 2YSBA 2DSVA 4TYOA 4WKFA 1W1PA 3O5DA 2WK2A 1KFWA 3PRDA 4ODOA 1FKBA 3OA5A 3G6LA 1D7JA 1P5QA 4BF8A 2PPNA 1FKKA 1HKJA 1EG3A 2ESCA 2PPOA 1E44A 1OGBA 1QZ2A 3B9EA 4DWSA 1EIBA 2F21A 3O5OA 1UR9A 5DF0A 3RM4A 1NMWA 4FN2A 2KO7A 2RQSA 2WM0A 4DRPA 2KGJA 1JVWA 3B8SA 1E15A 1HJXA 2XP7A 5HTGA 1JNSA 1KT0A 2A3AA 1FKLA 4WKAA 1FKFA 1HKIA 1ZBCA 1TCOC 4TW6A 4JFJA 1BKFA 2K8IA 4MNMA 3QOKA 2RUCA 1EG4A 1J4HA 1NSGA 1J6YA 5DIVA 4NNRA 2F4EA 4J4OA 1LL6A 1YATA 3WL0A 2M8JA 4DRHA 4P8XA 4MNJA 2JX8A 4DT4A 1E9LA 3O5MA 2EZ5W 4E5RA 2XP4A 3PRAA 5BXJA 4Z2HA 3KACA 1LL4A 1KT1A 1HXVA 2O9OA 2E45A 2MNTA 4R5EA 4G50A 1FKDA 3B7XA
chains in the Genus database with same CATH topology
1LL7A 3ARXA 2DT0A 3EY6A 1FKGA 1W1TA 3CZ8A 3CH9A 3NRKA 1R9HA 3W4RA 5AHTA 1JNDA 4Z2IA 4Z2KA 4Z2GA 1GOIA 4WIWA 5DIUA 1E6PA 1YW5A 4LAWA 1W9VA 1HKKA 4HARA 1UR8A 1ZK6A 3MDYB 4GLXA 3H9RB 4S3KA 4MGVA 4Z2JA 1NWUA 4DWSD 3WIJA 1I5HW 2Y8NB 2OWOA 3M7NA 3M85A 1WMVA 2YSIA 4LGXA 4DH0A 3KCEA 2A3CA 1CTNA 1D2KA 2OFNA 1SYTA 1W1YA 2WLYA 4DRQA 4DWSB 1W26A 3FAPA 3AROA 2DPEA 1FKIA 2YBUA 5I98A 4TNSA 1W9PA 5HWBA 1D6OA 1ROUA 4N19A 2RSEA 2N87A 1WR7A 2G8ZA 1C9HA 3IHZA 5E5WA 2DSUA 3ARVA 3AQUA 3KABA 1J4RA 2KR7A 1NWSA 1ZU8A 3B9AA 4Q7NA 2LGOA 2ZQUA 4LAYA 3RM8A 3O5IA 4GIVA 3RFWA 1RP5A 3G6MA 3WD2A 2PPPA 2VN1A 2DT2A 2KFWA 2YSGA 2VCDA 2DG4A 2DSWA 3KAGA 3AS1A 2YBTA 4URIA 3B9DA 4ZPVR 3MQHA 3ARUA 5JH8A 1IX5A 4JFKA 2BA1A 1X6NA 4P8VA 3PR9A 4TW8A 5U47A 1QPFA 3O5QA 1FKRA 4MNKA 1HJVA 4DRMA 1WAWA 2MDIA 3NI6A 1A7XA 1ROTA 2LJ4A 3O5RA 1RD6A 2AWGA 3IKDA 4XAKA 2PV3A 3PA7A 1OGGA 1LG1A 4TX0A 1E6RA 2LAJA 5E62A 5DITA 2ITKA 1U79A 3JYMA 2DT3A 4DZ3A 4FAPA 3L4HA 4IPXA 1HKMA 1D7HA 1LJYA 3IKGA 1NWRA 2XPAA 3KAHA 2XP5A 3NTPA 1OWQA 4Z2LA 1PINA 4U85A 2JV4A 1GUVA 3UQBA 4ODMA 2RUQA 2DG9A 2XP9A 3UQIA 5B8IC 1TR8A 4NSBA 4MSPA 4J4NA 2PV2A 4KQZA 2Y78A 1EYMA 1VF8A 2F2DA 4W9PA 1N1AA 5HW7A 4GGQA 3CHFA 2PV1A 2L2SA 1E6NA 4ODRA 1ZL1A 1ITXA 3AS3A 3ALFA 4S3JA 1TK7A 3I6CA 5HKGA 1Q6IA 1H0GA 1NH6A 1XHGA 1K9RA 2YAJB 4LAVA 1WB0A 4W5UA 4ITZA 3O5LA 3RGCA 3CNGA 4WJXA 1JNEA 3KZ7A 2XP6A 1QPLA 5GPRA 3WD1A 3ARYA 3OOBA 1FD9A 2A3EA 1BL4A 1ZBWA 4IQCA 3FXYA 4WKHA 4ODKA 1NWTA 4LAXA 3WD0A 4ODQA 3LE4A 1SR0A 1WNOA 3O5PA 3JYJA 4QIBA 4Q22A 3MCBA 4MAVA 5DEZA 3GPKA 2DMVA 3PQHA 5HW6A 1EHNA 4QT3A 2ZQSA 1XRVA 5HWCA 4JFMA 3CGNA 2UZ5A 3ARTA 2DT1A 3FSBA 1FLCA 4REXA 1Y0OA 3UI5A 4HBEA 2WADA 1O6WA 2KI3A 1FAPA 4NZCA 4DROA 2M08A 3VAWA 1ZBVA 3LKXA 4QZVB 2M3OW 3CHEA 5HT1A 1JMQA 3WD4A 2XPBA 2MLYA 1EDQA 4ODPA 1W1VA 3WL1A 4DWSC 2MLZA 4IT6A 3TCZA 1ZBKA 2RUDA 2MF9A 2M2AA 1FKJA 4IQ2A 2LKNA 3PRBA 4P8UA 4A0TA 2DG3A 1GPFA 3KAFA 2JZVA 4JYSA 4ODNA 1PBKA 2L4JA 2WAEA 2ZAJA 4JFLA 2MLXA 4O2TA 2YSHA 4DRNA 1O6IA 2AOSA 5GPGA 2OLHA 3WH0A 2A3BA 4MNLA 1D7IA 4WK9A 1JNTA 4U84A 3O5JA 1TFVA 2PI6A 3UI4A 3WQWA 3ARQA 4R0XA 3LUOA 2LPVA 2DSZA 4C02B 3AS2A 3WKZA 1F8AB 3RMEA 3CHDA 2DK7A 4DIPA 2FAPA 3TC5A 1Q6UA 5J6EA 3ARWA 2ZR6A 3CGMA 3ODKA 2IUZA 3O5EA 4W9OA 3FSCA 5CQ2A 3KAIA 1ZB5A 3UI6A 1FKSA 3WD3A 2DWVA 1LQ0A 2MPHA 1HJWA 5E65A 2KE0A 4TW7A 3MCBB 4ZS6A 3RM9A 3TDBA 3ARSA 3JXVA 1H0IA 2QF8A 2KXQA 2XP3A 3MQGA 1FKTA 4PTMA 3ALGA 2ZR4A 4QT2A 1FFRA 2D9FA 4MTVA 4G2PA 1Q1CA 1FJDA 2PBCA 4AY1A 5D75A 1W9UA 3IK8A 1NMVA 2DK1A 3LKXB 1FKHA 2G41A 4ODLA 1B6CA 3CHCA 1L1PA 1M5YA 1FFQA 2XP8A 2ZQTA 4JFIA 4KR0B 3UF8A 3O5KA 3O5FA 2DJYA 2Q5AA 3UQAA 2FKEA 4L3NA 5E66A 2JXWA 2O92A 3ARPA 5E64A 4HBOA 1X6LA 2M8IA 1K9TA 4L72B 2RE3A 1F40A 1E6ZA 2FDMA 2WLZA 3BXWA 3KADA 4P8WA 1LG2A 3FY1A 4W9QA 3ARZA 2JMFA 3ARRA 3AS0A 1J4IA 2ZR5A 3O5GA 5HW8A 4DZ2A 5HUAA 4IT4A 4DRIA 5GQBA 4U86A 2M1IA 3WQVA 1T11A 5HBFA 4MPKA 4ZPWR 1ZCNA 4A0UA 4ZPTR 2RURA 4DRKA 4ML4A 1EQ3A 2ZQVA 4DRJA 2YSFA 1Q6HA 3FS8A 2QRVA 2B31A 1K9QA 5DO2A 2IF4A 2YSBA 2DSVA 4TYOA 4WKFA 1W1PA 3O5DA 2WK2A 1KFWA 3PRDA 4ODOA 1FKBA 3OA5A 3G6LA 1D7JA 1P5QA 4BF8A 2PPNA 1FKKA 1HKJA 1EG3A 2ESCA 2PPOA 1OGBA 1QZ2A 3B9EA 4DWSA 1EIBA 2F21A 3O5OA 1UR9A 5DF0A 3RM4A 1NMWA 4FN2A 2KO7A 2RQSA 2WM0A 4DRPA 2KGJA 1JVWA 3B8SA 1E15A 1HJXA 2XP7A 5HTGA 1JNSA 1KT0A 2A3AA 1FKLA 4WKAA 1FKFA 1HKIA 1ZBCA 1TCOC 4TW6A 4JFJA 1BKFA 2K8IA 4MNMA 3QOKA 2RUCA 1EG4A 1J4HA 1NSGA 1J6YA 5DIVA 4NNRA 2F4EA 4J4OA 1LL6A 1YATA 3WL0A 2M8JA 4DRHA 4P8XA 4MNJA 2JX8A 4DT4A 1E9LA 3O5MA 2EZ5W 4E5RA 2XP4A 3PRAA 5BXJA 4Z2HA 3KACA 1LL4A 1KT1A 1HXVA 2O9OA 2E45A 2MNTA 4R5EA 4G50A 1FKDA 3B7XA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3EY6 A;  1FKG A;  3NRK A;  1R9H A;  5AHT A;  5DIU A;  1YW5 A;  4LAW A;  1ZK6 A;  3MDY B;  3H9R B;  4MGV A;  1I5H W;  3M7N A;  3M85 A;  1WMV A;  2YSI A;  4DH0 A;  3KCE A;  2OFN A;  4DRQ A;  1W26 A;  3FAP A;  1FKI A;  5I98 A;  4TNS A;  5HWB A;  1D6O A;  1ROU A;  4N19 A;  2RSE A;  2N87 A;  1WR7 A;  1C9H A;  3IHZ A;  3KAB A;  1J4R A;  2KR7 A;  2LGO A;  2ZQU A;  4LAY A;  3O5I A;  4GIV A;  3RFW A;  2PPP A;  2VN1 A;  2KFW A;  2YSG A;  2VCD A;  2DG4 A;  3KAG A;  4JFK A;  2BA1 A;  4TW8 A;  1QPF A;  3O5Q A;  1FKR A;  4DRM A;  2MDI A;  3NI6 A;  1A7X A;  1ROT A;  2LJ4 A;  3O5R A;  2AWG A;  3IKD A;  2PV3 A;  3PA7 A;  4TX0 A;  2LAJ A;  5DIT A;  2ITK A;  1U79 A;  3JYM A;  4DZ3 A;  4FAP A;  3L4H A;  4IPX A;  1D7H A;  3IKG A;  2XPA A;  3KAH A;  2XP5 A;  3NTP A;  1PIN A;  4U85 A;  2JV4 A;  3UQB A;  4ODM A;  2RUQ A;  2DG9 A;  2XP9 A;  3UQI A;  5B8I C;  4MSP A;  4J4N A;  2PV2 A;  2Y78 A;  1EYM A;  2F2D A;  4W9P A;  1N1A A;  5HW7 A;  4GGQ A;  2PV1 A;  2L2S A;  4ODR A;  1TK7 A;  3I6C A;  5HKG A;  1Q6I A;  3RGC A;  1K9R A;  4LAV A;  4ITZ A;  3O5L A;  3CNG A;  3KZ7 A;  2XP6 A;  1QPL A;  3OOB A;  1FD9 A;  1BL4 A;  4IQC A;  4ODK A;  4LAX A;  4ODQ A;  3LE4 A;  3O5P A;  3JYJ A;  4QIB A;  3GPK A;  2DMV A;  5HW6 A;  4QT3 A;  2ZQS A;  5HWC A;  4JFM A;  3CGN A;  2UZ5 A;  4REX A;  1Y0O A;  3UI5 A;  1O6W A;  2KI3 A;  1FAP A;  4DRO A;  2M08 A;  3VAW A;  2M3O W;  5HT1 A;  1JMQ A;  2XPB A;  2MLY A;  4ODP A;  2MLZ A;  3TCZ A;  2RUD A;  2MF9 A;  2M2A A;  1FKJ A;  4IQ2 A;  2LKN A;  3PRB A;  2DG3 A;  3KAF A;  2JZV A;  4JYS A;  4ODN A;  1PBK A;  2L4J A;  2ZAJ A;  4JFL A;  2MLX A;  4O2T A;  2YSH A;  4DRN A;  5GPG A;  3WH0 A;  1D7I A;  1JNT A;  4U84 A;  3O5J A;  3UI4 A;  4R0X A;  3LUO A;  2LPV A;  4C02 B;  1F8A B;  2DK7 A;  4DIP A;  2FAP A;  3TC5 A;  1Q6U A;  5J6E A;  2ZR6 A;  3CGM A;  3ODK A;  3O5E A;  4W9O A;  5CQ2 A;  3KAI A;  3UI6 A;  1FKS A;  2DWV A;  2MPH A;  2KE0 A;  4TW7 A;  3TDB A;  3JXV A;  2KXQ A;  2XP3 A;  1FKT A;  2ZR4 A;  4QT2 A;  2D9F A;  4G2P A;  1Q1C A;  1FJD A;  2PBC A;  5D75 A;  3IK8 A;  1NMV A;  2DK1 A;  1FKH A;  4ODL A;  1B6C A;  1L1P A;  1M5Y A;  2XP8 A;  2ZQT A;  4JFI A;  3UF8 A;  3O5K A;  3O5F A;  2DJY A;  2Q5A A;  3UQA A;  2FKE A;  2JXW A;  2M8I A;  2RE3 A;  1F40 A;  3KAD A;  4W9Q A;  2JMF A;  1J4I A;  2ZR5 A;  3O5G A;  5HW8 A;  4DZ2 A;  5HUA A;  4DRI A;  4U86 A;  2M1I A;  1T11 A;  1ZCN A;  2RUR A;  4DRK A;  1EQ3 A;  2ZQV A;  4DRJ A;  2YSF A;  1Q6H A;  1K9Q A;  2IF4 A;  2YSB A;  4TYO A;  3O5D A;  4ODO A;  3PRD A;  1FKB A;  1D7J A;  1P5Q A;  4BF8 A;  2PPN A;  1FKK A;  1EG3 A;  2PPO A;  1QZ2 A;  2F21 A;  3O5O A;  1NMW A;  4FN2 A;  2KO7 A;  2RQS A;  4DRP A;  2KGJ A;  1JVW A;  2XP7 A;  5HTG A;  1JNS A;  1KT0 A;  1FKL A;  1FKF A;  1TCO C;  4TW6 A;  4JFJ A;  1BKF A;  2K8I A;  2RUC A;  1EG4 A;  1J4H A;  1NSG A;  1J6Y A;  5DIV A;  4NNR A;  2F4E A;  4J4O A;  1YAT A;  2M8J A;  4DRH A;  2JX8 A;  4DT4 A;  3O5M A;  2EZ5 W;  4E5R A;  2XP4 A;  5BXJ A;  3KAC A;  1KT1 A;  1HXV A;  2E45 A;  2MNT A;  4G50 A;  1FKD A;  3B7X A; 
#chains in the Genus database with same CATH topology
 1LL7 A;  3ARX A;  2DT0 A;  3EY6 A;  1FKG A;  1W1T A;  3CZ8 A;  3CH9 A;  3NRK A;  1R9H A;  3W4R A;  5AHT A;  1JND A;  4Z2I A;  4Z2K A;  4Z2G A;  1GOI A;  4WIW A;  5DIU A;  1E6P A;  1YW5 A;  4LAW A;  1W9V A;  1HKK A;  4HAR A;  1UR8 A;  1ZK6 A;  3MDY B;  4GLX A;  3H9R B;  4S3K A;  4MGV A;  4Z2J A;  1NWU A;  4DWS D;  3WIJ A;  1I5H W;  2Y8N B;  2OWO A;  3M7N A;  3M85 A;  1WMV A;  2YSI A;  4LGX A;  4DH0 A;  3KCE A;  2A3C A;  1CTN A;  1D2K A;  2OFN A;  1SYT A;  1W1Y A;  2WLY A;  4DRQ A;  4DWS B;  1W26 A;  3FAP A;  3ARO A;  2DPE A;  1FKI A;  2YBU A;  5I98 A;  4TNS A;  1W9P A;  5HWB A;  1D6O A;  1ROU A;  4N19 A;  2RSE A;  2N87 A;  1WR7 A;  2G8Z A;  1C9H A;  3IHZ A;  5E5W A;  2DSU A;  3ARV A;  4UDM A;  3AQU A;  3KAB A;  1J4R A;  2KR7 A;  1NWS A;  1ZU8 A;  3B9A A;  4Q7N A;  2LGO A;  2ZQU A;  4LAY A;  3RM8 A;  3O5I A;  4GIV A;  3RFW A;  1RP5 A;  3G6M A;  3WD2 A;  2PPP A;  2VN1 A;  2DT2 A;  2KFW A;  2YSG A;  2P4V A;  2VCD A;  2DG4 A;  2DSW A;  3KAG A;  3AS1 A;  2YBT A;  4URI A;  3B9D A;  4ZPV R;  3MQH A;  3ARU A;  5JH8 A;  1IX5 A;  4JFK A;  2BA1 A;  1X6N A;  4P8V A;  3EIP A;  3PR9 A;  4TW8 A;  5U47 A;  1QPF A;  3O5Q A;  1FKR A;  4MNK A;  3GU0 A;  1HJV A;  4DRM A;  1WAW A;  2MDI A;  3NI6 A;  1A7X A;  1ROT A;  2LJ4 A;  3O5R A;  1RD6 A;  2AWG A;  3IKD A;  4XAK A;  2PV3 A;  3PA7 A;  1OGG A;  1LG1 A;  4TX0 A;  1E6R A;  2LAJ A;  5E62 A;  5DIT A;  2ITK A;  3GTY X;  1U79 A;  3JYM A;  2DT3 A;  4DZ3 A;  4FAP A;  3L4H A;  4IPX A;  1HKM A;  1D7H A;  1LJY A;  3IKG A;  1NWR A;  2XPA A;  3KAH A;  2XP5 A;  3NTP A;  1OWQ A;  4Z2L A;  1PIN A;  4U85 A;  2JV4 A;  1GUV A;  3UQB A;  4ODM A;  2RUQ A;  2DG9 A;  2XP9 A;  3UQI A;  5B8I C;  1TR8 A;  4NSB A;  3BMB A;  4MSP A;  4J4N A;  2PV2 A;  4KQZ A;  2Y78 A;  1EYM A;  1VF8 A;  2F2D A;  4W9P A;  1N1A A;  5HW7 A;  4GGQ A;  3CHF A;  2PV1 A;  2L2S A;  1E6N A;  4ODR A;  1ZL1 A;  1ITX A;  3AS3 A;  3ALF A;  4S3J A;  1TK7 A;  3I6C A;  5HKG A;  1Q6I A;  1H0G A;  1NH6 A;  1XHG A;  1K9R A;  2YAJ B;  4LAV A;  1WB0 A;  4W5U A;  4ITZ A;  3O5L A;  3RGC A;  3CNG A;  4WJX A;  1JNE A;  3KZ7 A;  2XP6 A;  1QPL A;  5GPR A;  3WD1 A;  3ARY A;  3OOB A;  1FD9 A;  2A3E A;  1BL4 A;  1ZBW A;  4IQC A;  3FXY A;  4WKH A;  4ODK A;  1NWT A;  4LAX A;  3WD0 A;  4ODQ A;  1JCH B;  3LE4 A;  1SR0 A;  1WNO A;  3O5P A;  3JYJ A;  2EUL A;  4QIB A;  4Q22 A;  3MCB A;  4MAV A;  5DEZ A;  3GPK A;  2DMV A;  3PQH A;  5HW6 A;  1EHN A;  4QT3 A;  2ZQS A;  1XRV A;  5HWC A;  4JFM A;  3CGN A;  2UZ5 A;  3ART A;  2DT1 A;  3FSB A;  1FLC A;  4REX A;  1Y0O A;  3UI5 A;  4HBE A;  2WAD A;  1O6W A;  2KI3 A;  1FAP A;  4NZC A;  4DRO A;  2M08 A;  3VAW A;  1ZBV A;  3LKX A;  4QZV B;  2M3O W;  3CHE A;  5HT1 A;  1JMQ A;  3WD4 A;  2XPB A;  2MLY A;  1EDQ A;  4ODP A;  1W1V A;  2B5U B;  3WL1 A;  4DWS C;  2MLZ A;  4IT6 A;  3TCZ A;  1ZBK A;  2RUD A;  2MF9 A;  2F23 A;  2M2A A;  1FKJ A;  4IQ2 A;  2LKN A;  3PRB A;  4P8U A;  4A0T A;  2DG3 A;  1GPF A;  3KAF A;  2JZV A;  4JYS A;  4ODN A;  1PBK A;  2L4J A;  2WAE A;  2ZAJ A;  4JFL A;  2MLX A;  4O2T A;  2YSH A;  4DRN A;  1O6I A;  2PN0 A;  2AOS A;  5GPG A;  2OLH A;  3WH0 A;  2A3B A;  4MNL A;  1D7I A;  4WK9 A;  1JNT A;  4U84 A;  3O5J A;  1TFV A;  2PI6 A;  3UI4 A;  3WQW A;  3ARQ A;  4R0X A;  3LUO A;  2LPV A;  2DSZ A;  4C02 B;  3AS2 A;  3WKZ A;  1F8A B;  3RME A;  3CHD A;  2DK7 A;  4DIP A;  2FAP A;  3TC5 A;  1Q6U A;  5J6E A;  3ARW A;  2ZR6 A;  3CGM A;  3ODK A;  2IUZ A;  3O5E A;  4W9O A;  3FSC A;  5CQ2 A;  3KAI A;  1ZB5 A;  3UI6 A;  1FKS A;  3WD3 A;  2DWV A;  1LQ0 A;  2MPH A;  1HJW A;  5E65 A;  2KE0 A;  4TW7 A;  3MCB B;  4ZS6 A;  3RM9 A;  3TDB A;  3ARS A;  3JXV A;  1H0I A;  2QF8 A;  2KXQ A;  2XP3 A;  3MQG A;  1FKT A;  4PTM A;  3ALG A;  2ZR4 A;  4QT2 A;  1FFR A;  2ETN A;  2D9F A;  4MTV A;  1GRJ A;  4G2P A;  1Q1C A;  1FJD A;  2PBC A;  4AY1 A;  5D75 A;  1W9U A;  3IK8 A;  1NMV A;  2DK1 A;  3LKX B;  1FKH A;  2G41 A;  4ODL A;  1B6C A;  3CHC A;  1L1P A;  1M5Y A;  1FFQ A;  2XP8 A;  2ZQT A;  4JFI A;  4KR0 B;  3UF8 A;  3O5K A;  3O5F A;  2DJY A;  2Q5A A;  3UQA A;  2FKE A;  4L3N A;  5E66 A;  2JXW A;  2O92 A;  3ARP A;  5E64 A;  4HBO A;  1X6L A;  2M8I A;  1K9T A;  4L72 B;  2RE3 A;  1F40 A;  1E6Z A;  2FDM A;  2WLZ A;  3BXW A;  3KAD A;  4P8W A;  1LG2 A;  3FY1 A;  4W9Q A;  3ARZ A;  2JMF A;  3ARR A;  3AS0 A;  1J4I A;  2ZR5 A;  3O5G A;  5HW8 A;  4DZ2 A;  5HUA A;  4IT4 A;  4DRI A;  5GQB A;  4U86 A;  2M1I A;  3WQV A;  1T11 A;  5HBF A;  4MPK A;  4ZPW R;  1ZCN A;  4A0U A;  4ZPT R;  2RUR A;  4DRK A;  4ML4 A;  1EQ3 A;  2ZQV A;  4DRJ A;  2YSF A;  1Q6H A;  3FS8 A;  2QRV A;  2B31 A;  1K9Q A;  5DO2 A;  2IF4 A;  2YSB A;  2DSV A;  4TYO A;  4WKF A;  1W1P A;  3O5D A;  2WK2 A;  1KFW A;  3PRD A;  4ODO A;  1FKB A;  3OA5 A;  3G6L A;  1D7J A;  1P5Q A;  4BF8 A;  2PPN A;  1FKK A;  1HKJ A;  1EG3 A;  2ESC A;  2PPO A;  1E44 A;  1OGB A;  1QZ2 A;  3B9E A;  4DWS A;  1EIB A;  2F21 A;  3O5O A;  1UR9 A;  5DF0 A;  3RM4 A;  1NMW A;  4FN2 A;  2KO7 A;  2RQS A;  2WM0 A;  4DRP A;  2KGJ A;  1JVW A;  3B8S A;  1E15 A;  1HJX A;  2XP7 A;  5HTG A;  1JNS A;  1KT0 A;  2A3A A;  1FKL A;  4WKA A;  1FKF A;  1HKI A;  1ZBC A;  1TCO C;  4TW6 A;  4JFJ A;  1BKF A;  2K8I A;  4MNM A;  3QOK A;  2RUC A;  1EG4 A;  1J4H A;  1NSG A;  1J6Y A;  5DIV A;  4NNR A;  2F4E A;  4J4O A;  1LL6 A;  1YAT A;  3WL0 A;  2M8J A;  4DRH A;  4P8X A;  4MNJ A;  2JX8 A;  4DT4 A;  1E9L A;  3O5M A;  2EZ5 W;  4E5R A;  2XP4 A;  3PRA A;  5BXJ A;  4Z2H A;  3KAC A;  1LL4 A;  1KT1 A;  1HXV A;  2O9O A;  2E45 A;  2MNT A;  4R5E A;  4G50 A;  1FKD A;  3B7X A; 
#chains in the Genus database with same CATH homology
 1LL7 A;  3ARX A;  2DT0 A;  3EY6 A;  1FKG A;  1W1T A;  3CZ8 A;  3CH9 A;  3NRK A;  1R9H A;  3W4R A;  5AHT A;  1JND A;  4Z2I A;  4Z2K A;  4Z2G A;  1GOI A;  4WIW A;  5DIU A;  1E6P A;  1YW5 A;  4LAW A;  1W9V A;  1HKK A;  4HAR A;  1UR8 A;  1ZK6 A;  3MDY B;  4GLX A;  3H9R B;  4S3K A;  4MGV A;  4Z2J A;  1NWU A;  4DWS D;  3WIJ A;  1I5H W;  2Y8N B;  2OWO A;  3M7N A;  3M85 A;  1WMV A;  2YSI A;  4LGX A;  4DH0 A;  3KCE A;  2A3C A;  1CTN A;  1D2K A;  2OFN A;  1SYT A;  1W1Y A;  2WLY A;  4DRQ A;  4DWS B;  1W26 A;  3FAP A;  3ARO A;  2DPE A;  1FKI A;  2YBU A;  5I98 A;  4TNS A;  1W9P A;  5HWB A;  1D6O A;  1ROU A;  4N19 A;  2RSE A;  2N87 A;  1WR7 A;  2G8Z A;  1C9H A;  3IHZ A;  5E5W A;  2DSU A;  3ARV A;  3AQU A;  3KAB A;  1J4R A;  2KR7 A;  1NWS A;  1ZU8 A;  3B9A A;  4Q7N A;  2LGO A;  2ZQU A;  4LAY A;  3RM8 A;  3O5I A;  4GIV A;  3RFW A;  1RP5 A;  3G6M A;  3WD2 A;  2PPP A;  2VN1 A;  2DT2 A;  2KFW A;  2YSG A;  2VCD A;  2DG4 A;  2DSW A;  3KAG A;  3AS1 A;  2YBT A;  4URI A;  3B9D A;  4ZPV R;  3MQH A;  3ARU A;  5JH8 A;  1IX5 A;  4JFK A;  2BA1 A;  1X6N A;  4P8V A;  3PR9 A;  4TW8 A;  5U47 A;  1QPF A;  3O5Q A;  1FKR A;  4MNK A;  1HJV A;  4DRM A;  1WAW A;  2MDI A;  3NI6 A;  1A7X A;  1ROT A;  2LJ4 A;  3O5R A;  1RD6 A;  2AWG A;  3IKD A;  4XAK A;  2PV3 A;  3PA7 A;  1OGG A;  1LG1 A;  4TX0 A;  1E6R A;  2LAJ A;  5E62 A;  5DIT A;  2ITK A;  1U79 A;  3JYM A;  2DT3 A;  4DZ3 A;  4FAP A;  3L4H A;  4IPX A;  1HKM A;  1D7H A;  1LJY A;  3IKG A;  1NWR A;  2XPA A;  3KAH A;  2XP5 A;  3NTP A;  1OWQ A;  4Z2L A;  1PIN A;  4U85 A;  2JV4 A;  1GUV A;  3UQB A;  4ODM A;  2RUQ A;  2DG9 A;  2XP9 A;  3UQI A;  5B8I C;  1TR8 A;  4NSB A;  4MSP A;  4J4N A;  2PV2 A;  4KQZ A;  2Y78 A;  1EYM A;  1VF8 A;  2F2D A;  4W9P A;  1N1A A;  5HW7 A;  4GGQ A;  3CHF A;  2PV1 A;  2L2S A;  1E6N A;  4ODR A;  1ZL1 A;  1ITX A;  3AS3 A;  3ALF A;  4S3J A;  1TK7 A;  3I6C A;  5HKG A;  1Q6I A;  1H0G A;  1NH6 A;  1XHG A;  1K9R A;  2YAJ B;  4LAV A;  1WB0 A;  4W5U A;  4ITZ A;  3O5L A;  3RGC A;  3CNG A;  4WJX A;  1JNE A;  3KZ7 A;  2XP6 A;  1QPL A;  5GPR A;  3WD1 A;  3ARY A;  3OOB A;  1FD9 A;  2A3E A;  1BL4 A;  1ZBW A;  4IQC A;  3FXY A;  4WKH A;  4ODK A;  1NWT A;  4LAX A;  3WD0 A;  4ODQ A;  3LE4 A;  1SR0 A;  1WNO A;  3O5P A;  3JYJ A;  4QIB A;  4Q22 A;  3MCB A;  4MAV A;  5DEZ A;  3GPK A;  2DMV A;  3PQH A;  5HW6 A;  1EHN A;  4QT3 A;  2ZQS A;  1XRV A;  5HWC A;  4JFM A;  3CGN A;  2UZ5 A;  3ART A;  2DT1 A;  3FSB A;  1FLC A;  4REX A;  1Y0O A;  3UI5 A;  4HBE A;  2WAD A;  1O6W A;  2KI3 A;  1FAP A;  4NZC A;  4DRO A;  2M08 A;  3VAW A;  1ZBV A;  3LKX A;  4QZV B;  2M3O W;  3CHE A;  5HT1 A;  1JMQ A;  3WD4 A;  2XPB A;  2MLY A;  1EDQ A;  4ODP A;  1W1V A;  3WL1 A;  4DWS C;  2MLZ A;  4IT6 A;  3TCZ A;  1ZBK A;  2RUD A;  2MF9 A;  2M2A A;  1FKJ A;  4IQ2 A;  2LKN A;  3PRB A;  4P8U A;  4A0T A;  2DG3 A;  1GPF A;  3KAF A;  2JZV A;  4JYS A;  4ODN A;  1PBK A;  2L4J A;  2WAE A;  2ZAJ A;  4JFL A;  2MLX A;  4O2T A;  2YSH A;  4DRN A;  1O6I A;  2AOS A;  5GPG A;  2OLH A;  3WH0 A;  2A3B A;  4MNL A;  1D7I A;  4WK9 A;  1JNT A;  4U84 A;  3O5J A;  1TFV A;  2PI6 A;  3UI4 A;  3WQW A;  3ARQ A;  4R0X A;  3LUO A;  2LPV A;  2DSZ A;  4C02 B;  3AS2 A;  3WKZ A;  1F8A B;  3RME A;  3CHD A;  2DK7 A;  4DIP A;  2FAP A;  3TC5 A;  1Q6U A;  5J6E A;  3ARW A;  2ZR6 A;  3CGM A;  3ODK A;  2IUZ A;  3O5E A;  4W9O A;  3FSC A;  5CQ2 A;  3KAI A;  1ZB5 A;  3UI6 A;  1FKS A;  3WD3 A;  2DWV A;  1LQ0 A;  2MPH A;  1HJW A;  5E65 A;  2KE0 A;  4TW7 A;  3MCB B;  4ZS6 A;  3RM9 A;  3TDB A;  3ARS A;  3JXV A;  1H0I A;  2QF8 A;  2KXQ A;  2XP3 A;  3MQG A;  1FKT A;  4PTM A;  3ALG A;  2ZR4 A;  4QT2 A;  1FFR A;  2D9F A;  4MTV A;  4G2P A;  1Q1C A;  1FJD A;  2PBC A;  4AY1 A;  5D75 A;  1W9U A;  3IK8 A;  1NMV A;  2DK1 A;  3LKX B;  1FKH A;  2G41 A;  4ODL A;  1B6C A;  3CHC A;  1L1P A;  1M5Y A;  1FFQ A;  2XP8 A;  2ZQT A;  4JFI A;  4KR0 B;  3UF8 A;  3O5K A;  3O5F A;  2DJY A;  2Q5A A;  3UQA A;  2FKE A;  4L3N A;  5E66 A;  2JXW A;  2O92 A;  3ARP A;  5E64 A;  4HBO A;  1X6L A;  2M8I A;  1K9T A;  4L72 B;  2RE3 A;  1F40 A;  1E6Z A;  2FDM A;  2WLZ A;  3BXW A;  3KAD A;  4P8W A;  1LG2 A;  3FY1 A;  4W9Q A;  3ARZ A;  2JMF A;  3ARR A;  3AS0 A;  1J4I A;  2ZR5 A;  3O5G A;  5HW8 A;  4DZ2 A;  5HUA A;  4IT4 A;  4DRI A;  5GQB A;  4U86 A;  2M1I A;  3WQV A;  1T11 A;  5HBF A;  4MPK A;  4ZPW R;  1ZCN A;  4A0U A;  4ZPT R;  2RUR A;  4DRK A;  4ML4 A;  1EQ3 A;  2ZQV A;  4DRJ A;  2YSF A;  1Q6H A;  3FS8 A;  2QRV A;  2B31 A;  1K9Q A;  5DO2 A;  2IF4 A;  2YSB A;  2DSV A;  4TYO A;  4WKF A;  1W1P A;  3O5D A;  2WK2 A;  1KFW A;  3PRD A;  4ODO A;  1FKB A;  3OA5 A;  3G6L A;  1D7J A;  1P5Q A;  4BF8 A;  2PPN A;  1FKK A;  1HKJ A;  1EG3 A;  2ESC A;  2PPO A;  1OGB A;  1QZ2 A;  3B9E A;  4DWS A;  1EIB A;  2F21 A;  3O5O A;  1UR9 A;  5DF0 A;  3RM4 A;  1NMW A;  4FN2 A;  2KO7 A;  2RQS A;  2WM0 A;  4DRP A;  2KGJ A;  1JVW A;  3B8S A;  1E15 A;  1HJX A;  2XP7 A;  5HTG A;  1JNS A;  1KT0 A;  2A3A A;  1FKL A;  4WKA A;  1FKF A;  1HKI A;  1ZBC A;  1TCO C;  4TW6 A;  4JFJ A;  1BKF A;  2K8I A;  4MNM A;  3QOK A;  2RUC A;  1EG4 A;  1J4H A;  1NSG A;  1J6Y A;  5DIV A;  4NNR A;  2F4E A;  4J4O A;  1LL6 A;  1YAT A;  3WL0 A;  2M8J A;  4DRH A;  4P8X A;  4MNJ A;  2JX8 A;  4DT4 A;  1E9L A;  3O5M A;  2EZ5 W;  4E5R A;  2XP4 A;  3PRA A;  5BXJ A;  4Z2H A;  3KAC A;  1LL4 A;  1KT1 A;  1HXV A;  2O9O A;  2E45 A;  2MNT A;  4R5E A;  4G50 A;  1FKD A;  3B7X A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...