3ODKA

Discovery of cell-active phenyl-imidazole pin1 inhibitors by structure-guided fragment evolution
Total Genus 42
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
42
sequence length
157
structure length
145
Chain Sequence
LPPGWEKAMSRSSGRVYYFNHITNASQWERPSEPARVRCSHLLVKHSQSRRPSSWRQEKITRTKEEALELINGYIQKIKSGEEDFESLASQFSDCSSAKARGDLGAFSRGQMQKPFEDASFALRTGEMSGPVFTDSGIHIILRTE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Discovery of cell-active phenyl-imidazole Pin1 inhibitors by structure-guided fragment evolution.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Isomerase
molecule keywords Peptidyl-prolyl cis-trans isomerase NIMA-interacting 1
total genus 42
structure length 145
sequence length 157
ec nomenclature ec 5.2.1.8: Peptidylprolyl isomerase.
pdb deposition date 2010-08-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00397 WW WW domain
A PF00639 Rotamase PPIC-type PPIASE domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.20.70.10 Mainly Beta Single Sheet Ubiquitin Ligase Nedd4; Chain: W; Ubiquitin Ligase Nedd4; Chain: W; 3odkA01
3.10.50.40 Alpha Beta Roll Chitinase A; domain 3 Chitinase A; domain 3 3odkA02
4LAYA 2D9FA 5D75A 4U85A 2JV4A 1O6WA 4BF8A 3MDYB 3IHZA 1EG3A 2RQSA 4DRNA 1P5QA 1FKTA 2DK7A 3KADA 1ZCNA 4DRPA 1FKJA 2ZQSA 4C02B 5DIUA 3ODKA 2DK1A 3B7XA 1JNTA 2PPOA 2DMVA 4TNSA 3O5PA 2UZ5A 1C9HA 4E5RA 1K9RA 2IF4A 2XPAA 3CGNA 3KAHA 2K8IA 1PINA 5CQ2A 2RE3A 2LPVA 2XP7A 4DH0A 4REXA 3UQAA 2ZR4A 2PBCA 2XP8A 4TX0A 2JMFA 2DG3A 2MF9A 3O5KA 3IK8A 5BXJA 1EQ3A 1Y0OA 3PA7A 1F40A 2XPBA 1FKSA 3O5FA 2BA1A 2KXQA 2RURA 4IPXA 3VAWA 1D7IA 1NMWA 2LKNA 4NNRA 2ITKA 1FKFA 3O5LA 3KABA 4QIBA 3PRDA 3JYMA 4DZ3A 2L4JA 1D6OA 5B8IC 4ODRA 4ODLA 3UF8A 5GPGA 5HW6A 4G2PA 1FJDA 1L1PA 4W9QA 3UI6A 2ZQTA 2DG4A 3KAIA 2MLXA 2YSHA 2RUCA 3JYJA 1B6CA 1J4IA 1I5HW 3JXVA 4JFMA 4FAPA 4MGVA 2ZR5A 3KZ7A 4IQ2A 1R9HA 5HTGA 4J4NA 2LJ4A 1A7XA 3NRKA 2Y78A 4TW7A 3GPKA 3KACA 3FAPA 4LAVA 2N87A 3RGCA 4DT4A 1EG4A 3I6CA 3CNGA 2MDIA 1FKIA 2VCDA 5HWCA 3UQBA 3KCEA 3LE4A 1TCOC 2F2DA 1Q1CA 4MSPA 4ODMA 5I98A 1QPFA 4DRMA 4ODKA 2AWGA 4N19A 3LUOA 3CGMA 1FKHA 4LAWA 1Q6UA 2FAPA 2XP6A 2KE0A 3O5MA 4R0XA 4DRKA 1F8AB 1QPLA 1Q6IA 2KI3A 3M7NA 5J6EA 3UI5A 2M8JA 2F21A 3H9RB 4O2TA 5HW8A 2E45A 1YW5A 1FKGA 4ODNA 1T11A 3PRBA 4W9OA 5HKGA 2ZQUA 1JVWA 4G50A 2MLYA 4ODOA 2ZAJA 3NTPA 2F4EA 3UQIA 1WMVA 2ZR6A 2DWVA 2ZQVA 4JYSA 4JFJA 1BKFA 2M3OW 4DRJA 4DROA 5HWBA 2LGOA 1EYMA 2MPHA 2JZVA 2MNTA 2XP9A 4LAXA 3M85A 3TC5A 4ODPA 4TW8A 1ROUA 1ZK6A 1FAPA 4DRQA 1K9QA 2KO7A 4ODQA 1KT1A 3OOBA 2XP3A 2M1IA 2KGJA 2RSEA 5DITA 1FKKA 3NI6A 3L4HA 2XP5A 1J4HA 5HT1A 1J6YA 2Q5AA 2KFWA 4U84A 2RUQA 2OFNA 4JFIA 2RUDA 2PV2A 3WH0A 2XP4A 1QZ2A 1YATA 3O5RA 1NSGA 1FKDA 3O5OA 3O5DA 4ITZA 2PV1A 4TW6A 2M8IA 3O5EA 4QT2A 2PV3A 1WR7A 4J4OA 1HXVA 3TCZA 1D7JA 1N1AA 3EY6A 4GGQA 2PPPA 3RFWA 2YSBA 1D7HA 1PBKA 1ROTA 2DG9A 2KR7A 4JFKA 2M08A 4FN2A 4GIVA 4DRHA 5AHTA 5HW7A 4U86A 3IKDA 1KT0A 1JNSA 2M2AA 4IQCA 2PPNA 2YSFA 1FKRA 2JXWA 2FKEA 1FKBA 1BL4A 1NMVA 1J4RA 1U79A 2MLZA 1FD9A 1Q6HA 3KAFA 2LAJA 4TYOA 3UI4A 1FKLA 4DIPA 4DZ2A 3O5QA 2YSIA 2JX8A 2L2SA 1TK7A 2YSGA 1W26A 2VN1A 3O5IA 2EZ5W 1JMQA 3IKGA 4QT3A 5DIVA 2DJYA 3O5GA 4DRIA 4W9PA 3KAGA 3TDBA 3O5JA 5HUAA 4JFLA 1M5YA
chains in the Genus database with same CATH superfamily
4W5UA 4LAYA 1LQ0A 4U85A 3MDYB 3ARWA 1EG3A 2RQSA 4ZPWR 5JH8A 2DT1A 4XAKA 1KFWA 1OGBA 1UR9A 4MTVA 4PTMA 2K8IA 3UQAA 1E44A 1RP5A 2QRVA 4WKAA 3IK8A 4HBEA 1EQ3A 1Y0OA 2XPBA 4DWSC 4IPXA 2YBUA 2ITKA 3O5LA 3KABA 4QIBA 3PRDA 3AS3A 3UF8A 2G41A 5E64A 4G2PA 3UI6A 4Z2GA 3KAIA 2RUCA 3JYJA 1B6CA 4JFMA 4FAPA 1JCHB 2LJ4A 2B31A 2Y78A 1SYTA 4DT4A 5HWCA 1EG4A 3I6CA 4QZVB 3WD2A 2VCDA 1E6NA 3G6LA 1TCOC 2F2DA 1H0IA 1HJXA 3MCBB 1NWRA 3LUOA 1FKHA 1ITXA 3WQWA 3WD4A 3O5MA 4R0XA 1Q6IA 4Z2KA 4A0UA 5J6EA 2F21A 3FSCA 2E45A 1YW5A 5HKGA 3PRBA 2A3AA 2ZQUA 4G50A 1FFRA 4ODOA 3NTPA 3ARVA 3UQIA 1WMVA 4JYSA 5E5WA 4DROA 2JZVA 1K9QA 3MQGA 4MPKA 4ODQA 1KT1A 2RSEA 1FKKA 1J4HA 2P4VA 1NH6A 4U84A 2OFNA 4DZ2A 1YATA 3ARXA 3O5OA 1WR7A 1HKMA 3WD3A 3EY6A 4KQZA 3FY1A 3ARQA 4JFKA 4MNJA 1TR8A 4DRHA 5AHTA 4MNKA 3IKDA 1KT0A 1W1PA 4NZCA 2M2AA 2ESCA 2PPNA 2YSFA 2JXWA 1BL4A 1FD9A 1Q6HA 2OLHA 4TYOA 3B9DA 5HBFA 3WIJA 4QT3A 5DIVA 2A3CA 3FS8A 2DJYA 2FDMA 3KAGA 4JFLA 5E66A 4DWSB 1E6PA 2WM0A 1O6WA 4URIA 4DRNA 1LL4A 1ZCNA 1FKJA 2DT3A 4TNSA 1JNTA 3W4RA 2DSUA 4E5RA 1K9RA 3CGNA 3KAHA 2LPVA 2DSWA 2RE3A 4KR0B 4REXA 4AY1A 2ZR4A 3ARYA 3CH9A 1X6NA 1LL6A 1GOIA 2DT0A 5BXJA 4ZPTR 3PA7A 1FKSA 2RURA 3RM8A 2LKNA 1NMWA 1W1TA 4NNRA 1WAWA 3BXWA 1D6OA 1L1PA 1GUVA 1FJDA 2DG4A 2F23A 2MLXA 1J4IA 3LKXA 1I5HW 4MGVA 2ZR5A 4J4NA 3FXYA 3PQHA 1A7XA 4TW7A 3RGCA 3GPKA 1ZL1A 2N87A 5DEZA 3CNGA 4MSPA 1OWQA 1JNDA 2ETNA 1HKIA 1NWTA 1Q6UA 1WB0A 3CHEA 1QPLA 2KI3A 3M7NA 1CTNA 1O6IA 1FKGA 5HTGA 1JVWA 3WD1A 3CHFA 4IT4A 2ZQVA 3WD0A 4P8WA 3RM9A 1EIBA 1EDQA 2MNTA 3BMBA 2XP9A 3ALFA 3TC5A 4ODPA 4TW8A 4DRQA 1ZK6A 1FAPA 2KO7A 4Z2JA 3OOBA 4A0TA 3NI6A 3L4HA 2XP5A 1E6RA 4MNLA 3AS0A 2RUQA 2OWOA 1TFVA 4JFIA 1QZ2A 4HBOA 1FKDA 2M8IA 3AROA 4S3KA 3TCZA 1N1AA 4GGQA 4LGXA 4L3NA 3RFWA 4IT6A 1LG1A 1XRVA 1HJWA 1JNSA 5E65A 2DSVA 3RMEA 1NMVA 1W9VA 2LAJA 4DIPA 3O5QA 2YSIA 1TK7A 2YSGA 5HW7A 4W9PA 1LJYA 5D75A 5GQBA 1RD6A 3B8SA 4Z2IA 2JV4A 1ZU8A 3WQVA 3IHZA 1E6ZA 1E9LA 4WJXA 3KADA 5U47A 3CHCA 4DRPA 3ARUA 2ZQSA 4C02B 5DIUA 1H0GA 3ODKA 4L72B 3B7XA 5DO2A 4Z2LA 3PR9A 2UZ5A 3MQHA 3CHDA 2DPEA 2IF4A 1PINA 5CQ2A 2XP7A 1VF8A 4TX0A 2JMFA 2MF9A 1F40A 3QOKA 3O5FA 2BA1A 1LG2A 1EHNA 2A3BA 1FLCA 1FFQA 4DWSD 4DZ3A 2L4JA 5B8IC 4ODRA 2WK2A 3WKZA 4W9QA 2ZQTA 1W9UA 2YSHA 3KZ7A 4IQ2A 1R9HA 4LAVA 3UQBA 2MDIA 1FKIA 3G6MA 1ZBWA 3LE4A 5I98A 1Q1CA 4ODMA 4DRMA 4ODKA 1JNEA 3ARZA 2FAPA 2KE0A 1F8AB 2PI6A 2M8JA 2A3EA 3H9RB 3WL1A 1T11A 1HKJA 4GLXA 1W9PA 2DWVA 3AS2A 3EIPA 4JFJA 1ZBVA 4MAVA 3OA5A 3M85A 1ROUA 2XP3A 1IX5A 5DITA 1LL7A 2PN0A 1J6YA 4WKFA 2KFWA 2RUDA 3O5DA 2XP4A 1NSGA 4TW6A 1GRJA 4DWSA 2IUZA 4J4OA 1D7JA 2PPPA 4R5EA 3B9EA 2YSBA 4S3JA 1ROTA 4GIVA 1UR8A 4P8UA 2Y8NB 4IQCA 1FKRA 2FKEA 4P8VA 1J4RA 3KAFA 3ARTA 1FKLA 1E15A 1SR0A 3O5IA 1JMQA 4DRIA 3IKGA 5HUAA 1GPFA 5GPRA 3TDBA 2XPAA 3O5JA 4BF8A 5DF0A 1M5YA 2DSZA 4ML4A 2D9FA 4P8XA 1ZBCA 3WL0A 2WADA 1P5QA 1FKTA 2DK7A 2DK1A 2PPOA 2DMVA 3O5PA 2QF8A 2WLZA 1C9HA 2AOSA 1XHGA 4DH0A 2PBCA 2XP8A 1ZBKA 3GU0A 4WK9A 2DG3A 1ZB5A 3O5KA 4MNMA 2KXQA 3AQUA 3VAWA 1D7IA 1NWSA 4UDMA 3LKXB 1FKFA 5E62A 3JYMA 4ODLA 5HW6A 5GPGA 3MCBA 3ARRA 4WIWA 3JXVA 3B9AA 1W1YA 2EULA 3NRKA 3KACA 3FAPA 1X6LA 3KCEA 3ALGA 1QPFA 2AWGA 2WLYA 4N19A 3CGMA 4HARA 4LAWA 2O9OA 1HKKA 1NWUA 2XP6A 4DRKA 2O92A 3UI5A 4O2TA 5HW8A 4ODNA 2WAEA 1W1VA 4W9OA 3FSBA 2MLYA 2ZAJA 2F4EA 3RM4A 2ZR6A 3ARPA 4DRJA 1BKFA 2M3OW 5HWBA 2LGOA 1EYMA 2MPHA 4ZPVR 4LAXA 3PRAA 2YBTA 2M1IA 2KGJA 5HT1A 4Q22A 2Q5AA 4Z2HA 2DT2A 1HJVA 4ZS6A 2PV2A 3WH0A 3O5RA 4ITZA 4Q7NA 2PV1A 3O5EA 4QT2A 3GTYX 2PV3A 1HXVA 1D2KA 2G8ZA 1D7HA 1PBKA 2KR7A 2DG9A 2M08A 2YAJB 4FN2A 4U86A 3CZ8A 1FKBA 1U79A 2MLZA 1WNOA 1K9TA 3ARSA 2JX8A 2B5UB 2VN1A 1W26A 2L2SA 1OGGA 2EZ5W 4NSBA 3O5GA 3UI4A 3AS1A 4WKHA
chains in the Genus database with same CATH topology
4W5UA 4LAYA 1LQ0A 4U85A 3MDYB 3ARWA 1EG3A 2RQSA 4ZPWR 5JH8A 2DT1A 4XAKA 1KFWA 1OGBA 1UR9A 4MTVA 4PTMA 2K8IA 3UQAA 1RP5A 2QRVA 4WKAA 3IK8A 4HBEA 1EQ3A 1Y0OA 2XPBA 4DWSC 4IPXA 2YBUA 2ITKA 3O5LA 3KABA 4QIBA 3PRDA 3AS3A 3UF8A 2G41A 5E64A 4G2PA 3UI6A 4Z2GA 3KAIA 2RUCA 3JYJA 1B6CA 4JFMA 4FAPA 2LJ4A 2B31A 2Y78A 1SYTA 4DT4A 5HWCA 1EG4A 3I6CA 4QZVB 3WD2A 2VCDA 1E6NA 3G6LA 1TCOC 2F2DA 1H0IA 1HJXA 3MCBB 1NWRA 3LUOA 1FKHA 1ITXA 3WQWA 3WD4A 3O5MA 4R0XA 1Q6IA 4Z2KA 4A0UA 5J6EA 2F21A 3FSCA 2E45A 1YW5A 5HKGA 3PRBA 2A3AA 2ZQUA 4G50A 1FFRA 4ODOA 3NTPA 3ARVA 3UQIA 1WMVA 4JYSA 5E5WA 4DROA 2JZVA 1K9QA 3MQGA 4MPKA 4ODQA 1KT1A 2RSEA 1FKKA 1J4HA 1NH6A 4U84A 2OFNA 4DZ2A 1YATA 3ARXA 3O5OA 1WR7A 1HKMA 3WD3A 3EY6A 4KQZA 3FY1A 3ARQA 4JFKA 4MNJA 1TR8A 4DRHA 5AHTA 4MNKA 3IKDA 1KT0A 1W1PA 4NZCA 2M2AA 2ESCA 2PPNA 2YSFA 2JXWA 1BL4A 1FD9A 1Q6HA 2OLHA 4TYOA 3B9DA 5HBFA 3WIJA 4QT3A 5DIVA 2A3CA 3FS8A 2DJYA 2FDMA 3KAGA 4JFLA 5E66A 4DWSB 1E6PA 2WM0A 1O6WA 4URIA 4DRNA 1LL4A 1ZCNA 1FKJA 2DT3A 4TNSA 1JNTA 3W4RA 2DSUA 4E5RA 1K9RA 3CGNA 3KAHA 2LPVA 2DSWA 2RE3A 4KR0B 4REXA 4AY1A 2ZR4A 3ARYA 3CH9A 1X6NA 1LL6A 1GOIA 2DT0A 5BXJA 4ZPTR 3PA7A 1FKSA 2RURA 3RM8A 2LKNA 1NMWA 1W1TA 4NNRA 1WAWA 3BXWA 1D6OA 1L1PA 1GUVA 1FJDA 2DG4A 2MLXA 1J4IA 3LKXA 1I5HW 4MGVA 2ZR5A 4J4NA 3FXYA 3PQHA 1A7XA 4TW7A 3RGCA 3GPKA 1ZL1A 2N87A 5DEZA 3CNGA 4MSPA 1OWQA 1JNDA 1HKIA 1NWTA 1Q6UA 1WB0A 3CHEA 1QPLA 2KI3A 3M7NA 1CTNA 1O6IA 1FKGA 5HTGA 1JVWA 3WD1A 3CHFA 4IT4A 2ZQVA 3WD0A 4P8WA 3RM9A 1EIBA 1EDQA 2MNTA 2XP9A 3ALFA 3TC5A 4ODPA 4TW8A 4DRQA 1ZK6A 1FAPA 2KO7A 4Z2JA 3OOBA 4A0TA 3NI6A 3L4HA 2XP5A 1E6RA 4MNLA 3AS0A 2RUQA 2OWOA 1TFVA 4JFIA 1QZ2A 4HBOA 1FKDA 2M8IA 3AROA 4S3KA 3TCZA 1N1AA 4GGQA 4LGXA 4L3NA 3RFWA 4IT6A 1LG1A 1XRVA 1HJWA 1JNSA 5E65A 2DSVA 3RMEA 1NMVA 1W9VA 2LAJA 4DIPA 3O5QA 2YSIA 1TK7A 2YSGA 5HW7A 4W9PA 1LJYA 5D75A 5GQBA 1RD6A 3B8SA 4Z2IA 2JV4A 1ZU8A 3WQVA 3IHZA 1E6ZA 1E9LA 4WJXA 3KADA 5U47A 3CHCA 4DRPA 3ARUA 2ZQSA 4C02B 5DIUA 1H0GA 3ODKA 4L72B 3B7XA 5DO2A 4Z2LA 3PR9A 2UZ5A 3MQHA 3CHDA 2DPEA 2IF4A 1PINA 5CQ2A 2XP7A 1VF8A 4TX0A 2JMFA 2MF9A 1F40A 3QOKA 3O5FA 2BA1A 1LG2A 1EHNA 2A3BA 1FLCA 1FFQA 4DWSD 4DZ3A 2L4JA 5B8IC 4ODRA 2WK2A 3WKZA 4W9QA 2ZQTA 1W9UA 2YSHA 3KZ7A 4IQ2A 1R9HA 4LAVA 3UQBA 2MDIA 1FKIA 3G6MA 1ZBWA 3LE4A 5I98A 1Q1CA 4ODMA 4DRMA 4ODKA 1JNEA 3ARZA 2FAPA 2KE0A 1F8AB 2PI6A 2M8JA 2A3EA 3H9RB 3WL1A 1T11A 1HKJA 4GLXA 1W9PA 2DWVA 3AS2A 4JFJA 1ZBVA 4MAVA 3OA5A 3M85A 1ROUA 2XP3A 1IX5A 5DITA 1LL7A 1J6YA 4WKFA 2KFWA 2RUDA 3O5DA 2XP4A 1NSGA 4TW6A 4DWSA 2IUZA 4J4OA 1D7JA 2PPPA 4R5EA 3B9EA 2YSBA 4S3JA 1ROTA 4GIVA 1UR8A 4P8UA 2Y8NB 4IQCA 1FKRA 2FKEA 4P8VA 1J4RA 3KAFA 3ARTA 1FKLA 1E15A 1SR0A 3O5IA 1JMQA 4DRIA 3IKGA 5HUAA 1GPFA 5GPRA 3TDBA 2XPAA 3O5JA 4BF8A 5DF0A 1M5YA 2DSZA 4ML4A 2D9FA 4P8XA 1ZBCA 3WL0A 2WADA 1P5QA 1FKTA 2DK7A 2DK1A 2PPOA 2DMVA 3O5PA 2QF8A 2WLZA 1C9HA 2AOSA 1XHGA 4DH0A 2PBCA 2XP8A 1ZBKA 4WK9A 2DG3A 1ZB5A 3O5KA 4MNMA 2KXQA 3AQUA 3VAWA 1D7IA 1NWSA 3LKXB 1FKFA 5E62A 3JYMA 4ODLA 5HW6A 5GPGA 3MCBA 3ARRA 4WIWA 3JXVA 3B9AA 1W1YA 3NRKA 3KACA 3FAPA 1X6LA 3KCEA 3ALGA 1QPFA 2AWGA 2WLYA 4N19A 3CGMA 4HARA 4LAWA 2O9OA 1HKKA 1NWUA 2XP6A 4DRKA 2O92A 3UI5A 4O2TA 5HW8A 4ODNA 2WAEA 1W1VA 4W9OA 3FSBA 2MLYA 2ZAJA 2F4EA 3RM4A 2ZR6A 3ARPA 4DRJA 1BKFA 2M3OW 5HWBA 2LGOA 1EYMA 2MPHA 4ZPVR 4LAXA 3PRAA 2YBTA 2M1IA 2KGJA 5HT1A 4Q22A 2Q5AA 4Z2HA 2DT2A 1HJVA 4ZS6A 2PV2A 3WH0A 3O5RA 4ITZA 4Q7NA 2PV1A 3O5EA 4QT2A 2PV3A 1HXVA 1D2KA 2G8ZA 1D7HA 1PBKA 2KR7A 2DG9A 2M08A 2YAJB 4FN2A 4U86A 3CZ8A 1FKBA 1U79A 2MLZA 1WNOA 1K9TA 3ARSA 2JX8A 2L2SA 1W26A 2VN1A 1OGGA 2EZ5W 4NSBA 3O5GA 3UI4A 3AS1A 4WKHA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4LAY A;  2D9F A;  5D75 A;  4U85 A;  2JV4 A;  1O6W A;  4BF8 A;  3MDY B;  3IHZ A;  1EG3 A;  2RQS A;  4DRN A;  1P5Q A;  1FKT A;  2DK7 A;  3KAD A;  1ZCN A;  4DRP A;  1FKJ A;  2ZQS A;  4C02 B;  5DIU A;  3ODK A;  2DK1 A;  3B7X A;  1JNT A;  2PPO A;  2DMV A;  4TNS A;  3O5P A;  2UZ5 A;  1C9H A;  4E5R A;  1K9R A;  2IF4 A;  2XPA A;  3CGN A;  3KAH A;  2K8I A;  1PIN A;  5CQ2 A;  2RE3 A;  2LPV A;  2XP7 A;  4DH0 A;  4REX A;  3UQA A;  2ZR4 A;  2PBC A;  2XP8 A;  4TX0 A;  2JMF A;  2DG3 A;  2MF9 A;  3O5K A;  3IK8 A;  5BXJ A;  1EQ3 A;  1Y0O A;  3PA7 A;  1F40 A;  2XPB A;  1FKS A;  3O5F A;  2BA1 A;  2KXQ A;  2RUR A;  4IPX A;  3VAW A;  1D7I A;  1NMW A;  2LKN A;  4NNR A;  2ITK A;  1FKF A;  3O5L A;  3KAB A;  4QIB A;  3PRD A;  3JYM A;  4DZ3 A;  2L4J A;  1D6O A;  5B8I C;  4ODR A;  4ODL A;  3UF8 A;  5GPG A;  5HW6 A;  4G2P A;  1FJD A;  1L1P A;  4W9Q A;  3UI6 A;  2ZQT A;  2DG4 A;  3KAI A;  2MLX A;  2YSH A;  2RUC A;  3JYJ A;  1B6C A;  1J4I A;  1I5H W;  3JXV A;  4JFM A;  4FAP A;  4MGV A;  2ZR5 A;  3KZ7 A;  4IQ2 A;  1R9H A;  5HTG A;  4J4N A;  2LJ4 A;  1A7X A;  3NRK A;  2Y78 A;  4TW7 A;  3GPK A;  3KAC A;  3FAP A;  4LAV A;  2N87 A;  3RGC A;  4DT4 A;  1EG4 A;  3I6C A;  3CNG A;  2MDI A;  1FKI A;  2VCD A;  5HWC A;  3UQB A;  3KCE A;  3LE4 A;  1TCO C;  2F2D A;  1Q1C A;  4MSP A;  4ODM A;  5I98 A;  1QPF A;  4DRM A;  4ODK A;  2AWG A;  4N19 A;  3LUO A;  3CGM A;  1FKH A;  4LAW A;  1Q6U A;  2FAP A;  2XP6 A;  2KE0 A;  3O5M A;  4R0X A;  4DRK A;  1F8A B;  1QPL A;  1Q6I A;  2KI3 A;  3M7N A;  5J6E A;  3UI5 A;  2M8J A;  2F21 A;  3H9R B;  4O2T A;  5HW8 A;  2E45 A;  1YW5 A;  1FKG A;  4ODN A;  1T11 A;  3PRB A;  4W9O A;  5HKG A;  2ZQU A;  1JVW A;  4G50 A;  2MLY A;  4ODO A;  2ZAJ A;  3NTP A;  2F4E A;  3UQI A;  1WMV A;  2ZR6 A;  2DWV A;  2ZQV A;  4JYS A;  4JFJ A;  1BKF A;  2M3O W;  4DRJ A;  4DRO A;  5HWB A;  2LGO A;  1EYM A;  2MPH A;  2JZV A;  2MNT A;  2XP9 A;  4LAX A;  3M85 A;  3TC5 A;  4ODP A;  4TW8 A;  1ROU A;  1ZK6 A;  1FAP A;  4DRQ A;  1K9Q A;  2KO7 A;  4ODQ A;  1KT1 A;  3OOB A;  2XP3 A;  2M1I A;  2KGJ A;  2RSE A;  5DIT A;  1FKK A;  3NI6 A;  3L4H A;  2XP5 A;  1J4H A;  5HT1 A;  1J6Y A;  2Q5A A;  2KFW A;  4U84 A;  2RUQ A;  2OFN A;  4JFI A;  2RUD A;  2PV2 A;  3WH0 A;  2XP4 A;  1QZ2 A;  1YAT A;  3O5R A;  1NSG A;  1FKD A;  3O5O A;  3O5D A;  4ITZ A;  2PV1 A;  4TW6 A;  2M8I A;  3O5E A;  4QT2 A;  2PV3 A;  1WR7 A;  4J4O A;  1HXV A;  3TCZ A;  1D7J A;  1N1A A;  3EY6 A;  4GGQ A;  2PPP A;  3RFW A;  2YSB A;  1D7H A;  1PBK A;  1ROT A;  2DG9 A;  2KR7 A;  4JFK A;  2M08 A;  4FN2 A;  4GIV A;  4DRH A;  5AHT A;  5HW7 A;  4U86 A;  3IKD A;  1KT0 A;  1JNS A;  2M2A A;  4IQC A;  2PPN A;  2YSF A;  1FKR A;  2JXW A;  2FKE A;  1FKB A;  1BL4 A;  1NMV A;  1J4R A;  1U79 A;  2MLZ A;  1FD9 A;  1Q6H A;  3KAF A;  2LAJ A;  4TYO A;  3UI4 A;  1FKL A;  4DIP A;  4DZ2 A;  3O5Q A;  2YSI A;  2JX8 A;  2L2S A;  1TK7 A;  2YSG A;  1W26 A;  2VN1 A;  3O5I A;  2EZ5 W;  1JMQ A;  3IKG A;  4QT3 A;  5DIV A;  2DJY A;  3O5G A;  4DRI A;  4W9P A;  3KAG A;  3TDB A;  3O5J A;  5HUA A;  4JFL A;  1M5Y A; 
#chains in the Genus database with same CATH topology
 4W5U A;  4LAY A;  1LQ0 A;  4U85 A;  3MDY B;  3ARW A;  1EG3 A;  2RQS A;  4ZPW R;  5JH8 A;  2DT1 A;  4XAK A;  1KFW A;  1OGB A;  1UR9 A;  4MTV A;  4PTM A;  2K8I A;  3UQA A;  1E44 A;  1RP5 A;  2QRV A;  4WKA A;  3IK8 A;  4HBE A;  1EQ3 A;  1Y0O A;  2XPB A;  4DWS C;  4IPX A;  2YBU A;  2ITK A;  3O5L A;  3KAB A;  4QIB A;  3PRD A;  3AS3 A;  3UF8 A;  2G41 A;  5E64 A;  4G2P A;  3UI6 A;  4Z2G A;  3KAI A;  2RUC A;  3JYJ A;  1B6C A;  4JFM A;  4FAP A;  1JCH B;  2LJ4 A;  2B31 A;  2Y78 A;  1SYT A;  4DT4 A;  5HWC A;  1EG4 A;  3I6C A;  4QZV B;  3WD2 A;  2VCD A;  1E6N A;  3G6L A;  1TCO C;  2F2D A;  1H0I A;  1HJX A;  3MCB B;  1NWR A;  3LUO A;  1FKH A;  1ITX A;  3WQW A;  3WD4 A;  3O5M A;  4R0X A;  1Q6I A;  4Z2K A;  4A0U A;  5J6E A;  2F21 A;  3FSC A;  2E45 A;  1YW5 A;  5HKG A;  3PRB A;  2A3A A;  2ZQU A;  4G50 A;  1FFR A;  4ODO A;  3NTP A;  3ARV A;  3UQI A;  1WMV A;  4JYS A;  5E5W A;  4DRO A;  2JZV A;  1K9Q A;  3MQG A;  4MPK A;  4ODQ A;  1KT1 A;  2RSE A;  1FKK A;  1J4H A;  2P4V A;  1NH6 A;  4U84 A;  2OFN A;  4DZ2 A;  1YAT A;  3ARX A;  3O5O A;  1WR7 A;  1HKM A;  3WD3 A;  3EY6 A;  4KQZ A;  3FY1 A;  3ARQ A;  4JFK A;  4MNJ A;  1TR8 A;  4DRH A;  5AHT A;  4MNK A;  3IKD A;  1KT0 A;  1W1P A;  4NZC A;  2M2A A;  2ESC A;  2PPN A;  2YSF A;  2JXW A;  1BL4 A;  1FD9 A;  1Q6H A;  2OLH A;  4TYO A;  3B9D A;  5HBF A;  3WIJ A;  4QT3 A;  5DIV A;  2A3C A;  3FS8 A;  2DJY A;  2FDM A;  3KAG A;  4JFL A;  5E66 A;  4DWS B;  1E6P A;  2WM0 A;  1O6W A;  4URI A;  4DRN A;  1LL4 A;  1ZCN A;  1FKJ A;  2DT3 A;  4TNS A;  1JNT A;  3W4R A;  2DSU A;  4E5R A;  1K9R A;  3CGN A;  3KAH A;  2LPV A;  2DSW A;  2RE3 A;  4KR0 B;  4REX A;  4AY1 A;  2ZR4 A;  3ARY A;  3CH9 A;  1X6N A;  1LL6 A;  1GOI A;  2DT0 A;  5BXJ A;  4ZPT R;  3PA7 A;  1FKS A;  2RUR A;  3RM8 A;  2LKN A;  1NMW A;  1W1T A;  4NNR A;  1WAW A;  3BXW A;  1D6O A;  1L1P A;  1GUV A;  1FJD A;  2DG4 A;  2F23 A;  2MLX A;  1J4I A;  3LKX A;  1I5H W;  4MGV A;  2ZR5 A;  4J4N A;  3FXY A;  3PQH A;  1A7X A;  4TW7 A;  3RGC A;  3GPK A;  1ZL1 A;  2N87 A;  5DEZ A;  3CNG A;  4MSP A;  1OWQ A;  1JND A;  2ETN A;  1HKI A;  1NWT A;  1Q6U A;  1WB0 A;  3CHE A;  1QPL A;  2KI3 A;  3M7N A;  1CTN A;  1O6I A;  1FKG A;  5HTG A;  1JVW A;  3WD1 A;  3CHF A;  4IT4 A;  2ZQV A;  3WD0 A;  4P8W A;  3RM9 A;  1EIB A;  1EDQ A;  2MNT A;  3BMB A;  2XP9 A;  3ALF A;  3TC5 A;  4ODP A;  4TW8 A;  4DRQ A;  1ZK6 A;  1FAP A;  2KO7 A;  4Z2J A;  3OOB A;  4A0T A;  3NI6 A;  3L4H A;  2XP5 A;  1E6R A;  4MNL A;  3AS0 A;  2RUQ A;  2OWO A;  1TFV A;  4JFI A;  1QZ2 A;  4HBO A;  1FKD A;  2M8I A;  3ARO A;  4S3K A;  3TCZ A;  1N1A A;  4GGQ A;  4LGX A;  4L3N A;  3RFW A;  4IT6 A;  1LG1 A;  1XRV A;  1HJW A;  1JNS A;  5E65 A;  2DSV A;  3RME A;  1NMV A;  1W9V A;  2LAJ A;  4DIP A;  3O5Q A;  2YSI A;  1TK7 A;  2YSG A;  5HW7 A;  4W9P A;  1LJY A;  5D75 A;  5GQB A;  1RD6 A;  3B8S A;  4Z2I A;  2JV4 A;  1ZU8 A;  3WQV A;  3IHZ A;  1E6Z A;  1E9L A;  4WJX A;  3KAD A;  5U47 A;  3CHC A;  4DRP A;  3ARU A;  2ZQS A;  4C02 B;  5DIU A;  1H0G A;  3ODK A;  4L72 B;  3B7X A;  5DO2 A;  4Z2L A;  3PR9 A;  2UZ5 A;  3MQH A;  3CHD A;  2DPE A;  2IF4 A;  1PIN A;  5CQ2 A;  2XP7 A;  1VF8 A;  4TX0 A;  2JMF A;  2MF9 A;  1F40 A;  3QOK A;  3O5F A;  2BA1 A;  1LG2 A;  1EHN A;  2A3B A;  1FLC A;  1FFQ A;  4DWS D;  4DZ3 A;  2L4J A;  5B8I C;  4ODR A;  2WK2 A;  3WKZ A;  4W9Q A;  2ZQT A;  1W9U A;  2YSH A;  3KZ7 A;  4IQ2 A;  1R9H A;  4LAV A;  3UQB A;  2MDI A;  1FKI A;  3G6M A;  1ZBW A;  3LE4 A;  5I98 A;  1Q1C A;  4ODM A;  4DRM A;  4ODK A;  1JNE A;  3ARZ A;  2FAP A;  2KE0 A;  1F8A B;  2PI6 A;  2M8J A;  2A3E A;  3H9R B;  3WL1 A;  1T11 A;  1HKJ A;  4GLX A;  1W9P A;  2DWV A;  3AS2 A;  3EIP A;  4JFJ A;  1ZBV A;  4MAV A;  3OA5 A;  3M85 A;  1ROU A;  2XP3 A;  1IX5 A;  5DIT A;  1LL7 A;  2PN0 A;  1J6Y A;  4WKF A;  2KFW A;  2RUD A;  3O5D A;  2XP4 A;  1NSG A;  4TW6 A;  1GRJ A;  4DWS A;  2IUZ A;  4J4O A;  1D7J A;  2PPP A;  4R5E A;  3B9E A;  2YSB A;  4S3J A;  1ROT A;  4GIV A;  1UR8 A;  4P8U A;  2Y8N B;  4IQC A;  1FKR A;  2FKE A;  4P8V A;  1J4R A;  3KAF A;  3ART A;  1FKL A;  1E15 A;  1SR0 A;  3O5I A;  1JMQ A;  4DRI A;  3IKG A;  5HUA A;  1GPF A;  5GPR A;  3TDB A;  2XPA A;  3O5J A;  4BF8 A;  5DF0 A;  1M5Y A;  2DSZ A;  4ML4 A;  2D9F A;  4P8X A;  1ZBC A;  3WL0 A;  2WAD A;  1P5Q A;  1FKT A;  2DK7 A;  2DK1 A;  2PPO A;  2DMV A;  3O5P A;  2QF8 A;  2WLZ A;  1C9H A;  2AOS A;  1XHG A;  4DH0 A;  2PBC A;  2XP8 A;  1ZBK A;  3GU0 A;  4WK9 A;  2DG3 A;  1ZB5 A;  3O5K A;  4MNM A;  2KXQ A;  3AQU A;  3VAW A;  1D7I A;  1NWS A;  4UDM A;  3LKX B;  1FKF A;  5E62 A;  3JYM A;  4ODL A;  5HW6 A;  5GPG A;  3MCB A;  3ARR A;  4WIW A;  3JXV A;  3B9A A;  1W1Y A;  2EUL A;  3NRK A;  3KAC A;  3FAP A;  1X6L A;  3KCE A;  3ALG A;  1QPF A;  2AWG A;  2WLY A;  4N19 A;  3CGM A;  4HAR A;  4LAW A;  2O9O A;  1HKK A;  1NWU A;  2XP6 A;  4DRK A;  2O92 A;  3UI5 A;  4O2T A;  5HW8 A;  4ODN A;  2WAE A;  1W1V A;  4W9O A;  3FSB A;  2MLY A;  2ZAJ A;  2F4E A;  3RM4 A;  2ZR6 A;  3ARP A;  4DRJ A;  1BKF A;  2M3O W;  5HWB A;  2LGO A;  1EYM A;  2MPH A;  4ZPV R;  4LAX A;  3PRA A;  2YBT A;  2M1I A;  2KGJ A;  5HT1 A;  4Q22 A;  2Q5A A;  4Z2H A;  2DT2 A;  1HJV A;  4ZS6 A;  2PV2 A;  3WH0 A;  3O5R A;  4ITZ A;  4Q7N A;  2PV1 A;  3O5E A;  4QT2 A;  3GTY X;  2PV3 A;  1HXV A;  1D2K A;  2G8Z A;  1D7H A;  1PBK A;  2KR7 A;  2DG9 A;  2M08 A;  2YAJ B;  4FN2 A;  4U86 A;  3CZ8 A;  1FKB A;  1U79 A;  2MLZ A;  1WNO A;  1K9T A;  3ARS A;  2JX8 A;  2B5U B;  2VN1 A;  1W26 A;  2L2S A;  1OGG A;  2EZ5 W;  4NSB A;  3O5G A;  3UI4 A;  3AS1 A;  4WKH A; 
#chains in the Genus database with same CATH homology
 4W5U A;  4LAY A;  1LQ0 A;  4U85 A;  3MDY B;  3ARW A;  1EG3 A;  2RQS A;  4ZPW R;  5JH8 A;  2DT1 A;  4XAK A;  1KFW A;  1OGB A;  1UR9 A;  4MTV A;  4PTM A;  2K8I A;  3UQA A;  1RP5 A;  2QRV A;  4WKA A;  3IK8 A;  4HBE A;  1EQ3 A;  1Y0O A;  2XPB A;  4DWS C;  4IPX A;  2YBU A;  2ITK A;  3O5L A;  3KAB A;  4QIB A;  3PRD A;  3AS3 A;  3UF8 A;  2G41 A;  5E64 A;  4G2P A;  3UI6 A;  4Z2G A;  3KAI A;  2RUC A;  3JYJ A;  1B6C A;  4JFM A;  4FAP A;  2LJ4 A;  2B31 A;  2Y78 A;  1SYT A;  4DT4 A;  5HWC A;  1EG4 A;  3I6C A;  4QZV B;  3WD2 A;  2VCD A;  1E6N A;  3G6L A;  1TCO C;  2F2D A;  1H0I A;  1HJX A;  3MCB B;  1NWR A;  3LUO A;  1FKH A;  1ITX A;  3WQW A;  3WD4 A;  3O5M A;  4R0X A;  1Q6I A;  4Z2K A;  4A0U A;  5J6E A;  2F21 A;  3FSC A;  2E45 A;  1YW5 A;  5HKG A;  3PRB A;  2A3A A;  2ZQU A;  4G50 A;  1FFR A;  4ODO A;  3NTP A;  3ARV A;  3UQI A;  1WMV A;  4JYS A;  5E5W A;  4DRO A;  2JZV A;  1K9Q A;  3MQG A;  4MPK A;  4ODQ A;  1KT1 A;  2RSE A;  1FKK A;  1J4H A;  1NH6 A;  4U84 A;  2OFN A;  4DZ2 A;  1YAT A;  3ARX A;  3O5O A;  1WR7 A;  1HKM A;  3WD3 A;  3EY6 A;  4KQZ A;  3FY1 A;  3ARQ A;  4JFK A;  4MNJ A;  1TR8 A;  4DRH A;  5AHT A;  4MNK A;  3IKD A;  1KT0 A;  1W1P A;  4NZC A;  2M2A A;  2ESC A;  2PPN A;  2YSF A;  2JXW A;  1BL4 A;  1FD9 A;  1Q6H A;  2OLH A;  4TYO A;  3B9D A;  5HBF A;  3WIJ A;  4QT3 A;  5DIV A;  2A3C A;  3FS8 A;  2DJY A;  2FDM A;  3KAG A;  4JFL A;  5E66 A;  4DWS B;  1E6P A;  2WM0 A;  1O6W A;  4URI A;  4DRN A;  1LL4 A;  1ZCN A;  1FKJ A;  2DT3 A;  4TNS A;  1JNT A;  3W4R A;  2DSU A;  4E5R A;  1K9R A;  3CGN A;  3KAH A;  2LPV A;  2DSW A;  2RE3 A;  4KR0 B;  4REX A;  4AY1 A;  2ZR4 A;  3ARY A;  3CH9 A;  1X6N A;  1LL6 A;  1GOI A;  2DT0 A;  5BXJ A;  4ZPT R;  3PA7 A;  1FKS A;  2RUR A;  3RM8 A;  2LKN A;  1NMW A;  1W1T A;  4NNR A;  1WAW A;  3BXW A;  1D6O A;  1L1P A;  1GUV A;  1FJD A;  2DG4 A;  2MLX A;  1J4I A;  3LKX A;  1I5H W;  4MGV A;  2ZR5 A;  4J4N A;  3FXY A;  3PQH A;  1A7X A;  4TW7 A;  3RGC A;  3GPK A;  1ZL1 A;  2N87 A;  5DEZ A;  3CNG A;  4MSP A;  1OWQ A;  1JND A;  1HKI A;  1NWT A;  1Q6U A;  1WB0 A;  3CHE A;  1QPL A;  2KI3 A;  3M7N A;  1CTN A;  1O6I A;  1FKG A;  5HTG A;  1JVW A;  3WD1 A;  3CHF A;  4IT4 A;  2ZQV A;  3WD0 A;  4P8W A;  3RM9 A;  1EIB A;  1EDQ A;  2MNT A;  2XP9 A;  3ALF A;  3TC5 A;  4ODP A;  4TW8 A;  4DRQ A;  1ZK6 A;  1FAP A;  2KO7 A;  4Z2J A;  3OOB A;  4A0T A;  3NI6 A;  3L4H A;  2XP5 A;  1E6R A;  4MNL A;  3AS0 A;  2RUQ A;  2OWO A;  1TFV A;  4JFI A;  1QZ2 A;  4HBO A;  1FKD A;  2M8I A;  3ARO A;  4S3K A;  3TCZ A;  1N1A A;  4GGQ A;  4LGX A;  4L3N A;  3RFW A;  4IT6 A;  1LG1 A;  1XRV A;  1HJW A;  1JNS A;  5E65 A;  2DSV A;  3RME A;  1NMV A;  1W9V A;  2LAJ A;  4DIP A;  3O5Q A;  2YSI A;  1TK7 A;  2YSG A;  5HW7 A;  4W9P A;  1LJY A;  5D75 A;  5GQB A;  1RD6 A;  3B8S A;  4Z2I A;  2JV4 A;  1ZU8 A;  3WQV A;  3IHZ A;  1E6Z A;  1E9L A;  4WJX A;  3KAD A;  5U47 A;  3CHC A;  4DRP A;  3ARU A;  2ZQS A;  4C02 B;  5DIU A;  1H0G A;  3ODK A;  4L72 B;  3B7X A;  5DO2 A;  4Z2L A;  3PR9 A;  2UZ5 A;  3MQH A;  3CHD A;  2DPE A;  2IF4 A;  1PIN A;  5CQ2 A;  2XP7 A;  1VF8 A;  4TX0 A;  2JMF A;  2MF9 A;  1F40 A;  3QOK A;  3O5F A;  2BA1 A;  1LG2 A;  1EHN A;  2A3B A;  1FLC A;  1FFQ A;  4DWS D;  4DZ3 A;  2L4J A;  5B8I C;  4ODR A;  2WK2 A;  3WKZ A;  4W9Q A;  2ZQT A;  1W9U A;  2YSH A;  3KZ7 A;  4IQ2 A;  1R9H A;  4LAV A;  3UQB A;  2MDI A;  1FKI A;  3G6M A;  1ZBW A;  3LE4 A;  5I98 A;  1Q1C A;  4ODM A;  4DRM A;  4ODK A;  1JNE A;  3ARZ A;  2FAP A;  2KE0 A;  1F8A B;  2PI6 A;  2M8J A;  2A3E A;  3H9R B;  3WL1 A;  1T11 A;  1HKJ A;  4GLX A;  1W9P A;  2DWV A;  3AS2 A;  4JFJ A;  1ZBV A;  4MAV A;  3OA5 A;  3M85 A;  1ROU A;  2XP3 A;  1IX5 A;  5DIT A;  1LL7 A;  1J6Y A;  4WKF A;  2KFW A;  2RUD A;  3O5D A;  2XP4 A;  1NSG A;  4TW6 A;  4DWS A;  2IUZ A;  4J4O A;  1D7J A;  2PPP A;  4R5E A;  3B9E A;  2YSB A;  4S3J A;  1ROT A;  4GIV A;  1UR8 A;  4P8U A;  2Y8N B;  4IQC A;  1FKR A;  2FKE A;  4P8V A;  1J4R A;  3KAF A;  3ART A;  1FKL A;  1E15 A;  1SR0 A;  3O5I A;  1JMQ A;  4DRI A;  3IKG A;  5HUA A;  1GPF A;  5GPR A;  3TDB A;  2XPA A;  3O5J A;  4BF8 A;  5DF0 A;  1M5Y A;  2DSZ A;  4ML4 A;  2D9F A;  4P8X A;  1ZBC A;  3WL0 A;  2WAD A;  1P5Q A;  1FKT A;  2DK7 A;  2DK1 A;  2PPO A;  2DMV A;  3O5P A;  2QF8 A;  2WLZ A;  1C9H A;  2AOS A;  1XHG A;  4DH0 A;  2PBC A;  2XP8 A;  1ZBK A;  4WK9 A;  2DG3 A;  1ZB5 A;  3O5K A;  4MNM A;  2KXQ A;  3AQU A;  3VAW A;  1D7I A;  1NWS A;  3LKX B;  1FKF A;  5E62 A;  3JYM A;  4ODL A;  5HW6 A;  5GPG A;  3MCB A;  3ARR A;  4WIW A;  3JXV A;  3B9A A;  1W1Y A;  3NRK A;  3KAC A;  3FAP A;  1X6L A;  3KCE A;  3ALG A;  1QPF A;  2AWG A;  2WLY A;  4N19 A;  3CGM A;  4HAR A;  4LAW A;  2O9O A;  1HKK A;  1NWU A;  2XP6 A;  4DRK A;  2O92 A;  3UI5 A;  4O2T A;  5HW8 A;  4ODN A;  2WAE A;  1W1V A;  4W9O A;  3FSB A;  2MLY A;  2ZAJ A;  2F4E A;  3RM4 A;  2ZR6 A;  3ARP A;  4DRJ A;  1BKF A;  2M3O W;  5HWB A;  2LGO A;  1EYM A;  2MPH A;  4ZPV R;  4LAX A;  3PRA A;  2YBT A;  2M1I A;  2KGJ A;  5HT1 A;  4Q22 A;  2Q5A A;  4Z2H A;  2DT2 A;  1HJV A;  4ZS6 A;  2PV2 A;  3WH0 A;  3O5R A;  4ITZ A;  4Q7N A;  2PV1 A;  3O5E A;  4QT2 A;  2PV3 A;  1HXV A;  1D2K A;  2G8Z A;  1D7H A;  1PBK A;  2KR7 A;  2DG9 A;  2M08 A;  2YAJ B;  4FN2 A;  4U86 A;  3CZ8 A;  1FKB A;  1U79 A;  2MLZ A;  1WNO A;  1K9T A;  3ARS A;  2JX8 A;  2L2S A;  1W26 A;  2VN1 A;  1OGG A;  2EZ5 W;  4NSB A;  3O5G A;  3UI4 A;  3AS1 A;  4WKH A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...