3ODKA

Discovery of cell-active phenyl-imidazole pin1 inhibitors by structure-guided fragment evolution
Total Genus 42
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
42
sequence length
157
structure length
145
Chain Sequence
b'LPPGWEKAMSRSSGRVYYFNHITNASQWERPSEPARVRCSHLLVKHSQSRRPSSWRQEKITRTKEEALELINGYIQKIKSGEEDFESLASQFSDCSSAKARGDLGAFSRGQMQKPFEDASFALRTGEMSGPVFTDSGIHIILRTE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Peptidyl-prolyl cis-trans isomerase NIMA-interacting 1
molecule tags Isomerase
source organism Homo sapiens
publication title Discovery of cell-active phenyl-imidazole Pin1 inhibitors by structure-guided fragment evolution.
pubmed doi rcsb
total genus 42
structure length 145
sequence length 157
ec nomenclature ec 5.2.1.8: Peptidylprolyl isomerase.
pdb deposition date 2010-08-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00397 WW WW domain
A PF00639 Rotamase PPIC-type PPIASE domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.20.70.10 Mainly Beta Single Sheet Ubiquitin Ligase Nedd4; Chain: W; Ubiquitin Ligase Nedd4; Chain: W; 3odkA01
3.10.50.40 Alpha Beta Roll Chitinase A; domain 3 Chitinase A; domain 3 3odkA02
4DRIA 1Q6HA 2E45A 1J4RA 2ZR4A 4U85A 1QZ2A 1TCOC 1ZK6A 2RQSA 2MLXA 3M85A 1NMWA 3H9RB 3O5OA 3JXVA 4DRKA 2XPBA 2PV2A 5BXJA 4ODLA 4IQ2A 4W9PA 4BF8A 5HWBA 4DZ3A 5AHTA 3TC5A 1F8AB 3CNGA 2PV1A 3O5IA 4G50A 3KAIA 3O5RA 1FKFA 4C02B 2DG3A 3I6CA 2D9FA 2RUQA 3O5EA 4JFKA 5HW6A 2L4JA 1D7JA 1BL4A 1T11A 4DRNA 2KO7A 1JVWA 1JMQA 2M8JA 1M5YA 2JZVA 2KFWA 3L4HA 2RSEA 2KE0A 2VCDA 3MDYB 4ODMA 4DIPA 1ZCNA 5DIVA 2XP9A 2PV3A 2JMFA 1D7IA 3TDBA 1FKGA 1N1AA 2PBCA 3UI5A 1YATA 4ODKA 2F4EA 1EQ3A 1FKTA 2KI3A 4J4NA 4MSPA 1A7XA 4TW8A 5HW7A 4NNRA 4ODOA 3O5LA 3PA7A 3KADA 2L2SA 2DWVA 1P5QA 4DRQA 4DZ2A 2DG4A 2IF4A 4N19A 5HKGA 2RUCA 2M8IA 1FKIA 4LAYA 1FKLA 4MGVA 4TW6A 5HTGA 4JYSA 4FN2A 3M7NA 2JXWA 2UZ5A 2ZAJA 4QIBA 3IKDA 4IQCA 2RURA 2PPOA 2FAPA 2YSBA 1FKSA 4W9QA 3RGCA 3KABA 4JFIA 2YSGA 1FJDA 2XP4A 5CQ2A 5HUAA 1PINA 3TCZA 1JNTA 1FKKA 2M1IA 2KXQA 1QPLA 4G2PA 4REXA 2ZQTA 2VN1A 4QT2A 3FAPA 1Q6UA 2DK1A 2M08A 2ZR6A 1FD9A 3O5QA 1FAPA 4ODRA 2XP6A 2XP7A 2DG9A 5I98A 3O5JA 3KAGA 3NTPA 2LGOA 2M2AA 3O5PA 2JV4A 2ZQUA 1J4HA 4GGQA 2XPAA 2LJ4A 4DRPA 1FKRA 1Q6IA 1WR7A 5HW8A 1K9QA 3JYMA 1B6CA 3IHZA 4TNSA 4TW7A 2YSHA 3PRDA 4TYOA 1ROTA 2DMVA 2ZQVA 3LE4A 2KR7A 3OOBA 3NI6A 3PRBA 4TX0A 4DH0A 4GIVA 4DROA 2DK7A 2YSFA 3CGMA 4QT3A 1FKDA 1Q1CA 2OFNA 2MLYA 1FKBA 2N87A 1KT0A 3LUOA 2XP5A 3KCEA 4IPXA 4E5RA 2XP3A 1QPFA 5DITA 1NSGA 2PPPA 4DRMA 4J4OA 1FKHA 2RE3A 2FKEA 2KGJA 3UQIA 1F40A 1HXVA 2JX8A 3O5MA 1O6WA 1K9RA 3O5DA 1TK7A 1YW5A 4ODNA 3VAWA 1J4IA 1FKJA 4ODQA 3O5GA 1BKFA 2M3OW 1L1PA 4JFLA 2XP8A 4ITZA 5B8IC 3UI4A 3UI6A 2DJYA 4JFMA 2LPVA 4R0XA 1J6YA 4ODPA 2MLZA 2F21A 3IKGA 1KT1A 2Y78A 1D7HA 3UF8A 5J6EA 5GPGA 4DT4A 1Y0OA 1NMVA 4U86A 2K8IA 3O5FA 1PBKA 4LAXA 1D6OA 2BA1A 4U84A 4LAVA 5D75A 3JYJA 3O5KA 4O2TA 3KAHA 3EY6A 2MDIA 4JFJA 4LAWA 3KZ7A 2LAJA 2Q5AA 3UQBA 3RFWA 2AWGA 3IK8A 3WH0A 2YSIA 3KAFA 1ROUA 3GPKA 3NRKA 1WMVA 1I5HW 1JNSA 4DRHA 2MF9A 4FAPA 3UQAA 2PPNA 3CGNA 3KACA 3ODKA 2ITKA 4W9OA 5HWCA 2MNTA 1C9HA 2ZQSA 1U79A 1EYMA 5DIUA 1W26A 2MPHA 1R9HA 3B7XA 4DRJA 2RUDA 1EG4A 2ZR5A 2LKNA 2F2DA 2EZ5W 5HT1A 1EG3A
chains in the Genus database with same CATH superfamily
2RQSA 4U85A 3JXVA 2PV2A 4WIWA 2DSVA 4BF8A 1F8AB 1UR9A 1OGBA 2O92A 3AS1A 4AY1A 2WLYA 3I6CA 1D7JA 1JVWA 1JMQA 2M8JA 1M5YA 3MCBB 2KFWA 3FS8A 3WD1A 5DIVA 2JMFA 1EIBA 1EQ3A 1HKMA 2B31A 4Q22A 2KI3A 4J4NA 2AOSA 2ESCA 4DRQA 1D2KA 2DG4A 2F23A 5HKGA 4N19A 4MGVA 1HKJA 2JXWA 3WD0A 2RURA 3MQGA 5DEZA 2YSBA 1FKSA 1CTNA 3RGCA 3KABA 2XP4A 1PINA 1QPLA 4QT2A 3FAPA 2FDMA 1H0GA 1Q6UA 5GQBA 3B8SA 2ETNA 1FAPA 2G41A 1X6LA 2DG9A 3O5JA 4GGQA 2WAEA 1E9LA 3CHFA 4IT4A 1LJYA 3JYMA 4UDMA 4TNSA 3OOBA 1ITXA 4S3JA 3CGMA 4DWSA 1ZBKA 4WJXA 3G6LA 2PN0A 3KCEA 1QPFA 2DT3A 4MTVA 2DSUA 3UQIA 2KGJA 1F40A 4GLXA 1HKIA 4ODNA 4ZS6A 5HBFA 3WD2A 3UI4A 3UI6A 3FY1A 4ODPA 4Z2JA 3IKGA 3AS3A 1D7HA 1E6NA 5GPGA 5E5WA 3B9EA 4WKFA 4P8XA 1EDQA 4NZCA 5D75A 2O9OA 3AS2A 1W1TA 3UQBA 1O6IA 3GPKA 1UR8A 1I5HW 4ML4A 4DRHA 4FAPA 4W9OA 4IT6A 3ODKA 2ITKA 2MNTA 1U79A 2WK2A 2A3AA 1R9HA 4DWSD 4DRJA 2F2DA 1OWQA 4QT3A 1EG3A 5HT1A 1Q6HA 2E45A 4DRIA 2WADA 3O5OA 1EHNA 2XPBA 1W1YA 5BXJA 4ODLA 4W9PA 5HWBA 3AQUA 1HJXA 1E6ZA 3O5IA 1VF8A 1FKFA 1LL7A 3CZ8A 4C02B 4MNMA 2D9FA 3O5EA 3QOKA 4JFKA 3ARSA 3ARWA 4MNKA 5E62A 4P8VA 2JZVA 4NSBA 1W1PA 4URIA 2RSEA 4DIPA 3PQHA 4HBOA 3TDBA 1HJWA 3B9AA 4Z2GA 2PBCA 3EIPA 2DSWA 1W9VA 5HW7A 4NNRA 3KADA 2L2SA 2DWVA 1RP5A 1P5QA 3ARRA 1RD6A 2M8IA 1FKIA 2DT2A 3GU0A 4Z2IA 1ZBWA 3IKDA 4PTMA 3CHCA 1FJDA 1W9PA 2WM0A 2M1IA 2KXQA 4G2PA 4REXA 2B5UB 2QRVA 3O5QA 3ARXA 2M08A 2XP6A 2XP7A 4Z2KA 3LKXB 2DT1A 3O5PA 3RFWA 3NTPA 4ZPTR 3WD4A 4DRPA 4MNJA 2XPAA 1FFRA 1GUVA 3IHZA 3WD3A 4TW7A 2YAJB 3PRBA 2DMVA 3ALFA 3CH9A 3MCBA 4P8WA 4R5EA 3FSBA 2MLYA 1FKBA 2N87A 3LUOA 4IPXA 2XP5A 1NWUA 4E5RA 2A3CA 5DITA 3OA5A 4Q7NA 4QZVB 4J4OA 1JCHB 2WLZA 2OWOA 1HXVA 2JX8A 3O5DA 1XRVA 3WL0A 5E66A 1LQ0A 4MAVA 1LG1A 1J4IA 3O5GA 2YBUA 4MPKA 3WL1A 3G6MA 4JFMA 4R0XA 4A0UA 4S3KA 1J6YA 2MLZA 5J6EA 1NMVA 1LG2A 4LAXA 3O5FA 3JYJA 3O5KA 4O2TA 3KAHA 3EY6A 4JFJA 2IUZA 2DT0A 1JNEA 2LAJA 3WH0A 3KAFA 3NRKA 3UQAA 1X6NA 3KACA 5HWCA 1TFVA 3B7XA 1FKJA 2ZR5A 2LKNA 5B8IC 1J4RA 1QZ2A 3RM8A 1TCOC 1ZK6A 2YBTA 2MLXA 3M85A 4DRKA 3GTYX 3CNGA 2PV1A 3O5RA 2DSZA 3WIJA 3FSCA 1IX5A 2RUQA 3MQHA 1KFWA 2L4JA 1T11A 2KO7A 3L4HA 1XHGA 2VCDA 4L72B 4ODMA 1ZCNA 2PV3A 2QF8A 1NWSA 1N1AA 1SR0A 2F4EA 1FKTA 4HARA 4TW8A 3O5LA 1E15A 2G8ZA 1K9TA 2IF4A 4TW6A 4FN2A 4ZPWR 3M7NA 4MNLA 1LL4A 2ZAJA 4QIBA 1E44A 1LL6A 1ZB5A 4IQCA 1ZBVA 2PPOA 1NWRA 4A0TA 4JFIA 2YSGA 5CQ2A 4XAKA 2A3EA 1JNTA 1FKKA 4KQZA 2ZQTA 2VN1A 1ZBCA 3W4RA 1FD9A 3RM9A 2LGOA 2M2AA 1J4HA 2ZQUA 1E6PA 3WQVA 1FKRA 1Q6IA 1B6CA 4TYOA 2YSHA 1ROTA 1W1VA 3LE4A 2KR7A 2DK7A 4KR0B 2YSFA 1FKDA 1Q1CA 1JNSA 3LKXA 2XP3A 1NWTA 1NSGA 2PPPA 1FKHA 1HKKA 5GPRA 1NH6A 4Z2LA 1K9RA 1ZL1A 3VAWA 4ODQA 5E65A 4P8UA 1L1PA 2LPVA 2F21A 3PR9A 1Y0OA 4U86A 2K8IA 1PBKA 1HJVA 1JNDA 1D6OA 4U84A 3RMEA 4LAWA 1E6RA 3KZ7A 3CHDA 2AWGA 3IK8A 2YSIA 1WMVA 2MF9A 4WKHA 2PPNA 2ZQSA 1WB0A 5DIUA 2MPHA 2RUDA 1EG4A 4MSPA 2ZR4A 3ARYA 3H9RB 1TR8A 2PI6A 1NMWA 2EULA 4IQ2A 4DZ3A 5AHTA 3TC5A 4G50A 3KAIA 3WKZA 2DG3A 2DPEA 5HW6A 4DRNA 1BL4A 1WAWA 3RM4A 4WKAA 1H0IA 2KE0A 3MDYB 4ZPVR 1SYTA 2XP9A 5DF0A 1D7IA 1FKGA 3UI5A 1YATA 4ODKA 1WNOA 4L3NA 3FXYA 4W5UA 4Z2HA 3BMBA 1GRJA 1A7XA 5JH8A 4ODOA 3PA7A 3BXWA 3ARUA 4DZ2A 1FLCA 4LGXA 1OGGA 2RUCA 5HTGA 1FKLA 4DWSC 4JYSA 2UZ5A 1W9UA 2A3BA 2FAPA 4W9QA 4HBEA 4WK9A 5HUAA 1FFQA 3TCZA 3CHEA 2DK1A 4ODRA 2ZR6A 5I98A 3KAGA 4LAYA 2JV4A 3ARZA 2LJ4A 5HW8A 1WR7A 1K9QA 3PRDA 3ALGA 2ZQVA 4TX0A 4DH0A 3NI6A 3ARPA 4GIVA 4DROA 2OFNA 2OLHA 1KT0A 4DRMA 3ARQA 3ARVA 2RE3A 5DO2A 2FKEA 1GOIA 3O5MA 1O6WA 1TK7A 1YW5A 1GPFA 1BKFA 2M3OW 4JFLA 2XP8A 4ITZA 5E64A 2DJYA 1KT1A 2Y78A 3UF8A 3WQWA 4DT4A 3B9DA 2BA1A 5U47A 3ARTA 4LAVA 4DWSB 2MDIA 2Q5AA 2P4VA 1ROUA 1ZU8A 2Y8NB 3CGNA 3PRAA 3AROA 1C9HA 3AS0A 1EYMA 1W26A 2EZ5W
chains in the Genus database with same CATH topology
2RQSA 4U85A 3JXVA 2PV2A 4WIWA 2DSVA 4BF8A 1F8AB 1UR9A 1OGBA 2O92A 3AS1A 4AY1A 2WLYA 3I6CA 1D7JA 1JVWA 1JMQA 2M8JA 1M5YA 3MCBB 2KFWA 3FS8A 3WD1A 5DIVA 2JMFA 1EIBA 1EQ3A 1HKMA 2B31A 4Q22A 2KI3A 4J4NA 2AOSA 2ESCA 4DRQA 1D2KA 2DG4A 5HKGA 4N19A 4MGVA 1HKJA 2JXWA 3WD0A 2RURA 3MQGA 5DEZA 2YSBA 1FKSA 1CTNA 3RGCA 3KABA 2XP4A 1PINA 1QPLA 4QT2A 3FAPA 2FDMA 1H0GA 1Q6UA 5GQBA 3B8SA 1FAPA 2G41A 1X6LA 2DG9A 3O5JA 4GGQA 2WAEA 1E9LA 3CHFA 4IT4A 1LJYA 3JYMA 4TNSA 3OOBA 1ITXA 4S3JA 3CGMA 4DWSA 1ZBKA 4WJXA 3G6LA 3KCEA 1QPFA 2DT3A 4MTVA 2DSUA 3UQIA 2KGJA 1F40A 4GLXA 1HKIA 4ODNA 4ZS6A 5HBFA 3WD2A 3UI4A 3UI6A 3FY1A 4ODPA 4Z2JA 3IKGA 3AS3A 1D7HA 1E6NA 5GPGA 5E5WA 3B9EA 4WKFA 4P8XA 1EDQA 4NZCA 5D75A 2O9OA 3AS2A 1W1TA 3UQBA 1O6IA 3GPKA 1UR8A 1I5HW 4ML4A 4DRHA 4FAPA 4W9OA 4IT6A 3ODKA 2ITKA 2MNTA 1U79A 2WK2A 2A3AA 1R9HA 4DWSD 4DRJA 2F2DA 1OWQA 4QT3A 1EG3A 5HT1A 1Q6HA 2E45A 4DRIA 2WADA 3O5OA 1EHNA 2XPBA 1W1YA 5BXJA 4ODLA 4W9PA 5HWBA 3AQUA 1HJXA 1E6ZA 3O5IA 1VF8A 1FKFA 1LL7A 3CZ8A 4C02B 4MNMA 2D9FA 3O5EA 3QOKA 4JFKA 3ARSA 3ARWA 4MNKA 5E62A 4P8VA 2JZVA 4NSBA 1W1PA 4URIA 2RSEA 4DIPA 3PQHA 4HBOA 3TDBA 1HJWA 3B9AA 4Z2GA 2PBCA 2DSWA 1W9VA 5HW7A 4NNRA 3KADA 2L2SA 2DWVA 1RP5A 1P5QA 3ARRA 1RD6A 2M8IA 1FKIA 2DT2A 4Z2IA 1ZBWA 3IKDA 4PTMA 3CHCA 1FJDA 1W9PA 2WM0A 2M1IA 2KXQA 4G2PA 4REXA 2QRVA 3O5QA 3ARXA 2M08A 2XP6A 2XP7A 4Z2KA 3LKXB 2DT1A 3O5PA 3RFWA 3NTPA 4ZPTR 3WD4A 4DRPA 4MNJA 2XPAA 1FFRA 1GUVA 3IHZA 3WD3A 4TW7A 2YAJB 3PRBA 2DMVA 3ALFA 3CH9A 3MCBA 4P8WA 4R5EA 3FSBA 2MLYA 1FKBA 2N87A 3LUOA 4IPXA 2XP5A 1NWUA 4E5RA 2A3CA 5DITA 3OA5A 4Q7NA 4QZVB 4J4OA 2WLZA 2OWOA 1HXVA 2JX8A 3O5DA 1XRVA 3WL0A 5E66A 1LQ0A 4MAVA 1LG1A 1J4IA 3O5GA 2YBUA 4MPKA 3WL1A 3G6MA 4JFMA 4R0XA 4A0UA 4S3KA 1J6YA 2MLZA 5J6EA 1NMVA 1LG2A 4LAXA 3O5FA 3JYJA 3O5KA 4O2TA 3KAHA 3EY6A 4JFJA 2IUZA 2DT0A 1JNEA 2LAJA 3WH0A 3KAFA 3NRKA 3UQAA 1X6NA 3KACA 5HWCA 1TFVA 3B7XA 1FKJA 2ZR5A 2LKNA 5B8IC 1J4RA 1QZ2A 3RM8A 1TCOC 1ZK6A 2YBTA 2MLXA 3M85A 4DRKA 3CNGA 2PV1A 3O5RA 2DSZA 3WIJA 3FSCA 1IX5A 2RUQA 3MQHA 1KFWA 2L4JA 1T11A 2KO7A 3L4HA 1XHGA 2VCDA 4L72B 4ODMA 1ZCNA 2PV3A 2QF8A 1NWSA 1N1AA 1SR0A 2F4EA 1FKTA 4HARA 4TW8A 3O5LA 1E15A 2G8ZA 1K9TA 2IF4A 4TW6A 4FN2A 4ZPWR 3M7NA 4MNLA 1LL4A 2ZAJA 4QIBA 1LL6A 1ZB5A 4IQCA 1ZBVA 2PPOA 1NWRA 4A0TA 4JFIA 2YSGA 5CQ2A 4XAKA 2A3EA 1JNTA 1FKKA 4KQZA 2ZQTA 2VN1A 1ZBCA 3W4RA 1FD9A 3RM9A 2LGOA 2M2AA 1J4HA 2ZQUA 1E6PA 3WQVA 1FKRA 1Q6IA 1B6CA 4TYOA 2YSHA 1ROTA 1W1VA 3LE4A 2KR7A 2DK7A 4KR0B 2YSFA 1FKDA 1Q1CA 1JNSA 3LKXA 2XP3A 1NWTA 1NSGA 2PPPA 1FKHA 1HKKA 5GPRA 1NH6A 4Z2LA 1K9RA 1ZL1A 3VAWA 4ODQA 5E65A 4P8UA 1L1PA 2LPVA 2F21A 3PR9A 1Y0OA 4U86A 2K8IA 1PBKA 1HJVA 1JNDA 1D6OA 4U84A 3RMEA 4LAWA 1E6RA 3KZ7A 3CHDA 2AWGA 3IK8A 2YSIA 1WMVA 2MF9A 4WKHA 2PPNA 2ZQSA 1WB0A 5DIUA 2MPHA 2RUDA 1EG4A 4MSPA 2ZR4A 3ARYA 3H9RB 1TR8A 2PI6A 1NMWA 4IQ2A 4DZ3A 5AHTA 3TC5A 4G50A 3KAIA 3WKZA 2DG3A 2DPEA 5HW6A 4DRNA 1BL4A 1WAWA 3RM4A 4WKAA 1H0IA 2KE0A 3MDYB 4ZPVR 1SYTA 2XP9A 5DF0A 1D7IA 1FKGA 3UI5A 1YATA 4ODKA 1WNOA 4L3NA 3FXYA 4W5UA 4Z2HA 1A7XA 5JH8A 4ODOA 3PA7A 3BXWA 3ARUA 4DZ2A 1FLCA 4LGXA 1OGGA 2RUCA 5HTGA 1FKLA 4DWSC 4JYSA 1W9UA 2A3BA 2UZ5A 2FAPA 4W9QA 4HBEA 4WK9A 5HUAA 1FFQA 3TCZA 3CHEA 2DK1A 4ODRA 2ZR6A 5I98A 3KAGA 4LAYA 2JV4A 3ARZA 2LJ4A 5HW8A 1WR7A 1K9QA 3PRDA 3ALGA 2ZQVA 4TX0A 4DH0A 3NI6A 3ARPA 4GIVA 4DROA 2OFNA 2OLHA 1KT0A 4DRMA 3ARQA 3ARVA 2RE3A 5DO2A 2FKEA 1GOIA 3O5MA 1O6WA 1TK7A 1YW5A 1GPFA 1BKFA 2M3OW 4JFLA 2XP8A 4ITZA 5E64A 2DJYA 1KT1A 2Y78A 3UF8A 3WQWA 4DT4A 3B9DA 2BA1A 5U47A 3ARTA 4LAVA 4DWSB 2MDIA 2Q5AA 1ROUA 1ZU8A 2Y8NB 3CGNA 3PRAA 3AROA 1C9HA 3AS0A 1EYMA 1W26A 2EZ5W
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4DRI A;  1Q6H A;  2E45 A;  1J4R A;  2ZR4 A;  4U85 A;  1QZ2 A;  1TCO C;  1ZK6 A;  2RQS A;  2MLX A;  3M85 A;  1NMW A;  3H9R B;  3O5O A;  3JXV A;  4DRK A;  2XPB A;  2PV2 A;  5BXJ A;  4ODL A;  4IQ2 A;  4W9P A;  4BF8 A;  5HWB A;  4DZ3 A;  5AHT A;  3TC5 A;  1F8A B;  3CNG A;  2PV1 A;  3O5I A;  4G50 A;  3KAI A;  3O5R A;  1FKF A;  4C02 B;  2DG3 A;  3I6C A;  2D9F A;  2RUQ A;  3O5E A;  4JFK A;  5HW6 A;  2L4J A;  1D7J A;  1BL4 A;  1T11 A;  4DRN A;  2KO7 A;  1JVW A;  1JMQ A;  2M8J A;  1M5Y A;  2JZV A;  2KFW A;  3L4H A;  2RSE A;  2KE0 A;  2VCD A;  3MDY B;  4ODM A;  4DIP A;  1ZCN A;  5DIV A;  2XP9 A;  2PV3 A;  2JMF A;  1D7I A;  3TDB A;  1FKG A;  1N1A A;  2PBC A;  3UI5 A;  1YAT A;  4ODK A;  2F4E A;  1EQ3 A;  1FKT A;  2KI3 A;  4J4N A;  4MSP A;  1A7X A;  4TW8 A;  5HW7 A;  4NNR A;  4ODO A;  3O5L A;  3PA7 A;  3KAD A;  2L2S A;  2DWV A;  1P5Q A;  4DRQ A;  4DZ2 A;  2DG4 A;  2IF4 A;  4N19 A;  5HKG A;  2RUC A;  2M8I A;  1FKI A;  4LAY A;  1FKL A;  4MGV A;  4TW6 A;  5HTG A;  4JYS A;  4FN2 A;  3M7N A;  2JXW A;  2UZ5 A;  2ZAJ A;  4QIB A;  3IKD A;  4IQC A;  2RUR A;  2PPO A;  2FAP A;  2YSB A;  1FKS A;  4W9Q A;  3RGC A;  3KAB A;  4JFI A;  2YSG A;  1FJD A;  2XP4 A;  5CQ2 A;  5HUA A;  1PIN A;  3TCZ A;  1JNT A;  1FKK A;  2M1I A;  2KXQ A;  1QPL A;  4G2P A;  4REX A;  2ZQT A;  2VN1 A;  4QT2 A;  3FAP A;  1Q6U A;  2DK1 A;  2M08 A;  2ZR6 A;  1FD9 A;  3O5Q A;  1FAP A;  4ODR A;  2XP6 A;  2XP7 A;  2DG9 A;  5I98 A;  3O5J A;  3KAG A;  3NTP A;  2LGO A;  2M2A A;  3O5P A;  2JV4 A;  2ZQU A;  1J4H A;  4GGQ A;  2XPA A;  2LJ4 A;  4DRP A;  1FKR A;  1Q6I A;  1WR7 A;  5HW8 A;  1K9Q A;  3JYM A;  1B6C A;  3IHZ A;  4TNS A;  4TW7 A;  2YSH A;  3PRD A;  4TYO A;  1ROT A;  2DMV A;  2ZQV A;  3LE4 A;  2KR7 A;  3OOB A;  3NI6 A;  3PRB A;  4TX0 A;  4DH0 A;  4GIV A;  4DRO A;  2DK7 A;  2YSF A;  3CGM A;  4QT3 A;  1FKD A;  1Q1C A;  2OFN A;  2MLY A;  1FKB A;  2N87 A;  1KT0 A;  3LUO A;  2XP5 A;  3KCE A;  4IPX A;  4E5R A;  2XP3 A;  1QPF A;  5DIT A;  1NSG A;  2PPP A;  4DRM A;  4J4O A;  1FKH A;  2RE3 A;  2FKE A;  2KGJ A;  3UQI A;  1F40 A;  1HXV A;  2JX8 A;  3O5M A;  1O6W A;  1K9R A;  3O5D A;  1TK7 A;  1YW5 A;  4ODN A;  3VAW A;  1J4I A;  1FKJ A;  4ODQ A;  3O5G A;  1BKF A;  2M3O W;  1L1P A;  4JFL A;  2XP8 A;  4ITZ A;  5B8I C;  3UI4 A;  3UI6 A;  2DJY A;  4JFM A;  2LPV A;  4R0X A;  1J6Y A;  4ODP A;  2MLZ A;  2F21 A;  3IKG A;  1KT1 A;  2Y78 A;  1D7H A;  3UF8 A;  5J6E A;  5GPG A;  4DT4 A;  1Y0O A;  1NMV A;  4U86 A;  2K8I A;  3O5F A;  1PBK A;  4LAX A;  1D6O A;  2BA1 A;  4U84 A;  4LAV A;  5D75 A;  3JYJ A;  3O5K A;  4O2T A;  3KAH A;  3EY6 A;  2MDI A;  4JFJ A;  4LAW A;  3KZ7 A;  2LAJ A;  2Q5A A;  3UQB A;  3RFW A;  2AWG A;  3IK8 A;  3WH0 A;  2YSI A;  3KAF A;  1ROU A;  3GPK A;  3NRK A;  1WMV A;  1I5H W;  1JNS A;  4DRH A;  2MF9 A;  4FAP A;  3UQA A;  2PPN A;  3CGN A;  3KAC A;  3ODK A;  2ITK A;  4W9O A;  5HWC A;  2MNT A;  1C9H A;  2ZQS A;  1U79 A;  1EYM A;  5DIU A;  1W26 A;  2MPH A;  1R9H A;  3B7X A;  4DRJ A;  2RUD A;  1EG4 A;  2ZR5 A;  2LKN A;  2F2D A;  2EZ5 W;  5HT1 A;  1EG3 A; 
#chains in the Genus database with same CATH topology
 2RQS A;  4U85 A;  3JXV A;  2PV2 A;  4WIW A;  2DSV A;  4BF8 A;  1F8A B;  1UR9 A;  1OGB A;  2O92 A;  3AS1 A;  4AY1 A;  2WLY A;  3I6C A;  1D7J A;  1JVW A;  1JMQ A;  2M8J A;  1M5Y A;  3MCB B;  2KFW A;  3FS8 A;  3WD1 A;  5DIV A;  2JMF A;  1EIB A;  1EQ3 A;  1HKM A;  2B31 A;  4Q22 A;  2KI3 A;  4J4N A;  2AOS A;  2ESC A;  4DRQ A;  1D2K A;  2DG4 A;  2F23 A;  5HKG A;  4N19 A;  4MGV A;  1HKJ A;  2JXW A;  3WD0 A;  2RUR A;  3MQG A;  5DEZ A;  2YSB A;  1FKS A;  1CTN A;  3RGC A;  3KAB A;  2XP4 A;  1PIN A;  1QPL A;  4QT2 A;  3FAP A;  2FDM A;  1H0G A;  1Q6U A;  5GQB A;  3B8S A;  2ETN A;  1FAP A;  2G41 A;  1X6L A;  2DG9 A;  3O5J A;  4GGQ A;  2WAE A;  1E9L A;  3CHF A;  4IT4 A;  1LJY A;  3JYM A;  4UDM A;  4TNS A;  3OOB A;  1ITX A;  4S3J A;  3CGM A;  4DWS A;  1ZBK A;  4WJX A;  3G6L A;  2PN0 A;  3KCE A;  1QPF A;  2DT3 A;  4MTV A;  2DSU A;  3UQI A;  2KGJ A;  1F40 A;  4GLX A;  1HKI A;  4ODN A;  4ZS6 A;  5HBF A;  3WD2 A;  3UI4 A;  3UI6 A;  3FY1 A;  4ODP A;  4Z2J A;  3IKG A;  3AS3 A;  1D7H A;  1E6N A;  5GPG A;  5E5W A;  3B9E A;  4WKF A;  4P8X A;  1EDQ A;  4NZC A;  5D75 A;  2O9O A;  3AS2 A;  1W1T A;  3UQB A;  1O6I A;  3GPK A;  1UR8 A;  1I5H W;  4ML4 A;  4DRH A;  4FAP A;  4W9O A;  4IT6 A;  3ODK A;  2ITK A;  2MNT A;  1U79 A;  2WK2 A;  2A3A A;  1R9H A;  4DWS D;  4DRJ A;  2F2D A;  1OWQ A;  4QT3 A;  1EG3 A;  5HT1 A;  1Q6H A;  2E45 A;  4DRI A;  2WAD A;  3O5O A;  1EHN A;  2XPB A;  1W1Y A;  5BXJ A;  4ODL A;  4W9P A;  5HWB A;  3AQU A;  1HJX A;  1E6Z A;  3O5I A;  1VF8 A;  1FKF A;  1LL7 A;  3CZ8 A;  4C02 B;  4MNM A;  2D9F A;  3O5E A;  3QOK A;  4JFK A;  3ARS A;  3ARW A;  4MNK A;  5E62 A;  4P8V A;  2JZV A;  4NSB A;  1W1P A;  4URI A;  2RSE A;  4DIP A;  3PQH A;  4HBO A;  3TDB A;  1HJW A;  3B9A A;  4Z2G A;  2PBC A;  3EIP A;  2DSW A;  1W9V A;  5HW7 A;  4NNR A;  3KAD A;  2L2S A;  2DWV A;  1RP5 A;  1P5Q A;  3ARR A;  1RD6 A;  2M8I A;  1FKI A;  2DT2 A;  3GU0 A;  4Z2I A;  1ZBW A;  3IKD A;  4PTM A;  3CHC A;  1FJD A;  1W9P A;  2WM0 A;  2M1I A;  2KXQ A;  4G2P A;  4REX A;  2B5U B;  2QRV A;  3O5Q A;  3ARX A;  2M08 A;  2XP6 A;  2XP7 A;  4Z2K A;  3LKX B;  2DT1 A;  3O5P A;  3RFW A;  3NTP A;  4ZPT R;  3WD4 A;  4DRP A;  4MNJ A;  2XPA A;  1FFR A;  1GUV A;  3IHZ A;  3WD3 A;  4TW7 A;  2YAJ B;  3PRB A;  2DMV A;  3ALF A;  3CH9 A;  3MCB A;  4P8W A;  4R5E A;  3FSB A;  2MLY A;  1FKB A;  2N87 A;  3LUO A;  4IPX A;  2XP5 A;  1NWU A;  4E5R A;  2A3C A;  5DIT A;  3OA5 A;  4Q7N A;  4QZV B;  4J4O A;  1JCH B;  2WLZ A;  2OWO A;  1HXV A;  2JX8 A;  3O5D A;  1XRV A;  3WL0 A;  5E66 A;  1LQ0 A;  4MAV A;  1LG1 A;  1J4I A;  3O5G A;  2YBU A;  4MPK A;  3WL1 A;  3G6M A;  4JFM A;  4R0X A;  4A0U A;  4S3K A;  1J6Y A;  2MLZ A;  5J6E A;  1NMV A;  1LG2 A;  4LAX A;  3O5F A;  3JYJ A;  3O5K A;  4O2T A;  3KAH A;  3EY6 A;  4JFJ A;  2IUZ A;  2DT0 A;  1JNE A;  2LAJ A;  3WH0 A;  3KAF A;  3NRK A;  3UQA A;  1X6N A;  3KAC A;  5HWC A;  1TFV A;  3B7X A;  1FKJ A;  2ZR5 A;  2LKN A;  5B8I C;  1J4R A;  1QZ2 A;  3RM8 A;  1TCO C;  1ZK6 A;  2YBT A;  2MLX A;  3M85 A;  4DRK A;  3GTY X;  3CNG A;  2PV1 A;  3O5R A;  2DSZ A;  3WIJ A;  3FSC A;  1IX5 A;  2RUQ A;  3MQH A;  1KFW A;  2L4J A;  1T11 A;  2KO7 A;  3L4H A;  1XHG A;  2VCD A;  4L72 B;  4ODM A;  1ZCN A;  2PV3 A;  2QF8 A;  1NWS A;  1N1A A;  1SR0 A;  2F4E A;  1FKT A;  4HAR A;  4TW8 A;  3O5L A;  1E15 A;  2G8Z A;  1K9T A;  2IF4 A;  4TW6 A;  4FN2 A;  4ZPW R;  3M7N A;  4MNL A;  1LL4 A;  2ZAJ A;  4QIB A;  1E44 A;  1LL6 A;  1ZB5 A;  4IQC A;  1ZBV A;  2PPO A;  1NWR A;  4A0T A;  4JFI A;  2YSG A;  5CQ2 A;  4XAK A;  2A3E A;  1JNT A;  1FKK A;  4KQZ A;  2ZQT A;  2VN1 A;  1ZBC A;  3W4R A;  1FD9 A;  3RM9 A;  2LGO A;  2M2A A;  1J4H A;  2ZQU A;  1E6P A;  3WQV A;  1FKR A;  1Q6I A;  1B6C A;  4TYO A;  2YSH A;  1ROT A;  1W1V A;  3LE4 A;  2KR7 A;  2DK7 A;  4KR0 B;  2YSF A;  1FKD A;  1Q1C A;  1JNS A;  3LKX A;  2XP3 A;  1NWT A;  1NSG A;  2PPP A;  1FKH A;  1HKK A;  5GPR A;  1NH6 A;  4Z2L A;  1K9R A;  1ZL1 A;  3VAW A;  4ODQ A;  5E65 A;  4P8U A;  1L1P A;  2LPV A;  2F21 A;  3PR9 A;  1Y0O A;  4U86 A;  2K8I A;  1PBK A;  1HJV A;  1JND A;  1D6O A;  4U84 A;  3RME A;  4LAW A;  1E6R A;  3KZ7 A;  3CHD A;  2AWG A;  3IK8 A;  2YSI A;  1WMV A;  2MF9 A;  4WKH A;  2PPN A;  2ZQS A;  1WB0 A;  5DIU A;  2MPH A;  2RUD A;  1EG4 A;  4MSP A;  2ZR4 A;  3ARY A;  3H9R B;  1TR8 A;  2PI6 A;  1NMW A;  2EUL A;  4IQ2 A;  4DZ3 A;  5AHT A;  3TC5 A;  4G50 A;  3KAI A;  3WKZ A;  2DG3 A;  2DPE A;  5HW6 A;  4DRN A;  1BL4 A;  1WAW A;  3RM4 A;  4WKA A;  1H0I A;  2KE0 A;  3MDY B;  4ZPV R;  1SYT A;  2XP9 A;  5DF0 A;  1D7I A;  1FKG A;  3UI5 A;  1YAT A;  4ODK A;  1WNO A;  4L3N A;  3FXY A;  4W5U A;  4Z2H A;  3BMB A;  1GRJ A;  1A7X A;  5JH8 A;  4ODO A;  3PA7 A;  3BXW A;  3ARU A;  4DZ2 A;  1FLC A;  4LGX A;  1OGG A;  2RUC A;  5HTG A;  1FKL A;  4DWS C;  4JYS A;  2UZ5 A;  1W9U A;  2A3B A;  2FAP A;  4W9Q A;  4HBE A;  4WK9 A;  5HUA A;  1FFQ A;  3TCZ A;  3CHE A;  2DK1 A;  4ODR A;  2ZR6 A;  5I98 A;  3KAG A;  4LAY A;  2JV4 A;  3ARZ A;  2LJ4 A;  5HW8 A;  1WR7 A;  1K9Q A;  3PRD A;  3ALG A;  2ZQV A;  4TX0 A;  4DH0 A;  3NI6 A;  3ARP A;  4GIV A;  4DRO A;  2OFN A;  2OLH A;  1KT0 A;  4DRM A;  3ARQ A;  3ARV A;  2RE3 A;  5DO2 A;  2FKE A;  1GOI A;  3O5M A;  1O6W A;  1TK7 A;  1YW5 A;  1GPF A;  1BKF A;  2M3O W;  4JFL A;  2XP8 A;  4ITZ A;  5E64 A;  2DJY A;  1KT1 A;  2Y78 A;  3UF8 A;  3WQW A;  4DT4 A;  3B9D A;  2BA1 A;  5U47 A;  3ART A;  4LAV A;  4DWS B;  2MDI A;  2Q5A A;  2P4V A;  1ROU A;  1ZU8 A;  2Y8N B;  3CGN A;  3PRA A;  3ARO A;  1C9H A;  3AS0 A;  1EYM A;  1W26 A;  2EZ5 W; 
#chains in the Genus database with same CATH homology
 2RQS A;  4U85 A;  3JXV A;  2PV2 A;  4WIW A;  2DSV A;  4BF8 A;  1F8A B;  1UR9 A;  1OGB A;  2O92 A;  3AS1 A;  4AY1 A;  2WLY A;  3I6C A;  1D7J A;  1JVW A;  1JMQ A;  2M8J A;  1M5Y A;  3MCB B;  2KFW A;  3FS8 A;  3WD1 A;  5DIV A;  2JMF A;  1EIB A;  1EQ3 A;  1HKM A;  2B31 A;  4Q22 A;  2KI3 A;  4J4N A;  2AOS A;  2ESC A;  4DRQ A;  1D2K A;  2DG4 A;  5HKG A;  4N19 A;  4MGV A;  1HKJ A;  2JXW A;  3WD0 A;  2RUR A;  3MQG A;  5DEZ A;  2YSB A;  1FKS A;  1CTN A;  3RGC A;  3KAB A;  2XP4 A;  1PIN A;  1QPL A;  4QT2 A;  3FAP A;  2FDM A;  1H0G A;  1Q6U A;  5GQB A;  3B8S A;  1FAP A;  2G41 A;  1X6L A;  2DG9 A;  3O5J A;  4GGQ A;  2WAE A;  1E9L A;  3CHF A;  4IT4 A;  1LJY A;  3JYM A;  4TNS A;  3OOB A;  1ITX A;  4S3J A;  3CGM A;  4DWS A;  1ZBK A;  4WJX A;  3G6L A;  3KCE A;  1QPF A;  2DT3 A;  4MTV A;  2DSU A;  3UQI A;  2KGJ A;  1F40 A;  4GLX A;  1HKI A;  4ODN A;  4ZS6 A;  5HBF A;  3WD2 A;  3UI4 A;  3UI6 A;  3FY1 A;  4ODP A;  4Z2J A;  3IKG A;  3AS3 A;  1D7H A;  1E6N A;  5GPG A;  5E5W A;  3B9E A;  4WKF A;  4P8X A;  1EDQ A;  4NZC A;  5D75 A;  2O9O A;  3AS2 A;  1W1T A;  3UQB A;  1O6I A;  3GPK A;  1UR8 A;  1I5H W;  4ML4 A;  4DRH A;  4FAP A;  4W9O A;  4IT6 A;  3ODK A;  2ITK A;  2MNT A;  1U79 A;  2WK2 A;  2A3A A;  1R9H A;  4DWS D;  4DRJ A;  2F2D A;  1OWQ A;  4QT3 A;  1EG3 A;  5HT1 A;  1Q6H A;  2E45 A;  4DRI A;  2WAD A;  3O5O A;  1EHN A;  2XPB A;  1W1Y A;  5BXJ A;  4ODL A;  4W9P A;  5HWB A;  3AQU A;  1HJX A;  1E6Z A;  3O5I A;  1VF8 A;  1FKF A;  1LL7 A;  3CZ8 A;  4C02 B;  4MNM A;  2D9F A;  3O5E A;  3QOK A;  4JFK A;  3ARS A;  3ARW A;  4MNK A;  5E62 A;  4P8V A;  2JZV A;  4NSB A;  1W1P A;  4URI A;  2RSE A;  4DIP A;  3PQH A;  4HBO A;  3TDB A;  1HJW A;  3B9A A;  4Z2G A;  2PBC A;  2DSW A;  1W9V A;  5HW7 A;  4NNR A;  3KAD A;  2L2S A;  2DWV A;  1RP5 A;  1P5Q A;  3ARR A;  1RD6 A;  2M8I A;  1FKI A;  2DT2 A;  4Z2I A;  1ZBW A;  3IKD A;  4PTM A;  3CHC A;  1FJD A;  1W9P A;  2WM0 A;  2M1I A;  2KXQ A;  4G2P A;  4REX A;  2QRV A;  3O5Q A;  3ARX A;  2M08 A;  2XP6 A;  2XP7 A;  4Z2K A;  3LKX B;  2DT1 A;  3O5P A;  3RFW A;  3NTP A;  4ZPT R;  3WD4 A;  4DRP A;  4MNJ A;  2XPA A;  1FFR A;  1GUV A;  3IHZ A;  3WD3 A;  4TW7 A;  2YAJ B;  3PRB A;  2DMV A;  3ALF A;  3CH9 A;  3MCB A;  4P8W A;  4R5E A;  3FSB A;  2MLY A;  1FKB A;  2N87 A;  3LUO A;  4IPX A;  2XP5 A;  1NWU A;  4E5R A;  2A3C A;  5DIT A;  3OA5 A;  4Q7N A;  4QZV B;  4J4O A;  2WLZ A;  2OWO A;  1HXV A;  2JX8 A;  3O5D A;  1XRV A;  3WL0 A;  5E66 A;  1LQ0 A;  4MAV A;  1LG1 A;  1J4I A;  3O5G A;  2YBU A;  4MPK A;  3WL1 A;  3G6M A;  4JFM A;  4R0X A;  4A0U A;  4S3K A;  1J6Y A;  2MLZ A;  5J6E A;  1NMV A;  1LG2 A;  4LAX A;  3O5F A;  3JYJ A;  3O5K A;  4O2T A;  3KAH A;  3EY6 A;  4JFJ A;  2IUZ A;  2DT0 A;  1JNE A;  2LAJ A;  3WH0 A;  3KAF A;  3NRK A;  3UQA A;  1X6N A;  3KAC A;  5HWC A;  1TFV A;  3B7X A;  1FKJ A;  2ZR5 A;  2LKN A;  5B8I C;  1J4R A;  1QZ2 A;  3RM8 A;  1TCO C;  1ZK6 A;  2YBT A;  2MLX A;  3M85 A;  4DRK A;  3CNG A;  2PV1 A;  3O5R A;  2DSZ A;  3WIJ A;  3FSC A;  1IX5 A;  2RUQ A;  3MQH A;  1KFW A;  2L4J A;  1T11 A;  2KO7 A;  3L4H A;  1XHG A;  2VCD A;  4L72 B;  4ODM A;  1ZCN A;  2PV3 A;  2QF8 A;  1NWS A;  1N1A A;  1SR0 A;  2F4E A;  1FKT A;  4HAR A;  4TW8 A;  3O5L A;  1E15 A;  2G8Z A;  1K9T A;  2IF4 A;  4TW6 A;  4FN2 A;  4ZPW R;  3M7N A;  4MNL A;  1LL4 A;  2ZAJ A;  4QIB A;  1LL6 A;  1ZB5 A;  4IQC A;  1ZBV A;  2PPO A;  1NWR A;  4A0T A;  4JFI A;  2YSG A;  5CQ2 A;  4XAK A;  2A3E A;  1JNT A;  1FKK A;  4KQZ A;  2ZQT A;  2VN1 A;  1ZBC A;  3W4R A;  1FD9 A;  3RM9 A;  2LGO A;  2M2A A;  1J4H A;  2ZQU A;  1E6P A;  3WQV A;  1FKR A;  1Q6I A;  1B6C A;  4TYO A;  2YSH A;  1ROT A;  1W1V A;  3LE4 A;  2KR7 A;  2DK7 A;  4KR0 B;  2YSF A;  1FKD A;  1Q1C A;  1JNS A;  3LKX A;  2XP3 A;  1NWT A;  1NSG A;  2PPP A;  1FKH A;  1HKK A;  5GPR A;  1NH6 A;  4Z2L A;  1K9R A;  1ZL1 A;  3VAW A;  4ODQ A;  5E65 A;  4P8U A;  1L1P A;  2LPV A;  2F21 A;  3PR9 A;  1Y0O A;  4U86 A;  2K8I A;  1PBK A;  1HJV A;  1JND A;  1D6O A;  4U84 A;  3RME A;  4LAW A;  1E6R A;  3KZ7 A;  3CHD A;  2AWG A;  3IK8 A;  2YSI A;  1WMV A;  2MF9 A;  4WKH A;  2PPN A;  2ZQS A;  1WB0 A;  5DIU A;  2MPH A;  2RUD A;  1EG4 A;  4MSP A;  2ZR4 A;  3ARY A;  3H9R B;  1TR8 A;  2PI6 A;  1NMW A;  4IQ2 A;  4DZ3 A;  5AHT A;  3TC5 A;  4G50 A;  3KAI A;  3WKZ A;  2DG3 A;  2DPE A;  5HW6 A;  4DRN A;  1BL4 A;  1WAW A;  3RM4 A;  4WKA A;  1H0I A;  2KE0 A;  3MDY B;  4ZPV R;  1SYT A;  2XP9 A;  5DF0 A;  1D7I A;  1FKG A;  3UI5 A;  1YAT A;  4ODK A;  1WNO A;  4L3N A;  3FXY A;  4W5U A;  4Z2H A;  1A7X A;  5JH8 A;  4ODO A;  3PA7 A;  3BXW A;  3ARU A;  4DZ2 A;  1FLC A;  4LGX A;  1OGG A;  2RUC A;  5HTG A;  1FKL A;  4DWS C;  4JYS A;  1W9U A;  2A3B A;  2UZ5 A;  2FAP A;  4W9Q A;  4HBE A;  4WK9 A;  5HUA A;  1FFQ A;  3TCZ A;  3CHE A;  2DK1 A;  4ODR A;  2ZR6 A;  5I98 A;  3KAG A;  4LAY A;  2JV4 A;  3ARZ A;  2LJ4 A;  5HW8 A;  1WR7 A;  1K9Q A;  3PRD A;  3ALG A;  2ZQV A;  4TX0 A;  4DH0 A;  3NI6 A;  3ARP A;  4GIV A;  4DRO A;  2OFN A;  2OLH A;  1KT0 A;  4DRM A;  3ARQ A;  3ARV A;  2RE3 A;  5DO2 A;  2FKE A;  1GOI A;  3O5M A;  1O6W A;  1TK7 A;  1YW5 A;  1GPF A;  1BKF A;  2M3O W;  4JFL A;  2XP8 A;  4ITZ A;  5E64 A;  2DJY A;  1KT1 A;  2Y78 A;  3UF8 A;  3WQW A;  4DT4 A;  3B9D A;  2BA1 A;  5U47 A;  3ART A;  4LAV A;  4DWS B;  2MDI A;  2Q5A A;  1ROU A;  1ZU8 A;  2Y8N B;  3CGN A;  3PRA A;  3ARO A;  1C9H A;  3AS0 A;  1EYM A;  1W26 A;  2EZ5 W; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...