2F21A

Human pin1 fip mutant
Total Genus 48
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
48
sequence length
162
structure length
153
Chain Sequence
MADEEKLPPGWEKRMSADGRVYYFNHITNASQWERPSGQGEPARVRCSHLLVKHSQSRRPSSWRQEKITRTKEEALELINGYIQKIKSGEEDFESLASQFSDCSSAKARGDLGAFSRGQMQKPFEDASFALRTGEMSGPVFTDSGIHIILRTE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure-function-folding relationship in a WW domain.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Isomerase
molecule keywords Peptidyl-prolyl cis-trans isomerase NIMA-interacting 1
total genus 48
structure length 153
sequence length 162
ec nomenclature ec 5.2.1.8: Peptidylprolyl isomerase.
pdb deposition date 2005-11-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00397 WW WW domain
A PF00639 Rotamase PPIC-type PPIASE domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.20.70.10 Mainly Beta Single Sheet Ubiquitin Ligase Nedd4; Chain: W; Ubiquitin Ligase Nedd4; Chain: W; 2f21A01
3.10.50.40 Alpha Beta Roll Chitinase A; domain 3 Chitinase A; domain 3 2f21A02
2JV4A 2XP7A 1J4HA 2XP5A 2VN1A 5DIVA 4J4NA 5GPGA 4DRNA 2PV3A 4O2TA 3LE4A 3NI6A 4ODNA 1FKIA 3TC5A 1ZCNA 2L4JA 1D7HA 4DIPA 1Q6HA 4FN2A 3L4HA 4DRPA 4IQ2A 2PPPA 1HXVA 1F8AB 4JYSA 2Q5AA 3UI5A 1EG4A 2XP3A 5AHTA 3M85A 4QIBA 4REXA 4DZ2A 2DK1A 3OOBA 1D7JA 2MLYA 2BA1A 1Q6IA 2JX8A 1QPLA 3JYMA 4ODLA 2MLZA 3RGCA 5BXJA 2RUQA 5HTGA 3PRBA 2KXQA 4FAPA 2DJYA 5J6EA 4DRHA 3EY6A 4ODKA 3LUOA 5HWBA 2F4EA 5D75A 1EG3A 2KFWA 2FKEA 2IF4A 2LAJA 3O5FA 2N87A 3JXVA 1C9HA 4DT4A 2XP4A 1Q6UA 1Q1CA 2YSIA 4TNSA 1L1PA 3O5DA 2DK7A 2DMVA 4DRQA 1O6WA 2AWGA 4IQCA 2F21A 4ODRA 4R0XA 4TW6A 4BF8A 1NMVA 2ZQUA 1FKTA 3O5PA 2MPHA 1BL4A 1NSGA 2RUCA 4DRMA 1D7IA 3KABA 4N19A 2L2SA 3GPKA 5HW8A 1A7XA 2ITKA 2XP8A 4U86A 1J4IA 1KT1A 4MSPA 2D9FA 2LGOA 2ZR6A 2ZQVA 2XPBA 4DH0A 3UQAA 3KZ7A 5HW7A 2XPAA 1WMVA 3JYJA 3IKDA 4QT3A 4ITZA 1I5HW 3KADA 3CGMA 4ODOA 1U79A 2K8IA 1ROUA 4DRKA 1FKJA 3FAPA 4E5RA 4JFMA 3UI6A 1B6CA 2JMFA 3MDYB 2ZQTA 3KAFA 2ZAJA 3KAHA 1BKFA 1JNTA 1YATA 4ODMA 4LAWA 2DG9A 3UF8A 5HWCA 1YW5A 2M1IA 3KACA 5CQ2A 3H9RB 4JFJA 4LAXA 2YSFA 2MDIA 3O5RA 2PV1A 4DRJA 2ZR4A 1FKLA 4G2PA 3PRDA 3VAWA 4W9PA 5HUAA 1J6YA 1EQ3A 2ZR5A 1FKRA 1FKFA 1KT0A 2RURA 2RE3A 2PPNA 3O5QA 4DRIA 2JZVA 2LPVA 2M8IA 4DZ3A 3TCZA 5DITA 1TCOC 3CGNA 4JFLA 4W9QA 5HT1A 1FD9A 2MF9A 4MGVA 4J4OA 3NTPA 1FKDA 2MNTA 1T11A 2M2AA 3O5IA 4NNRA 2E45A 4ODPA 1FKSA 3UQIA 1FKHA 3KCEA 3M7NA 1NMWA 2DG4A 2KI3A 2LJ4A 3O5GA 2DG3A 5B8IC 5HKGA 4DROA 5I98A 4U84A 4TX0A 2UZ5A 1FKGA 1W26A 1JVWA 2KR7A 3B7XA 3O5MA 3PA7A 2JXWA 1D6OA 4C02B 1FKKA 2RQSA 2ZQSA 3TDBA 2Y78A 1M5YA 1N1AA 1EYMA 1R9HA 1P5QA 3O5EA 1ROTA 5HW6A 4U85A 2M08A 5DIUA 1JMQA 2KE0A 2PV2A 2M3OW 4GIVA 2RSEA 4G50A 1QZ2A 3KAIA 1K9QA 2MLXA 3KAGA 1PBKA 3O5KA 3O5JA 4W9OA 2PBCA 3IKGA 3RFWA 2KO7A 2YSBA 3UQBA 3UI4A 2DWVA 1FAPA 1FKBA 1Y0OA 2PPOA 2KGJA 3IK8A 4TW8A 4TYOA 2OFNA 4LAVA 1PINA 1JNSA 3CNGA 4IPXA 2RUDA 4GGQA 3O5OA 2YSHA 4JFIA 4ODQA 1F40A 2XP9A 1WR7A 3ODKA 1J4RA 2YSGA 1FJDA 4QT2A 4LAYA 1TK7A 3I6CA 2EZ5W 2F2DA 4TW7A 3O5LA 3WH0A 2VCDA 1QPFA 3IHZA 3NRKA 2LKNA 4JFKA 2XP6A 1ZK6A 2FAPA 1K9RA 2M8JA
chains in the Genus database with same CATH superfamily
2JV4A 2B31A 1ZBWA 5DIVA 4J4NA 1H0GA 1LL7A 3NI6A 1NWTA 2WM0A 3TC5A 1SR0A 2L4JA 4URIA 4DRPA 4IQ2A 2P4VA 1TR8A 2YBTA 4QZVB 3M85A 4QIBA 3GU0A 1LG2A 3MCBA 5E62A 1GUVA 2MLZA 3RGCA 4FAPA 4DRHA 1VF8A 5E64A 2KFWA 2LAJA 1C9HA 4DT4A 1Q1CA 3ARRA 1L1PA 1W9VA 4Z2IA 1UR9A 2ZQUA 3O5PA 4ML4A 1BL4A 1D7IA 5HW8A 2XP8A 1KT1A 1ITXA 2ZR6A 2ZQVA 2XPBA 5HW7A 3IKDA 5HBFA 4ODOA 4Z2HA 3UI6A 2A3AA 1BKFA 4ODMA 5HWCA 4JFJA 4LAXA 2F23A 3GTYX 2MDIA 1EIBA 4G2PA 3VAWA 3PRDA 3WL1A 4W9PA 1LJYA 1FKFA 1KT0A 2RE3A 2PPNA 4HARA 2ESCA 1JNDA 5HT1A 4MNMA 5GPRA 2MNTA 3FSBA 1T11A 2M2AA 1FKSA 2DSZA 3O5GA 2LJ4A 1X6LA 3CH9A 5I98A 2ETNA 2UZ5A 1W26A 1JVWA 3ARSA 3B7XA 4WKHA 1FKKA 3TDBA 1R9HA 3AROA 2M08A 5DIUA 1JMQA 4Z2GA 1EQ3A 2DT0A 3KAIA 3G6MA 2MLXA 3O5KA 1SYTA 2PBCA 1E9LA 3ARUA 3IKGA 4PTMA 1OGBA 1FKBA 3FSCA 4DWSC 3IK8A 2WK2A 3MCBB 1PINA 3O5OA 3PQHA 2XP9A 3ODKA 5DEZA 2A3EA 3WD3A 5JH8A 1FJDA 1RP5A 3FXYA 3QOKA 2VCDA 1LL6A 1QPFA 3NRKA 1K9TA 5E66A 2XP6A 3ARYA 1H0IA 2AOSA 2VN1A 2XP5A 2IUZA 4NSBA 4Q7NA 1HJVA 1D7HA 2A3CA 3CHEA 1Q6HA 4DIPA 3L4HA 2EULA 2PPPA 1HXVA 1F8AB 1EG4A 2XP3A 3OOBA 3EIPA 2BA1A 5BXJA 5HTGA 4DWSA 2KXQA 2DJYA 1HJXA 2F4EA 5D75A 2IF4A 2N87A 4MNKA 5DO2A 1X6NA 1O6IA 4WK9A 2Y8NB 3O5DA 4A0TA 2AWGA 4R0XA 4TW6A 4HBEA 2MPHA 2RUCA 1ZB5A 4N19A 4IT6A 4P8XA 4ZPTR 2XPAA 4QT3A 1I5HW 3CGMA 3RM4A 1ROUA 4DRKA 4JFMA 1GOIA 2YAJB 3MDYB 1YATA 3KAFA 2ZAJA 3KAHA 1JNTA 2DG9A 1YW5A 5CQ2A 1HKKA 3ALFA 2O92A 2YSFA 2WAEA 2ZR4A 1EDQA 2DSUA 2QF8A 4DRMA 3O5QA 4DRIA 1HKIA 3CGNA 4J4OA 3NTPA 1CTNA 4A0UA 3WQWA 3CHFA 1FKHA 3KCEA 1NMWA 2KI3A 2DG3A 4DROA 4U84A 1FKGA 1E6RA 1W1PA 1WAWA 4C02B 2ZQSA 1N1AA 1EYMA 3B9DA 3O5EA 3WIJA 4GIVA 3FY1A 3G6LA 3UI4A 2DWVA 5U47A 4P8VA 4IPXA 2RUDA 4GGQA 4ODQA 2WADA 2EZ5W 1ZBCA 3O5LA 4DWSB 3MQHA 1XHGA 2LKNA 4L3NA 1ZK6A 3AS2A 2M8JA 4L72B 4WKFA 3B8SA 4DRNA 5GPGA 2PV3A 4ODNA 1FKIA 3B9EA 1JCHB 4NZCA 1ZCNA 4FN2A 3ALGA 3WD0A 5AHTA 4REXA 1D7JA 1Q6IA 2JX8A 1QPLA 2FDMA 3PRBA 3RM9A 1IX5A 3ARQA 3O5FA 4R5EA 1Q6UA 2YSIA 3LKXA 2DK7A 2DMVA 1O6WA 5HUAA 4ODRA 1LL4A 4BF8A 5DF0A 5GQBA 1W1TA 4KR0B 1WB0A 1W9UA 1RD6A 2L2SA 3GPKA 1A7XA 1FLCA 4U86A 1E15A 3BXWA 4MSPA 2YBUA 3WD2A 1GRJA 4DH0A 3UQAA 2DT2A 4MPKA 1JNEA 4ITZA 3KADA 1U79A 2K8IA 1ZL1A 4E5RA 3FAPA 1HKJA 3WKZA 3ARVA 4MTVA 3O5RA 2PV1A 4Z2KA 4WIWA 3CZ8A 2ZR5A 2RURA 4MAVA 2JZVA 2LPVA 3CHCA 3TCZA 1ZBVA 5DITA 4Z2JA 4JFLA 4W9QA 1UR8A 3AS3A 1FD9A 2MF9A 2B5UB 4ZPWR 3O5IA 4NNRA 4ODPA 4S3KA 4ZPVR 3M7NA 5HKGA 2DG4A 5B8IC 3CHDA 2G8ZA 4W5UA 2WLYA 1KFWA 4TX0A 3LKXB 2KR7A 4MNLA 2PI6A 2JXWA 1E44A 1M5YA 5HW6A 1ROTA 5J6EA 2M3OW 2WLZA 2RSEA 2G41A 3KAGA 1PBKA 3O5JA 4S3JA 3PRAA 2YSBA 3FS8A 2PN0A 3OA5A 2PPOA 3ARXA 2OFNA 1GPFA 1JNSA 4JFIA 2YSHA 1F40A 3B9AA 1WR7A 2YSGA 1ZBKA 4QT2A 4LAYA 1E6PA 1TK7A 3I6CA 3WD1A 2F2DA 4AY1A 3WH0A 4LGXA 4DWSD 4XAKA 4JFKA 1NWRA 2OWOA 2FAPA 1K9RA 1EG3A 3AS0A 4GLXA 3ARTA 2QRVA 2XP7A 1J4HA 3RMEA 1LQ0A 3AS1A 3LE4A 3PR9A 3MQGA 1XRVA 4JYSA 2Q5AA 2DT3A 3UI5A 3WL0A 4DZ2A 1W1VA 1HKMA 2DK1A 2MLYA 4ODLA 3JYMA 4WKAA 4IT4A 2RUQA 1EHNA 3EY6A 4ODKA 3LUOA 3WD4A 5HWBA 1LG1A 4HBOA 2FKEA 3JXVA 2XP4A 1OGGA 1NWSA 4TNSA 4DRQA 1WNOA 4IQCA 2F21A 1NMVA 1FKTA 1NSGA 3KABA 3WQVA 1FFQA 2ITKA 1J4IA 5E65A 1OWQA 2D9FA 2LGOA 3KZ7A 1HJWA 1WMVA 3JYJA 4MNJA 1FKJA 1B6CA 2JMFA 2ZQTA 3W4RA 4LAWA 3UF8A 2OLHA 2M1IA 3KACA 3H9RB 3ARWA 4DRJA 1FKLA 1J6YA 1FKRA 4DZ3A 2M8IA 4ZS6A 1E6ZA 1D2KA 1TCOC 5E5WA 4UDMA 1TFVA 2DSVA 2DSWA 4MGVA 1FKDA 2E45A 1NWUA 4Q22A 3UQIA 1W9PA 2O9OA 2A3BA 2DPEA 3ARPA 3PA7A 3O5MA 4Z2LA 1D6OA 1E6NA 2RQSA 2Y78A 1P5QA 4U85A 2KE0A 2PV2A 4G50A 3RM8A 1QZ2A 1K9QA 4W9OA 3RFWA 2DT1A 2KO7A 3UQBA 1FAPA 1Y0OA 2KGJA 4KQZA 4TW8A 4P8WA 4TYOA 4WJXA 4LAVA 3BMBA 3CNGA 3AQUA 1J4RA 1ZU8A 1W1YA 4P8UA 3ARZA 1NH6A 3IHZA 1FFRA 4O2TA 4TW7A
chains in the Genus database with same CATH topology
2JV4A 2B31A 1ZBWA 5DIVA 4J4NA 1H0GA 1LL7A 3NI6A 1NWTA 2WM0A 3TC5A 1SR0A 2L4JA 4URIA 4DRPA 4IQ2A 1TR8A 2YBTA 4QZVB 3M85A 4QIBA 1LG2A 3MCBA 5E62A 1GUVA 2MLZA 3RGCA 4FAPA 4DRHA 1VF8A 5E64A 2KFWA 2LAJA 1C9HA 4DT4A 1Q1CA 3ARRA 1L1PA 1W9VA 4Z2IA 1UR9A 2ZQUA 3O5PA 4ML4A 1BL4A 1D7IA 5HW8A 2XP8A 1KT1A 1ITXA 2ZR6A 2ZQVA 2XPBA 5HW7A 3IKDA 5HBFA 4ODOA 4Z2HA 3UI6A 2A3AA 1BKFA 4ODMA 5HWCA 4JFJA 4LAXA 2MDIA 1EIBA 4G2PA 3VAWA 3PRDA 3WL1A 4W9PA 1LJYA 1FKFA 1KT0A 2RE3A 2PPNA 4HARA 2ESCA 1JNDA 5HT1A 4MNMA 5GPRA 2MNTA 3FSBA 1T11A 2M2AA 1FKSA 2DSZA 3O5GA 2LJ4A 1X6LA 3CH9A 5I98A 2UZ5A 1W26A 1JVWA 3ARSA 3B7XA 4WKHA 1FKKA 3TDBA 1R9HA 3AROA 2M08A 5DIUA 1JMQA 4Z2GA 1EQ3A 2DT0A 3KAIA 3G6MA 2MLXA 3O5KA 1SYTA 2PBCA 1E9LA 3ARUA 3IKGA 4PTMA 1OGBA 1FKBA 3FSCA 4DWSC 3IK8A 2WK2A 3MCBB 1PINA 3O5OA 3PQHA 2XP9A 3ODKA 5DEZA 2A3EA 3WD3A 5JH8A 1FJDA 1RP5A 3FXYA 3QOKA 2VCDA 1LL6A 1QPFA 3NRKA 1K9TA 5E66A 2XP6A 3ARYA 1H0IA 2AOSA 2VN1A 2XP5A 2IUZA 4NSBA 4Q7NA 1HJVA 1D7HA 2A3CA 3CHEA 1Q6HA 4DIPA 3L4HA 2PPPA 1HXVA 1F8AB 1EG4A 2XP3A 3OOBA 2BA1A 5BXJA 5HTGA 4DWSA 2KXQA 2DJYA 1HJXA 2F4EA 5D75A 2IF4A 2N87A 4MNKA 5DO2A 1X6NA 1O6IA 4WK9A 2Y8NB 3O5DA 4A0TA 2AWGA 4R0XA 4TW6A 4HBEA 2MPHA 2RUCA 1ZB5A 4N19A 4IT6A 4P8XA 4ZPTR 2XPAA 4QT3A 1I5HW 3CGMA 3RM4A 1ROUA 4DRKA 4JFMA 1GOIA 2YAJB 3MDYB 1YATA 3KAFA 2ZAJA 3KAHA 1JNTA 2DG9A 1YW5A 5CQ2A 1HKKA 3ALFA 2O92A 2YSFA 2WAEA 2ZR4A 1EDQA 2DSUA 2QF8A 4DRMA 3O5QA 4DRIA 1HKIA 3CGNA 4J4OA 3NTPA 1CTNA 4A0UA 3WQWA 3CHFA 1FKHA 3KCEA 1NMWA 2KI3A 2DG3A 4DROA 4U84A 1FKGA 1E6RA 1W1PA 1WAWA 4C02B 2ZQSA 1N1AA 1EYMA 3B9DA 3O5EA 3WIJA 4GIVA 3FY1A 3G6LA 3UI4A 2DWVA 5U47A 4P8VA 4IPXA 2RUDA 4GGQA 4ODQA 2WADA 2EZ5W 1ZBCA 3O5LA 4DWSB 3MQHA 1XHGA 2LKNA 4L3NA 1ZK6A 3AS2A 2M8JA 4L72B 4WKFA 3B8SA 4DRNA 5GPGA 2PV3A 4ODNA 1FKIA 3B9EA 4NZCA 1ZCNA 4FN2A 3ALGA 3WD0A 5AHTA 4REXA 1D7JA 1Q6IA 2JX8A 1QPLA 2FDMA 3PRBA 3RM9A 1IX5A 3ARQA 3O5FA 4R5EA 1Q6UA 2YSIA 3LKXA 2DK7A 2DMVA 1O6WA 5HUAA 4ODRA 1LL4A 4BF8A 5DF0A 5GQBA 1W1TA 4KR0B 1WB0A 1W9UA 1RD6A 2L2SA 3GPKA 1A7XA 1FLCA 4U86A 1E15A 3BXWA 4MSPA 2YBUA 3WD2A 3UQAA 4DH0A 2DT2A 4MPKA 1JNEA 4ITZA 3KADA 1U79A 2K8IA 1ZL1A 4E5RA 3FAPA 1HKJA 3WKZA 3ARVA 4MTVA 3O5RA 2PV1A 4Z2KA 4WIWA 3CZ8A 2ZR5A 2RURA 4MAVA 2JZVA 2LPVA 3CHCA 3TCZA 1ZBVA 5DITA 4Z2JA 4JFLA 4W9QA 1UR8A 3AS3A 1FD9A 2MF9A 4ZPWR 3O5IA 4NNRA 4ODPA 4S3KA 4ZPVR 3M7NA 5HKGA 2DG4A 5B8IC 3CHDA 2G8ZA 4W5UA 2WLYA 1KFWA 4TX0A 3LKXB 2KR7A 4MNLA 2PI6A 2JXWA 1M5YA 5HW6A 1ROTA 5J6EA 2M3OW 2WLZA 2RSEA 2G41A 3KAGA 1PBKA 3O5JA 4S3JA 3PRAA 2YSBA 3FS8A 3OA5A 2PPOA 3ARXA 2OFNA 1GPFA 1JNSA 4JFIA 2YSHA 1F40A 3B9AA 1WR7A 2YSGA 1ZBKA 4QT2A 4LAYA 1E6PA 1TK7A 3I6CA 3WD1A 2F2DA 4AY1A 3WH0A 4LGXA 4DWSD 4XAKA 4JFKA 1NWRA 2OWOA 2FAPA 1K9RA 1EG3A 3AS0A 4GLXA 3ARTA 2QRVA 2XP7A 1J4HA 3RMEA 1LQ0A 3AS1A 3LE4A 3PR9A 3MQGA 1XRVA 4JYSA 2Q5AA 2DT3A 3UI5A 3WL0A 4DZ2A 1W1VA 1HKMA 2DK1A 2MLYA 4ODLA 3JYMA 4WKAA 4IT4A 2RUQA 1EHNA 3EY6A 4ODKA 3LUOA 3WD4A 5HWBA 1LG1A 4HBOA 2FKEA 3JXVA 2XP4A 1OGGA 1NWSA 4TNSA 4DRQA 1WNOA 4IQCA 2F21A 1NMVA 1FKTA 1NSGA 3KABA 3WQVA 1FFQA 2ITKA 1J4IA 5E65A 1OWQA 2D9FA 2LGOA 3KZ7A 1HJWA 1WMVA 3JYJA 4MNJA 1FKJA 1B6CA 2JMFA 2ZQTA 3W4RA 4LAWA 3UF8A 2OLHA 2M1IA 3KACA 3H9RB 3ARWA 4DRJA 1FKLA 1J6YA 1FKRA 4DZ3A 2M8IA 4ZS6A 1E6ZA 1D2KA 1TCOC 5E5WA 1TFVA 2DSVA 2DSWA 4MGVA 1FKDA 2E45A 1NWUA 4Q22A 3UQIA 1W9PA 2O9OA 2A3BA 2DPEA 3ARPA 3PA7A 3O5MA 4Z2LA 1D6OA 1E6NA 2RQSA 2Y78A 1P5QA 4U85A 2KE0A 2PV2A 4G50A 3RM8A 1QZ2A 1K9QA 4W9OA 3RFWA 2DT1A 2KO7A 3UQBA 1FAPA 1Y0OA 2KGJA 4KQZA 4TW8A 4P8WA 4TYOA 4WJXA 4LAVA 3CNGA 3AQUA 1J4RA 1ZU8A 1W1YA 4P8UA 3ARZA 1NH6A 3IHZA 1FFRA 4O2TA 4TW7A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2JV4 A;  2XP7 A;  1J4H A;  2XP5 A;  2VN1 A;  5DIV A;  4J4N A;  5GPG A;  4DRN A;  2PV3 A;  4O2T A;  3LE4 A;  3NI6 A;  4ODN A;  1FKI A;  3TC5 A;  1ZCN A;  2L4J A;  1D7H A;  4DIP A;  1Q6H A;  4FN2 A;  3L4H A;  4DRP A;  4IQ2 A;  2PPP A;  1HXV A;  1F8A B;  4JYS A;  2Q5A A;  3UI5 A;  1EG4 A;  2XP3 A;  5AHT A;  3M85 A;  4QIB A;  4REX A;  4DZ2 A;  2DK1 A;  3OOB A;  1D7J A;  2MLY A;  2BA1 A;  1Q6I A;  2JX8 A;  1QPL A;  3JYM A;  4ODL A;  2MLZ A;  3RGC A;  5BXJ A;  2RUQ A;  5HTG A;  3PRB A;  2KXQ A;  4FAP A;  2DJY A;  5J6E A;  4DRH A;  3EY6 A;  4ODK A;  3LUO A;  5HWB A;  2F4E A;  5D75 A;  1EG3 A;  2KFW A;  2FKE A;  2IF4 A;  2LAJ A;  3O5F A;  2N87 A;  3JXV A;  1C9H A;  4DT4 A;  2XP4 A;  1Q6U A;  1Q1C A;  2YSI A;  4TNS A;  1L1P A;  3O5D A;  2DK7 A;  2DMV A;  4DRQ A;  1O6W A;  2AWG A;  4IQC A;  2F21 A;  4ODR A;  4R0X A;  4TW6 A;  4BF8 A;  1NMV A;  2ZQU A;  1FKT A;  3O5P A;  2MPH A;  1BL4 A;  1NSG A;  2RUC A;  4DRM A;  1D7I A;  3KAB A;  4N19 A;  2L2S A;  3GPK A;  5HW8 A;  1A7X A;  2ITK A;  2XP8 A;  4U86 A;  1J4I A;  1KT1 A;  4MSP A;  2D9F A;  2LGO A;  2ZR6 A;  2ZQV A;  2XPB A;  4DH0 A;  3UQA A;  3KZ7 A;  5HW7 A;  2XPA A;  1WMV A;  3JYJ A;  3IKD A;  4QT3 A;  4ITZ A;  1I5H W;  3KAD A;  3CGM A;  4ODO A;  1U79 A;  2K8I A;  1ROU A;  4DRK A;  1FKJ A;  3FAP A;  4E5R A;  4JFM A;  3UI6 A;  1B6C A;  2JMF A;  3MDY B;  2ZQT A;  3KAF A;  2ZAJ A;  3KAH A;  1BKF A;  1JNT A;  1YAT A;  4ODM A;  4LAW A;  2DG9 A;  3UF8 A;  5HWC A;  1YW5 A;  2M1I A;  3KAC A;  5CQ2 A;  3H9R B;  4JFJ A;  4LAX A;  2YSF A;  2MDI A;  3O5R A;  2PV1 A;  4DRJ A;  2ZR4 A;  1FKL A;  4G2P A;  3PRD A;  3VAW A;  4W9P A;  5HUA A;  1J6Y A;  1EQ3 A;  2ZR5 A;  1FKR A;  1FKF A;  1KT0 A;  2RUR A;  2RE3 A;  2PPN A;  3O5Q A;  4DRI A;  2JZV A;  2LPV A;  2M8I A;  4DZ3 A;  3TCZ A;  5DIT A;  1TCO C;  3CGN A;  4JFL A;  4W9Q A;  5HT1 A;  1FD9 A;  2MF9 A;  4MGV A;  4J4O A;  3NTP A;  1FKD A;  2MNT A;  1T11 A;  2M2A A;  3O5I A;  4NNR A;  2E45 A;  4ODP A;  1FKS A;  3UQI A;  1FKH A;  3KCE A;  3M7N A;  1NMW A;  2DG4 A;  2KI3 A;  2LJ4 A;  3O5G A;  2DG3 A;  5B8I C;  5HKG A;  4DRO A;  5I98 A;  4U84 A;  4TX0 A;  2UZ5 A;  1FKG A;  1W26 A;  1JVW A;  2KR7 A;  3B7X A;  3O5M A;  3PA7 A;  2JXW A;  1D6O A;  4C02 B;  1FKK A;  2RQS A;  2ZQS A;  3TDB A;  2Y78 A;  1M5Y A;  1N1A A;  1EYM A;  1R9H A;  1P5Q A;  3O5E A;  1ROT A;  5HW6 A;  4U85 A;  2M08 A;  5DIU A;  1JMQ A;  2KE0 A;  2PV2 A;  2M3O W;  4GIV A;  2RSE A;  4G50 A;  1QZ2 A;  3KAI A;  1K9Q A;  2MLX A;  3KAG A;  1PBK A;  3O5K A;  3O5J A;  4W9O A;  2PBC A;  3IKG A;  3RFW A;  2KO7 A;  2YSB A;  3UQB A;  3UI4 A;  2DWV A;  1FAP A;  1FKB A;  1Y0O A;  2PPO A;  2KGJ A;  3IK8 A;  4TW8 A;  4TYO A;  2OFN A;  4LAV A;  1PIN A;  1JNS A;  3CNG A;  4IPX A;  2RUD A;  4GGQ A;  3O5O A;  2YSH A;  4JFI A;  4ODQ A;  1F40 A;  2XP9 A;  1WR7 A;  3ODK A;  1J4R A;  2YSG A;  1FJD A;  4QT2 A;  4LAY A;  1TK7 A;  3I6C A;  2EZ5 W;  2F2D A;  4TW7 A;  3O5L A;  3WH0 A;  2VCD A;  1QPF A;  3IHZ A;  3NRK A;  2LKN A;  4JFK A;  2XP6 A;  1ZK6 A;  2FAP A;  1K9R A;  2M8J A; 
#chains in the Genus database with same CATH topology
 2JV4 A;  2B31 A;  1ZBW A;  5DIV A;  4J4N A;  1H0G A;  1LL7 A;  3NI6 A;  1NWT A;  2WM0 A;  3TC5 A;  1SR0 A;  2L4J A;  4URI A;  4DRP A;  4IQ2 A;  2P4V A;  1TR8 A;  2YBT A;  4QZV B;  3M85 A;  4QIB A;  3GU0 A;  1LG2 A;  3MCB A;  5E62 A;  1GUV A;  2MLZ A;  3RGC A;  4FAP A;  4DRH A;  1VF8 A;  5E64 A;  2KFW A;  2LAJ A;  1C9H A;  4DT4 A;  1Q1C A;  3ARR A;  1L1P A;  1W9V A;  4Z2I A;  1UR9 A;  2ZQU A;  3O5P A;  4ML4 A;  1BL4 A;  1D7I A;  5HW8 A;  2XP8 A;  1KT1 A;  1ITX A;  2ZR6 A;  2ZQV A;  2XPB A;  5HW7 A;  3IKD A;  5HBF A;  4ODO A;  4Z2H A;  3UI6 A;  2A3A A;  1BKF A;  4ODM A;  5HWC A;  4JFJ A;  4LAX A;  2F23 A;  3GTY X;  2MDI A;  1EIB A;  4G2P A;  3VAW A;  3PRD A;  3WL1 A;  4W9P A;  1LJY A;  1FKF A;  1KT0 A;  2RE3 A;  2PPN A;  4HAR A;  2ESC A;  1JND A;  5HT1 A;  4MNM A;  5GPR A;  2MNT A;  3FSB A;  1T11 A;  2M2A A;  1FKS A;  2DSZ A;  3O5G A;  2LJ4 A;  1X6L A;  3CH9 A;  5I98 A;  2ETN A;  2UZ5 A;  1W26 A;  1JVW A;  3ARS A;  3B7X A;  4WKH A;  1FKK A;  3TDB A;  1R9H A;  3ARO A;  2M08 A;  5DIU A;  1JMQ A;  4Z2G A;  1EQ3 A;  2DT0 A;  3KAI A;  3G6M A;  2MLX A;  3O5K A;  1SYT A;  2PBC A;  1E9L A;  3ARU A;  3IKG A;  4PTM A;  1OGB A;  1FKB A;  3FSC A;  4DWS C;  3IK8 A;  2WK2 A;  3MCB B;  1PIN A;  3O5O A;  3PQH A;  2XP9 A;  3ODK A;  5DEZ A;  2A3E A;  3WD3 A;  5JH8 A;  1FJD A;  1RP5 A;  3FXY A;  3QOK A;  2VCD A;  1LL6 A;  1QPF A;  3NRK A;  1K9T A;  5E66 A;  2XP6 A;  3ARY A;  1H0I A;  2AOS A;  2VN1 A;  2XP5 A;  2IUZ A;  4NSB A;  4Q7N A;  1HJV A;  1D7H A;  2A3C A;  3CHE A;  1Q6H A;  4DIP A;  3L4H A;  2EUL A;  2PPP A;  1HXV A;  1F8A B;  1EG4 A;  2XP3 A;  3OOB A;  3EIP A;  2BA1 A;  5BXJ A;  5HTG A;  4DWS A;  2KXQ A;  2DJY A;  1HJX A;  2F4E A;  5D75 A;  2IF4 A;  2N87 A;  4MNK A;  5DO2 A;  1X6N A;  1O6I A;  4WK9 A;  2Y8N B;  3O5D A;  4A0T A;  2AWG A;  4R0X A;  4TW6 A;  4HBE A;  2MPH A;  2RUC A;  1ZB5 A;  4N19 A;  4IT6 A;  4P8X A;  4ZPT R;  2XPA A;  4QT3 A;  1I5H W;  3CGM A;  3RM4 A;  1ROU A;  4DRK A;  4JFM A;  1GOI A;  2YAJ B;  3MDY B;  1YAT A;  3KAF A;  2ZAJ A;  3KAH A;  1JNT A;  2DG9 A;  1YW5 A;  5CQ2 A;  1HKK A;  3ALF A;  2O92 A;  2YSF A;  2WAE A;  2ZR4 A;  1EDQ A;  2DSU A;  2QF8 A;  4DRM A;  3O5Q A;  4DRI A;  1HKI A;  3CGN A;  4J4O A;  3NTP A;  1CTN A;  4A0U A;  3WQW A;  3CHF A;  1FKH A;  3KCE A;  1NMW A;  2KI3 A;  2DG3 A;  4DRO A;  4U84 A;  1FKG A;  1E6R A;  1W1P A;  1WAW A;  4C02 B;  2ZQS A;  1N1A A;  1EYM A;  3B9D A;  3O5E A;  3WIJ A;  4GIV A;  3FY1 A;  3G6L A;  3UI4 A;  2DWV A;  5U47 A;  4P8V A;  4IPX A;  2RUD A;  4GGQ A;  4ODQ A;  2WAD A;  2EZ5 W;  1ZBC A;  3O5L A;  4DWS B;  3MQH A;  1XHG A;  2LKN A;  4L3N A;  1ZK6 A;  3AS2 A;  2M8J A;  4L72 B;  4WKF A;  3B8S A;  4DRN A;  5GPG A;  2PV3 A;  4ODN A;  1FKI A;  3B9E A;  1JCH B;  4NZC A;  1ZCN A;  4FN2 A;  3ALG A;  3WD0 A;  5AHT A;  4REX A;  1D7J A;  1Q6I A;  2JX8 A;  1QPL A;  2FDM A;  3PRB A;  3RM9 A;  1IX5 A;  3ARQ A;  3O5F A;  4R5E A;  1Q6U A;  2YSI A;  3LKX A;  2DK7 A;  2DMV A;  1O6W A;  5HUA A;  4ODR A;  1LL4 A;  4BF8 A;  5DF0 A;  5GQB A;  1W1T A;  4KR0 B;  1WB0 A;  1W9U A;  1RD6 A;  2L2S A;  3GPK A;  1A7X A;  1FLC A;  4U86 A;  1E15 A;  3BXW A;  4MSP A;  2YBU A;  3WD2 A;  1GRJ A;  4DH0 A;  3UQA A;  2DT2 A;  4MPK A;  1JNE A;  4ITZ A;  3KAD A;  1U79 A;  2K8I A;  1ZL1 A;  4E5R A;  3FAP A;  1HKJ A;  3WKZ A;  3ARV A;  4MTV A;  3O5R A;  2PV1 A;  4Z2K A;  4WIW A;  3CZ8 A;  2ZR5 A;  2RUR A;  4MAV A;  2JZV A;  2LPV A;  3CHC A;  3TCZ A;  1ZBV A;  5DIT A;  4Z2J A;  4JFL A;  4W9Q A;  1UR8 A;  3AS3 A;  1FD9 A;  2MF9 A;  2B5U B;  4ZPW R;  3O5I A;  4NNR A;  4ODP A;  4S3K A;  4ZPV R;  3M7N A;  5HKG A;  2DG4 A;  5B8I C;  3CHD A;  2G8Z A;  4W5U A;  2WLY A;  1KFW A;  4TX0 A;  3LKX B;  2KR7 A;  4MNL A;  2PI6 A;  2JXW A;  1E44 A;  1M5Y A;  5HW6 A;  1ROT A;  5J6E A;  2M3O W;  2WLZ A;  2RSE A;  2G41 A;  3KAG A;  1PBK A;  3O5J A;  4S3J A;  3PRA A;  2YSB A;  3FS8 A;  2PN0 A;  3OA5 A;  2PPO A;  3ARX A;  2OFN A;  1GPF A;  1JNS A;  4JFI A;  2YSH A;  1F40 A;  3B9A A;  1WR7 A;  2YSG A;  1ZBK A;  4QT2 A;  4LAY A;  1E6P A;  1TK7 A;  3I6C A;  3WD1 A;  2F2D A;  4AY1 A;  3WH0 A;  4LGX A;  4DWS D;  4XAK A;  4JFK A;  1NWR A;  2OWO A;  2FAP A;  1K9R A;  1EG3 A;  3AS0 A;  4GLX A;  3ART A;  2QRV A;  2XP7 A;  1J4H A;  3RME A;  1LQ0 A;  3AS1 A;  3LE4 A;  3PR9 A;  3MQG A;  1XRV A;  4JYS A;  2Q5A A;  2DT3 A;  3UI5 A;  3WL0 A;  4DZ2 A;  1W1V A;  1HKM A;  2DK1 A;  2MLY A;  4ODL A;  3JYM A;  4WKA A;  4IT4 A;  2RUQ A;  1EHN A;  3EY6 A;  4ODK A;  3LUO A;  3WD4 A;  5HWB A;  1LG1 A;  4HBO A;  2FKE A;  3JXV A;  2XP4 A;  1OGG A;  1NWS A;  4TNS A;  4DRQ A;  1WNO A;  4IQC A;  2F21 A;  1NMV A;  1FKT A;  1NSG A;  3KAB A;  3WQV A;  1FFQ A;  2ITK A;  1J4I A;  5E65 A;  1OWQ A;  2D9F A;  2LGO A;  3KZ7 A;  1HJW A;  1WMV A;  3JYJ A;  4MNJ A;  1FKJ A;  1B6C A;  2JMF A;  2ZQT A;  3W4R A;  4LAW A;  3UF8 A;  2OLH A;  2M1I A;  3KAC A;  3H9R B;  3ARW A;  4DRJ A;  1FKL A;  1J6Y A;  1FKR A;  4DZ3 A;  2M8I A;  4ZS6 A;  1E6Z A;  1D2K A;  1TCO C;  5E5W A;  4UDM A;  1TFV A;  2DSV A;  2DSW A;  4MGV A;  1FKD A;  2E45 A;  1NWU A;  4Q22 A;  3UQI A;  1W9P A;  2O9O A;  2A3B A;  2DPE A;  3ARP A;  3PA7 A;  3O5M A;  4Z2L A;  1D6O A;  1E6N A;  2RQS A;  2Y78 A;  1P5Q A;  4U85 A;  2KE0 A;  2PV2 A;  4G50 A;  3RM8 A;  1QZ2 A;  1K9Q A;  4W9O A;  3RFW A;  2DT1 A;  2KO7 A;  3UQB A;  1FAP A;  1Y0O A;  2KGJ A;  4KQZ A;  4TW8 A;  4P8W A;  4TYO A;  4WJX A;  4LAV A;  3BMB A;  3CNG A;  3AQU A;  1J4R A;  1ZU8 A;  1W1Y A;  4P8U A;  3ARZ A;  1NH6 A;  3IHZ A;  1FFR A;  4O2T A;  4TW7 A; 
#chains in the Genus database with same CATH homology
 2JV4 A;  2B31 A;  1ZBW A;  5DIV A;  4J4N A;  1H0G A;  1LL7 A;  3NI6 A;  1NWT A;  2WM0 A;  3TC5 A;  1SR0 A;  2L4J A;  4URI A;  4DRP A;  4IQ2 A;  1TR8 A;  2YBT A;  4QZV B;  3M85 A;  4QIB A;  1LG2 A;  3MCB A;  5E62 A;  1GUV A;  2MLZ A;  3RGC A;  4FAP A;  4DRH A;  1VF8 A;  5E64 A;  2KFW A;  2LAJ A;  1C9H A;  4DT4 A;  1Q1C A;  3ARR A;  1L1P A;  1W9V A;  4Z2I A;  1UR9 A;  2ZQU A;  3O5P A;  4ML4 A;  1BL4 A;  1D7I A;  5HW8 A;  2XP8 A;  1KT1 A;  1ITX A;  2ZR6 A;  2ZQV A;  2XPB A;  5HW7 A;  3IKD A;  5HBF A;  4ODO A;  4Z2H A;  3UI6 A;  2A3A A;  1BKF A;  4ODM A;  5HWC A;  4JFJ A;  4LAX A;  2MDI A;  1EIB A;  4G2P A;  3VAW A;  3PRD A;  3WL1 A;  4W9P A;  1LJY A;  1FKF A;  1KT0 A;  2RE3 A;  2PPN A;  4HAR A;  2ESC A;  1JND A;  5HT1 A;  4MNM A;  5GPR A;  2MNT A;  3FSB A;  1T11 A;  2M2A A;  1FKS A;  2DSZ A;  3O5G A;  2LJ4 A;  1X6L A;  3CH9 A;  5I98 A;  2UZ5 A;  1W26 A;  1JVW A;  3ARS A;  3B7X A;  4WKH A;  1FKK A;  3TDB A;  1R9H A;  3ARO A;  2M08 A;  5DIU A;  1JMQ A;  4Z2G A;  1EQ3 A;  2DT0 A;  3KAI A;  3G6M A;  2MLX A;  3O5K A;  1SYT A;  2PBC A;  1E9L A;  3ARU A;  3IKG A;  4PTM A;  1OGB A;  1FKB A;  3FSC A;  4DWS C;  3IK8 A;  2WK2 A;  3MCB B;  1PIN A;  3O5O A;  3PQH A;  2XP9 A;  3ODK A;  5DEZ A;  2A3E A;  3WD3 A;  5JH8 A;  1FJD A;  1RP5 A;  3FXY A;  3QOK A;  2VCD A;  1LL6 A;  1QPF A;  3NRK A;  1K9T A;  5E66 A;  2XP6 A;  3ARY A;  1H0I A;  2AOS A;  2VN1 A;  2XP5 A;  2IUZ A;  4NSB A;  4Q7N A;  1HJV A;  1D7H A;  2A3C A;  3CHE A;  1Q6H A;  4DIP A;  3L4H A;  2PPP A;  1HXV A;  1F8A B;  1EG4 A;  2XP3 A;  3OOB A;  2BA1 A;  5BXJ A;  5HTG A;  4DWS A;  2KXQ A;  2DJY A;  1HJX A;  2F4E A;  5D75 A;  2IF4 A;  2N87 A;  4MNK A;  5DO2 A;  1X6N A;  1O6I A;  4WK9 A;  2Y8N B;  3O5D A;  4A0T A;  2AWG A;  4R0X A;  4TW6 A;  4HBE A;  2MPH A;  2RUC A;  1ZB5 A;  4N19 A;  4IT6 A;  4P8X A;  4ZPT R;  2XPA A;  4QT3 A;  1I5H W;  3CGM A;  3RM4 A;  1ROU A;  4DRK A;  4JFM A;  1GOI A;  2YAJ B;  3MDY B;  1YAT A;  3KAF A;  2ZAJ A;  3KAH A;  1JNT A;  2DG9 A;  1YW5 A;  5CQ2 A;  1HKK A;  3ALF A;  2O92 A;  2YSF A;  2WAE A;  2ZR4 A;  1EDQ A;  2DSU A;  2QF8 A;  4DRM A;  3O5Q A;  4DRI A;  1HKI A;  3CGN A;  4J4O A;  3NTP A;  1CTN A;  4A0U A;  3WQW A;  3CHF A;  1FKH A;  3KCE A;  1NMW A;  2KI3 A;  2DG3 A;  4DRO A;  4U84 A;  1FKG A;  1E6R A;  1W1P A;  1WAW A;  4C02 B;  2ZQS A;  1N1A A;  1EYM A;  3B9D A;  3O5E A;  3WIJ A;  4GIV A;  3FY1 A;  3G6L A;  3UI4 A;  2DWV A;  5U47 A;  4P8V A;  4IPX A;  2RUD A;  4GGQ A;  4ODQ A;  2WAD A;  2EZ5 W;  1ZBC A;  3O5L A;  4DWS B;  3MQH A;  1XHG A;  2LKN A;  4L3N A;  1ZK6 A;  3AS2 A;  2M8J A;  4L72 B;  4WKF A;  3B8S A;  4DRN A;  5GPG A;  2PV3 A;  4ODN A;  1FKI A;  3B9E A;  4NZC A;  1ZCN A;  4FN2 A;  3ALG A;  3WD0 A;  5AHT A;  4REX A;  1D7J A;  1Q6I A;  2JX8 A;  1QPL A;  2FDM A;  3PRB A;  3RM9 A;  1IX5 A;  3ARQ A;  3O5F A;  4R5E A;  1Q6U A;  2YSI A;  3LKX A;  2DK7 A;  2DMV A;  1O6W A;  5HUA A;  4ODR A;  1LL4 A;  4BF8 A;  5DF0 A;  5GQB A;  1W1T A;  4KR0 B;  1WB0 A;  1W9U A;  1RD6 A;  2L2S A;  3GPK A;  1A7X A;  1FLC A;  4U86 A;  1E15 A;  3BXW A;  4MSP A;  2YBU A;  3WD2 A;  3UQA A;  4DH0 A;  2DT2 A;  4MPK A;  1JNE A;  4ITZ A;  3KAD A;  1U79 A;  2K8I A;  1ZL1 A;  4E5R A;  3FAP A;  1HKJ A;  3WKZ A;  3ARV A;  4MTV A;  3O5R A;  2PV1 A;  4Z2K A;  4WIW A;  3CZ8 A;  2ZR5 A;  2RUR A;  4MAV A;  2JZV A;  2LPV A;  3CHC A;  3TCZ A;  1ZBV A;  5DIT A;  4Z2J A;  4JFL A;  4W9Q A;  1UR8 A;  3AS3 A;  1FD9 A;  2MF9 A;  4ZPW R;  3O5I A;  4NNR A;  4ODP A;  4S3K A;  4ZPV R;  3M7N A;  5HKG A;  2DG4 A;  5B8I C;  3CHD A;  2G8Z A;  4W5U A;  2WLY A;  1KFW A;  4TX0 A;  3LKX B;  2KR7 A;  4MNL A;  2PI6 A;  2JXW A;  1M5Y A;  5HW6 A;  1ROT A;  5J6E A;  2M3O W;  2WLZ A;  2RSE A;  2G41 A;  3KAG A;  1PBK A;  3O5J A;  4S3J A;  3PRA A;  2YSB A;  3FS8 A;  3OA5 A;  2PPO A;  3ARX A;  2OFN A;  1GPF A;  1JNS A;  4JFI A;  2YSH A;  1F40 A;  3B9A A;  1WR7 A;  2YSG A;  1ZBK A;  4QT2 A;  4LAY A;  1E6P A;  1TK7 A;  3I6C A;  3WD1 A;  2F2D A;  4AY1 A;  3WH0 A;  4LGX A;  4DWS D;  4XAK A;  4JFK A;  1NWR A;  2OWO A;  2FAP A;  1K9R A;  1EG3 A;  3AS0 A;  4GLX A;  3ART A;  2QRV A;  2XP7 A;  1J4H A;  3RME A;  1LQ0 A;  3AS1 A;  3LE4 A;  3PR9 A;  3MQG A;  1XRV A;  4JYS A;  2Q5A A;  2DT3 A;  3UI5 A;  3WL0 A;  4DZ2 A;  1W1V A;  1HKM A;  2DK1 A;  2MLY A;  4ODL A;  3JYM A;  4WKA A;  4IT4 A;  2RUQ A;  1EHN A;  3EY6 A;  4ODK A;  3LUO A;  3WD4 A;  5HWB A;  1LG1 A;  4HBO A;  2FKE A;  3JXV A;  2XP4 A;  1OGG A;  1NWS A;  4TNS A;  4DRQ A;  1WNO A;  4IQC A;  2F21 A;  1NMV A;  1FKT A;  1NSG A;  3KAB A;  3WQV A;  1FFQ A;  2ITK A;  1J4I A;  5E65 A;  1OWQ A;  2D9F A;  2LGO A;  3KZ7 A;  1HJW A;  1WMV A;  3JYJ A;  4MNJ A;  1FKJ A;  1B6C A;  2JMF A;  2ZQT A;  3W4R A;  4LAW A;  3UF8 A;  2OLH A;  2M1I A;  3KAC A;  3H9R B;  3ARW A;  4DRJ A;  1FKL A;  1J6Y A;  1FKR A;  4DZ3 A;  2M8I A;  4ZS6 A;  1E6Z A;  1D2K A;  1TCO C;  5E5W A;  1TFV A;  2DSV A;  2DSW A;  4MGV A;  1FKD A;  2E45 A;  1NWU A;  4Q22 A;  3UQI A;  1W9P A;  2O9O A;  2A3B A;  2DPE A;  3ARP A;  3PA7 A;  3O5M A;  4Z2L A;  1D6O A;  1E6N A;  2RQS A;  2Y78 A;  1P5Q A;  4U85 A;  2KE0 A;  2PV2 A;  4G50 A;  3RM8 A;  1QZ2 A;  1K9Q A;  4W9O A;  3RFW A;  2DT1 A;  2KO7 A;  3UQB A;  1FAP A;  1Y0O A;  2KGJ A;  4KQZ A;  4TW8 A;  4P8W A;  4TYO A;  4WJX A;  4LAV A;  3CNG A;  3AQU A;  1J4R A;  1ZU8 A;  1W1Y A;  4P8U A;  3ARZ A;  1NH6 A;  3IHZ A;  1FFR A;  4O2T A;  4TW7 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...