2F21A

Human pin1 fip mutant
Total Genus 48
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
48
sequence length
162
structure length
153
Chain Sequence
b'MADEEKLPPGWEKRMSADGRVYYFNHITNASQWERPSGQGEPARVRCSHLLVKHSQSRRPSSWRQEKITRTKEEALELINGYIQKIKSGEEDFESLASQFSDCSSAKARGDLGAFSRGQMQKPFEDASFALRTGEMSGPVFTDSGIHIILRTE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Peptidyl-prolyl cis-trans isomerase NIMA-interacting 1
publication title Structure-function-folding relationship in a WW domain.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Isomerase
total genus 48
structure length 153
sequence length 162
ec nomenclature ec 5.2.1.8: Peptidylprolyl isomerase.
pdb deposition date 2005-11-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00397 WW WW domain
A PF00639 Rotamase PPIC-type PPIASE domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.20.70.10 Mainly Beta Single Sheet Ubiquitin Ligase Nedd4; Chain: W; Ubiquitin Ligase Nedd4; Chain: W; 2f21A01
3.10.50.40 Alpha Beta Roll Chitinase A; domain 3 Chitinase A; domain 3 2f21A02
5HKGA 1Q6IA 4IQCA 1N1AA 1KT0A 1Q6HA 1Q1CA 4E5RA 2JV4A 4REXA 3O5DA 2XPBA 1BL4A 3PRBA 2XPAA 3UI4A 3NRKA 1W26A 4QIBA 2RUDA 4ITZA 1I5HW 3IHZA 2YSBA 4DRQA 2F4EA 2RURA 2ZR6A 5HWCA 3JXVA 3O5MA 3UQIA 1C9HA 1NSGA 1EG4A 1FKRA 2XP5A 2XP7A 1J4RA 4ODPA 3M85A 3CGNA 5B8IC 2DG9A 2PV3A 4LAYA 1PBKA 2F2DA 3NI6A 4TW6A 2IF4A 2KO7A 3O5FA 4ODKA 1Q6UA 4FAPA 4W9OA 1FKDA 2FKEA 4JYSA 4FN2A 3KABA 3LE4A 4DRHA 2LJ4A 4DRPA 4JFIA 1L1PA 4DIPA 5HUAA 4DROA 4DRNA 2L4JA 3TC5A 3TCZA 4JFKA 4QT3A 1F40A 1F8AB 2M8IA 2ZR5A 2BA1A 2YSIA 2ZQVA 4ODRA 1TCOC 3RFWA 1QZ2A 4DRIA 1FD9A 2MF9A 2M1IA 5HW7A 3KZ7A 2M8JA 2LAJA 2YSGA 1NMWA 1YATA 2KFWA 4TNSA 2LPVA 4NNRA 2MLXA 2JX8A 2EZ5W 3FAPA 2RUQA 4N19A 3O5RA 3EY6A 1HXVA 2Q5AA 2KR7A 3O5EA 1FKKA 5HW6A 1D7JA 2JZVA 2VCDA 1JNSA 2XP9A 3VAWA 2ZAJA 2KI3A 2M08A 1J4IA 1D6OA 4IQ2A 3KAGA 3IK8A 1M5YA 4W9QA 2DG4A 3O5LA 1ROUA 2MDIA 3O5QA 2MPHA 3RGCA 2E45A 2PPNA 4DT4A 2DWVA 1O6WA 4G50A 3O5KA 4C02B 1FKIA 3KACA 4ODMA 3M7NA 2AWGA 2DG3A 3KAIA 2PPPA 4DZ3A 2LKNA 3KADA 4TX0A 2DK1A 1FAPA 4LAXA 2ZR4A 1FKTA 1U79A 2PBCA 1FKHA 2XP8A 5AHTA 1JMQA 3UI6A 1Y0OA 1J6YA 2PPOA 5CQ2A 2YSFA 4U86A 5J6EA 3KAHA 4ODLA 4JFLA 1NMVA 2ZQTA 3KCEA 5D75A 1EQ3A 2K8IA 3UF8A 1QPFA 1JNTA 3UI5A 1K9RA 1T11A 2RUCA 2PV2A 3KAFA 2RQSA 3NTPA 3H9RB 1A7XA 3O5JA 1ZCNA 1EYMA 4G2PA 1FJDA 2PV1A 3TDBA 1ZK6A 3O5OA 2D9FA 1FKGA 3LUOA 3UQBA 4W9PA 4MGVA 2ZQSA 3PRDA 1B6CA 2MLYA 4JFJA 1FKSA 3O5PA 1KT1A 3JYMA 4DZ2A 2YSHA 4R0XA 4TW8A 3L4HA 3GPKA 5HWBA 2UZ5A 4ODNA 4TW7A 5BXJA 2RSEA 2MLZA 4DRJA 3O5GA 1EG3A 2DMVA 4GIVA 4TYOA 3B7XA 4GGQA 1FKLA 4MSPA 3IKDA 5HTGA 3OOBA 2MNTA 4DRKA 3I6CA 1JVWA 1WR7A 5DIUA 2FAPA 1WMVA 5HT1A 2KGJA 4J4OA 3O5IA 3CNGA 1FKBA 2LGOA 2XP4A 1YW5A 1TK7A 2JXWA 1D7IA 2M3OW 3JYJA 4JFMA 2Y78A 4DH0A 3UQAA 1QPLA 2RE3A 4U84A 3MDYB 1ROTA 5HW8A 1K9QA 1P5QA 2DJYA 1J4HA 4DRMA 5DITA 3CGMA 2M2AA 3WH0A 2VN1A 4ODOA 2OFNA 4LAWA 3IKGA 2L2SA 3PA7A 2N87A 5I98A 1R9HA 2ZQUA 1FKFA 2ITKA 2JMFA 4U85A 1BKFA 4J4NA 1D7HA 2KXQA 2XP6A 4ODQA 4LAVA 4BF8A 5GPGA 5DIVA 1FKJA 2DK7A 2XP3A 4O2TA 3ODKA 2KE0A 1PINA 4IPXA 4QT2A 2F21A
chains in the Genus database with same CATH superfamily
5HKGA 1Q6IA 4IQCA 1N1AA 2PN0A 1KT0A 1Q6HA 3RMEA 1Q1CA 3GU0A 4E5RA 1WB0A 2DT1A 2JV4A 5U47A 2AOSA 4REXA 4WKAA 3O5DA 2XPBA 1GOIA 4DWSC 3ARVA 1BL4A 3WD0A 3AS0A 3PRBA 2XPAA 4ZPTR 3RM4A 3FSCA 1LQ0A 4WKFA 2A3AA 3ARQA 4IT4A 3UI4A 2WM0A 3ARYA 3NRKA 2B5UB 4S3KA 1W26A 3RM8A 4WKHA 4QIBA 2RUDA 4ITZA 1I5HW 2WK2A 3IHZA 2YSBA 4DRQA 1GPFA 2F23A 2F4EA 3G6LA 4KR0B 2RURA 2ZR6A 5HWCA 3JXVA 4L3NA 3O5MA 2DT2A 3UQIA 1C9HA 5DF0A 1NSGA 1EG4A 2DSUA 2XP5A 2XP7A 4DWSD 1X6NA 3ARWA 1FKRA 1J4RA 3LKXB 4ODPA 4NZCA 1UR8A 3M85A 3BXWA 3CGNA 5B8IC 2DG9A 4WK9A 4UDMA 2PV3A 4LAYA 1PBKA 2F2DA 3NI6A 4TW6A 3ARTA 4ML4A 3MCBA 2G8ZA 1O6IA 2IF4A 2KO7A 3O5FA 4ODKA 1Q6UA 4P8VA 4DWSA 4FAPA 3G6MA 1ZBKA 4W9OA 3WIJA 3CHDA 1FKDA 2FKEA 4JYSA 4FN2A 3KABA 3LE4A 4DRHA 2LJ4A 4DRPA 3CHCA 4JFIA 1L1PA 4DIPA 5HUAA 4DROA 2DPEA 4DRNA 2L4JA 5GPRA 4Z2GA 3TC5A 3TCZA 1E15A 3RM9A 2DSWA 4JFKA 1HKKA 1HKJA 1WAWA 5DEZA 1NWUA 3WQWA 1RP5A 4QT3A 1VF8A 1F40A 1F8AB 2YBTA 2M8IA 2ZR5A 1FFQA 2BA1A 2YSIA 1K9TA 2ZQVA 4ODRA 3ALGA 1TCOC 3RFWA 1QZ2A 4DRIA 1ZL1A 3WD4A 1FD9A 3FSBA 5E64A 2MF9A 5DO2A 2M1IA 5HW7A 3QOKA 3KZ7A 2M8JA 2LAJA 2YSGA 1NMWA 1YATA 2KFWA 4Z2LA 4MNMA 4QZVB 1LG1A 4TNSA 4Z2HA 4P8WA 3B8SA 3CZ8A 2A3EA 2LPVA 4NNRA 2MLXA 5E65A 3CH9A 4MNKA 2JX8A 4Q22A 2EZ5W 3FS8A 1W9PA 3FAPA 2RUQA 4N19A 4Z2IA 4ZS6A 3O5RA 3EY6A 1HXVA 2Q5AA 4HARA 2KR7A 3O5EA 3B9EA 1FKKA 1SYTA 3ARZA 5HW6A 1D7JA 2JZVA 1HJWA 2VCDA 1JNSA 2O92A 2XP9A 3VAWA 3WL1A 1ZBVA 2WLZA 3ALFA 2ZAJA 2KI3A 2M08A 2G41A 2YBUA 1LG2A 1W1VA 1J4IA 1D6OA 1RD6A 1D2KA 3FY1A 4IQ2A 1E6ZA 3KAGA 3IK8A 3ARSA 1M5YA 4W9QA 2DG4A 2A3BA 3ARUA 3O5LA 1ROUA 2MDIA 1TR8A 1LL7A 3O5QA 4QT2A 2PI6A 1JCHB 2MPHA 3RGCA 2E45A 2PPNA 4DT4A 2DWVA 1XHGA 1O6WA 1EIBA 4G50A 3O5KA 2ESCA 3ARRA 1HJVA 3WKZA 4C02B 1TFVA 1NWSA 1FKIA 3KACA 4ODMA 3M7NA 2AWGA 2DG3A 4AY1A 3KAIA 2PPPA 1OGGA 2LKNA 4DZ3A 3KADA 1H0GA 4KQZA 4TX0A 2DK1A 1FAPA 4LAXA 2ZR4A 1FKTA 1U79A 1UR9A 3MQGA 2PBCA 4A0UA 1FKHA 3AS1A 3PQHA 2YAJB 2XP8A 1W1YA 2ETNA 5AHTA 1JMQA 3UI6A 1Y0OA 1J6YA 2PPOA 5CQ2A 3GTYX 3B9AA 2YSFA 4U86A 5J6EA 3KAHA 4ZPWR 4ODLA 5E66A 4JFLA 1NMVA 2ZQTA 2A3CA 3WL0A 3KCEA 1W1TA 5D75A 4HBOA 1LL4A 1E6NA 1EQ3A 2K8IA 1W1PA 2DSVA 3UF8A 1QPFA 1JNTA 3UI5A 4XAKA 1K9RA 4Z2KA 1T11A 3WD3A 1XRVA 3AQUA 2RUCA 3PR9A 2PV2A 3WD1A 3MCBB 3KAFA 5HBFA 1ITXA 2RQSA 3NTPA 1E6RA 4DWSB 3H9RB 1A7XA 1HKMA 3O5JA 4Z2JA 4URIA 1ZCNA 1EYMA 4G2PA 1FJDA 2PV1A 3TDBA 1ZK6A 3O5OA 4MPKA 2D9FA 1FKGA 3LUOA 3UQBA 4W9PA 4LGXA 4MGVA 1ZU8A 4Q7NA 2ZQSA 4MNJA 3PRDA 1B6CA 2MLYA 4JFJA 1FKSA 3O5PA 1KT1A 3JYMA 4DZ2A 2Y8NB 2O9OA 2YSHA 3WD2A 4MAVA 4R0XA 3PRAA 4TW8A 4MNLA 4W5UA 2DSZA 4WJXA 3AS3A 2WADA 3L4HA 3GPKA 3EIPA 2QRVA 5HWBA 3LKXA 1H0IA 2FDMA 2WLYA 1JNDA 2UZ5A 4ODNA 4TW7A 4MTVA 5BXJA 2RSEA 4HBEA 3WQVA 2MLZA 3MQHA 3O5GA 1EG3A 3W4RA 4DRJA 2DMVA 4GIVA 4TYOA 3AS2A 3B7XA 1FKLA 1FLCA 4GGQA 4L72B 4MSPA 1WNOA 1NWRA 2OWOA 3IKDA 5HTGA 3OOBA 2MNTA 4DRKA 4ZPVR 3I6CA 1JVWA 1WR7A 5DIUA 2FAPA 5E5WA 1WMVA 2QF8A 5HT1A 1EHNA 2KGJA 3CHFA 4J4OA 3O5IA 3CNGA 1FKBA 2LGOA 4GLXA 2XP4A 1TK7A 1YW5A 4S3JA 2JXWA 1W9UA 1D7IA 1KFWA 2M3OW 1ZBWA 3B9DA 2P4VA 1X6LA 3JYJA 5JH8A 4JFMA 4PTMA 2DT3A 2Y78A 1IX5A 3OA5A 4DH0A 3UQAA 1QPLA 3ARPA 1HJXA 2RE3A 4U84A 3MDYB 1ROTA 5HW8A 1K9QA 1P5QA 2DJYA 1FFRA 4P8UA 1W9VA 1GUVA 1J4HA 2EULA 4DRMA 5DITA 3CGMA 1HKIA 2M2AA 3WH0A 2VN1A 4ODOA 4IT6A 2IUZA 4P8XA 4WIWA 2OFNA 1SR0A 1OWQA 4LAWA 3IKGA 2L2SA 1NH6A 3PA7A 1LJYA 2OLHA 3FXYA 2DT0A 1OGBA 5E62A 3CHEA 1ZBCA 1CTNA 2B31A 4NSBA 2N87A 5I98A 1LL6A 1R9HA 5GQBA 1E6PA 1E44A 2ZQUA 1FKFA 1JNEA 2ITKA 2JMFA 4U85A 1BKFA 4J4NA 1E9LA 2WAEA 2KXQA 2XP6A 1D7HA 3AROA 4ODQA 4LAVA 1EDQA 4BF8A 3ARXA 5GPGA 1ZB5A 1NWTA 5DIVA 1FKJA 2DK7A 4R5EA 2XP3A 4O2TA 4A0TA 3ODKA 2KE0A 1PINA 4IPXA 1GRJA 3BMBA 2F21A
chains in the Genus database with same CATH topology
5HKGA 1Q6IA 4IQCA 1N1AA 1KT0A 1Q6HA 3RMEA 1Q1CA 4E5RA 1WB0A 2DT1A 2JV4A 5U47A 2AOSA 4REXA 4WKAA 3O5DA 2XPBA 1GOIA 4DWSC 3ARVA 1BL4A 3WD0A 3AS0A 3PRBA 2XPAA 4ZPTR 3RM4A 3FSCA 1LQ0A 4WKFA 2A3AA 3ARQA 4IT4A 3UI4A 2WM0A 3ARYA 3NRKA 4S3KA 1W26A 3RM8A 4WKHA 4QIBA 2RUDA 4ITZA 1I5HW 2WK2A 3IHZA 2YSBA 4DRQA 1GPFA 2F4EA 3G6LA 4KR0B 2RURA 2ZR6A 5HWCA 3JXVA 4L3NA 3O5MA 2DT2A 3UQIA 1C9HA 5DF0A 1NSGA 1EG4A 2DSUA 2XP5A 2XP7A 4DWSD 1X6NA 3ARWA 1FKRA 1J4RA 3LKXB 4ODPA 4NZCA 1UR8A 3M85A 3BXWA 3CGNA 5B8IC 2DG9A 4WK9A 2PV3A 4LAYA 1PBKA 2F2DA 3NI6A 4TW6A 3ARTA 4ML4A 3MCBA 2G8ZA 1O6IA 2IF4A 2KO7A 3O5FA 4ODKA 1Q6UA 4P8VA 4DWSA 4FAPA 3G6MA 1ZBKA 4W9OA 3WIJA 3CHDA 1FKDA 2FKEA 4JYSA 4FN2A 3KABA 3LE4A 4DRHA 2LJ4A 4DRPA 3CHCA 4JFIA 1L1PA 4DIPA 5HUAA 4DROA 2DPEA 4DRNA 2L4JA 5GPRA 4Z2GA 3TC5A 3TCZA 1E15A 3RM9A 2DSWA 4JFKA 1HKKA 1HKJA 1WAWA 5DEZA 1NWUA 3WQWA 1RP5A 4QT3A 1VF8A 1F40A 1F8AB 2YBTA 2M8IA 2ZR5A 1FFQA 2BA1A 2YSIA 1K9TA 2ZQVA 4ODRA 3ALGA 1TCOC 3RFWA 1QZ2A 4DRIA 1ZL1A 3WD4A 1FD9A 3FSBA 5E64A 2MF9A 5DO2A 2M1IA 5HW7A 3QOKA 3KZ7A 2M8JA 2LAJA 2YSGA 1NMWA 1YATA 2KFWA 4Z2LA 4MNMA 4QZVB 1LG1A 4TNSA 4Z2HA 4P8WA 3B8SA 3CZ8A 2A3EA 2LPVA 4NNRA 2MLXA 5E65A 3CH9A 4MNKA 2JX8A 4Q22A 2EZ5W 3FS8A 1W9PA 3FAPA 2RUQA 4N19A 4Z2IA 4ZS6A 3O5RA 3EY6A 1HXVA 2Q5AA 4HARA 2KR7A 3O5EA 3B9EA 1FKKA 1SYTA 3ARZA 5HW6A 1D7JA 2JZVA 1HJWA 2VCDA 1JNSA 2O92A 2XP9A 3VAWA 3WL1A 1ZBVA 2WLZA 3ALFA 2ZAJA 2KI3A 2M08A 2G41A 2YBUA 1LG2A 1W1VA 1J4IA 1D6OA 1RD6A 1D2KA 3FY1A 4IQ2A 1E6ZA 3KAGA 3IK8A 3ARSA 1M5YA 4W9QA 2DG4A 2A3BA 3ARUA 3O5LA 1ROUA 2MDIA 1TR8A 1LL7A 3O5QA 2PI6A 2MPHA 3RGCA 2E45A 2PPNA 4DT4A 2DWVA 1XHGA 1O6WA 1EIBA 4G50A 3O5KA 2ESCA 3ARRA 1HJVA 3WKZA 4C02B 1TFVA 1NWSA 1FKIA 3KACA 4ODMA 3M7NA 2AWGA 2DG3A 4AY1A 3KAIA 2PPPA 1OGGA 2LKNA 4DZ3A 3KADA 1H0GA 4KQZA 4TX0A 2DK1A 1FAPA 4LAXA 2ZR4A 1FKTA 1U79A 1UR9A 3MQGA 2PBCA 4A0UA 1FKHA 3AS1A 3PQHA 2YAJB 2XP8A 1W1YA 5AHTA 1JMQA 3UI6A 1Y0OA 1J6YA 2PPOA 5CQ2A 3B9AA 2YSFA 4U86A 5J6EA 3KAHA 4ZPWR 4ODLA 5E66A 4JFLA 1NMVA 2ZQTA 2A3CA 3WL0A 3KCEA 1W1TA 5D75A 4HBOA 1LL4A 1E6NA 1EQ3A 2K8IA 1W1PA 2DSVA 3UF8A 1QPFA 1JNTA 3UI5A 4XAKA 1K9RA 4Z2KA 1T11A 3WD3A 1XRVA 3AQUA 2RUCA 3PR9A 2PV2A 3WD1A 3MCBB 3KAFA 5HBFA 1ITXA 2RQSA 3NTPA 1E6RA 4DWSB 3H9RB 1A7XA 1HKMA 3O5JA 4Z2JA 4URIA 1ZCNA 1EYMA 4G2PA 1FJDA 2PV1A 3TDBA 1ZK6A 3O5OA 4MPKA 2D9FA 1FKGA 3LUOA 3UQBA 4W9PA 4LGXA 4MGVA 1ZU8A 4Q7NA 2ZQSA 4MNJA 3PRDA 1B6CA 2MLYA 4JFJA 1FKSA 3O5PA 1KT1A 3JYMA 4DZ2A 2Y8NB 2O9OA 2YSHA 3WD2A 4MAVA 4R0XA 3PRAA 4TW8A 4MNLA 4W5UA 2DSZA 4WJXA 3AS3A 2WADA 3L4HA 3GPKA 2QRVA 5HWBA 3LKXA 1H0IA 2FDMA 2WLYA 1JNDA 2UZ5A 4ODNA 4TW7A 4MTVA 5BXJA 2RSEA 4HBEA 3WQVA 2MLZA 3MQHA 3O5GA 1EG3A 3W4RA 4DRJA 2DMVA 4GIVA 4TYOA 3AS2A 3B7XA 1FKLA 1FLCA 4GGQA 4L72B 4MSPA 1WNOA 1NWRA 2OWOA 3IKDA 5HTGA 3OOBA 2MNTA 4DRKA 4ZPVR 3I6CA 1JVWA 1WR7A 5DIUA 2FAPA 5E5WA 1WMVA 2QF8A 5HT1A 1EHNA 2KGJA 3CHFA 4J4OA 3O5IA 3CNGA 1FKBA 2LGOA 4GLXA 2XP4A 1TK7A 1YW5A 4S3JA 2JXWA 1W9UA 1D7IA 1KFWA 2M3OW 1ZBWA 3B9DA 1X6LA 3JYJA 5JH8A 4JFMA 4PTMA 2DT3A 2Y78A 1IX5A 3OA5A 4DH0A 3UQAA 1QPLA 3ARPA 1HJXA 2RE3A 4U84A 3MDYB 1ROTA 5HW8A 1K9QA 1P5QA 2DJYA 1FFRA 1W9VA 1GUVA 1J4HA 4DRMA 5DITA 3CGMA 1HKIA 2M2AA 3WH0A 2VN1A 4ODOA 4IT6A 2IUZA 4P8XA 4WIWA 2OFNA 1SR0A 1OWQA 4LAWA 3IKGA 2L2SA 1NH6A 3PA7A 1LJYA 2OLHA 3FXYA 2DT0A 1OGBA 5E62A 3CHEA 1ZBCA 1CTNA 2B31A 4NSBA 2N87A 5I98A 1LL6A 1R9HA 5GQBA 1E6PA 2ZQUA 1FKFA 1JNEA 2ITKA 2JMFA 4U85A 1BKFA 4J4NA 1E9LA 2WAEA 2KXQA 2XP6A 1D7HA 3AROA 4ODQA 4LAVA 1EDQA 4BF8A 3ARXA 5GPGA 1ZB5A 1NWTA 5DIVA 1FKJA 2DK7A 4R5EA 2XP3A 4O2TA 4A0TA 3ODKA 2KE0A 1PINA 4IPXA 4P8UA 4QT2A 2F21A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5HKG A;  1Q6I A;  4IQC A;  1N1A A;  1KT0 A;  1Q6H A;  1Q1C A;  4E5R A;  2JV4 A;  4REX A;  3O5D A;  2XPB A;  1BL4 A;  3PRB A;  2XPA A;  3UI4 A;  3NRK A;  1W26 A;  4QIB A;  2RUD A;  4ITZ A;  1I5H W;  3IHZ A;  2YSB A;  4DRQ A;  2F4E A;  2RUR A;  2ZR6 A;  5HWC A;  3JXV A;  3O5M A;  3UQI A;  1C9H A;  1NSG A;  1EG4 A;  1FKR A;  2XP5 A;  2XP7 A;  1J4R A;  4ODP A;  3M85 A;  3CGN A;  5B8I C;  2DG9 A;  2PV3 A;  4LAY A;  1PBK A;  2F2D A;  3NI6 A;  4TW6 A;  2IF4 A;  2KO7 A;  3O5F A;  4ODK A;  1Q6U A;  4FAP A;  4W9O A;  1FKD A;  2FKE A;  4JYS A;  4FN2 A;  3KAB A;  3LE4 A;  4DRH A;  2LJ4 A;  4DRP A;  4JFI A;  1L1P A;  4DIP A;  5HUA A;  4DRO A;  4DRN A;  2L4J A;  3TC5 A;  3TCZ A;  4JFK A;  4QT3 A;  1F40 A;  1F8A B;  2M8I A;  2ZR5 A;  2BA1 A;  2YSI A;  2ZQV A;  4ODR A;  1TCO C;  3RFW A;  1QZ2 A;  4DRI A;  1FD9 A;  2MF9 A;  2M1I A;  5HW7 A;  3KZ7 A;  2M8J A;  2LAJ A;  2YSG A;  1NMW A;  1YAT A;  2KFW A;  4TNS A;  2LPV A;  4NNR A;  2MLX A;  2JX8 A;  2EZ5 W;  3FAP A;  2RUQ A;  4N19 A;  3O5R A;  3EY6 A;  1HXV A;  2Q5A A;  2KR7 A;  3O5E A;  1FKK A;  5HW6 A;  1D7J A;  2JZV A;  2VCD A;  1JNS A;  2XP9 A;  3VAW A;  2ZAJ A;  2KI3 A;  2M08 A;  1J4I A;  1D6O A;  4IQ2 A;  3KAG A;  3IK8 A;  1M5Y A;  4W9Q A;  2DG4 A;  3O5L A;  1ROU A;  2MDI A;  3O5Q A;  2MPH A;  3RGC A;  2E45 A;  2PPN A;  4DT4 A;  2DWV A;  1O6W A;  4G50 A;  3O5K A;  4C02 B;  1FKI A;  3KAC A;  4ODM A;  3M7N A;  2AWG A;  2DG3 A;  3KAI A;  2PPP A;  4DZ3 A;  2LKN A;  3KAD A;  4TX0 A;  2DK1 A;  1FAP A;  4LAX A;  2ZR4 A;  1FKT A;  1U79 A;  2PBC A;  1FKH A;  2XP8 A;  5AHT A;  1JMQ A;  3UI6 A;  1Y0O A;  1J6Y A;  2PPO A;  5CQ2 A;  2YSF A;  4U86 A;  5J6E A;  3KAH A;  4ODL A;  4JFL A;  1NMV A;  2ZQT A;  3KCE A;  5D75 A;  1EQ3 A;  2K8I A;  3UF8 A;  1QPF A;  1JNT A;  3UI5 A;  1K9R A;  1T11 A;  2RUC A;  2PV2 A;  3KAF A;  2RQS A;  3NTP A;  3H9R B;  1A7X A;  3O5J A;  1ZCN A;  1EYM A;  4G2P A;  1FJD A;  2PV1 A;  3TDB A;  1ZK6 A;  3O5O A;  2D9F A;  1FKG A;  3LUO A;  3UQB A;  4W9P A;  4MGV A;  2ZQS A;  3PRD A;  1B6C A;  2MLY A;  4JFJ A;  1FKS A;  3O5P A;  1KT1 A;  3JYM A;  4DZ2 A;  2YSH A;  4R0X A;  4TW8 A;  3L4H A;  3GPK A;  5HWB A;  2UZ5 A;  4ODN A;  4TW7 A;  5BXJ A;  2RSE A;  2MLZ A;  4DRJ A;  3O5G A;  1EG3 A;  2DMV A;  4GIV A;  4TYO A;  3B7X A;  4GGQ A;  1FKL A;  4MSP A;  3IKD A;  5HTG A;  3OOB A;  2MNT A;  4DRK A;  3I6C A;  1JVW A;  1WR7 A;  5DIU A;  2FAP A;  1WMV A;  5HT1 A;  2KGJ A;  4J4O A;  3O5I A;  3CNG A;  1FKB A;  2LGO A;  2XP4 A;  1YW5 A;  1TK7 A;  2JXW A;  1D7I A;  2M3O W;  3JYJ A;  4JFM A;  2Y78 A;  4DH0 A;  3UQA A;  1QPL A;  2RE3 A;  4U84 A;  3MDY B;  1ROT A;  5HW8 A;  1K9Q A;  1P5Q A;  2DJY A;  1J4H A;  4DRM A;  5DIT A;  3CGM A;  2M2A A;  3WH0 A;  2VN1 A;  4ODO A;  2OFN A;  4LAW A;  3IKG A;  2L2S A;  3PA7 A;  2N87 A;  5I98 A;  1R9H A;  2ZQU A;  1FKF A;  2ITK A;  2JMF A;  4U85 A;  1BKF A;  4J4N A;  1D7H A;  2KXQ A;  2XP6 A;  4ODQ A;  4LAV A;  4BF8 A;  5GPG A;  5DIV A;  1FKJ A;  2DK7 A;  2XP3 A;  4O2T A;  3ODK A;  2KE0 A;  1PIN A;  4IPX A;  4QT2 A;  2F21 A; 
#chains in the Genus database with same CATH topology
 5HKG A;  1Q6I A;  4IQC A;  1N1A A;  2PN0 A;  1KT0 A;  1Q6H A;  3RME A;  1Q1C A;  3GU0 A;  4E5R A;  1WB0 A;  2DT1 A;  2JV4 A;  5U47 A;  2AOS A;  4REX A;  4WKA A;  3O5D A;  2XPB A;  1GOI A;  4DWS C;  3ARV A;  1BL4 A;  3WD0 A;  3AS0 A;  3PRB A;  2XPA A;  4ZPT R;  3RM4 A;  3FSC A;  1LQ0 A;  4WKF A;  2A3A A;  3ARQ A;  4IT4 A;  3UI4 A;  2WM0 A;  3ARY A;  3NRK A;  2B5U B;  4S3K A;  1W26 A;  3RM8 A;  4WKH A;  4QIB A;  2RUD A;  4ITZ A;  1I5H W;  2WK2 A;  3IHZ A;  2YSB A;  4DRQ A;  1GPF A;  2F23 A;  2F4E A;  3G6L A;  4KR0 B;  2RUR A;  2ZR6 A;  5HWC A;  3JXV A;  4L3N A;  3O5M A;  2DT2 A;  3UQI A;  1C9H A;  5DF0 A;  1NSG A;  1EG4 A;  2DSU A;  2XP5 A;  2XP7 A;  4DWS D;  1X6N A;  3ARW A;  1FKR A;  1J4R A;  3LKX B;  4ODP A;  4NZC A;  1UR8 A;  3M85 A;  3BXW A;  3CGN A;  5B8I C;  2DG9 A;  4WK9 A;  4UDM A;  2PV3 A;  4LAY A;  1PBK A;  2F2D A;  3NI6 A;  4TW6 A;  3ART A;  4ML4 A;  3MCB A;  2G8Z A;  1O6I A;  2IF4 A;  2KO7 A;  3O5F A;  4ODK A;  1Q6U A;  4P8V A;  4DWS A;  4FAP A;  3G6M A;  1ZBK A;  4W9O A;  3WIJ A;  3CHD A;  1FKD A;  2FKE A;  4JYS A;  4FN2 A;  3KAB A;  3LE4 A;  4DRH A;  2LJ4 A;  4DRP A;  3CHC A;  4JFI A;  1L1P A;  4DIP A;  5HUA A;  4DRO A;  2DPE A;  4DRN A;  2L4J A;  5GPR A;  4Z2G A;  3TC5 A;  3TCZ A;  1E15 A;  3RM9 A;  2DSW A;  4JFK A;  1HKK A;  1HKJ A;  1WAW A;  5DEZ A;  1NWU A;  3WQW A;  1RP5 A;  4QT3 A;  1VF8 A;  1F40 A;  1F8A B;  2YBT A;  2M8I A;  2ZR5 A;  1FFQ A;  2BA1 A;  2YSI A;  1K9T A;  2ZQV A;  4ODR A;  3ALG A;  1TCO C;  3RFW A;  1QZ2 A;  4DRI A;  1ZL1 A;  3WD4 A;  1FD9 A;  3FSB A;  5E64 A;  2MF9 A;  5DO2 A;  2M1I A;  5HW7 A;  3QOK A;  3KZ7 A;  2M8J A;  2LAJ A;  2YSG A;  1NMW A;  1YAT A;  2KFW A;  4Z2L A;  4MNM A;  4QZV B;  1LG1 A;  4TNS A;  4Z2H A;  4P8W A;  3B8S A;  3CZ8 A;  2A3E A;  2LPV A;  4NNR A;  2MLX A;  5E65 A;  3CH9 A;  4MNK A;  2JX8 A;  4Q22 A;  2EZ5 W;  3FS8 A;  1W9P A;  3FAP A;  2RUQ A;  4N19 A;  4Z2I A;  4ZS6 A;  3O5R A;  3EY6 A;  1HXV A;  2Q5A A;  4HAR A;  2KR7 A;  3O5E A;  3B9E A;  1FKK A;  1SYT A;  3ARZ A;  5HW6 A;  1D7J A;  2JZV A;  1HJW A;  2VCD A;  1JNS A;  2O92 A;  2XP9 A;  3VAW A;  3WL1 A;  1ZBV A;  2WLZ A;  3ALF A;  2ZAJ A;  2KI3 A;  2M08 A;  2G41 A;  2YBU A;  1LG2 A;  1W1V A;  1J4I A;  1D6O A;  1RD6 A;  1D2K A;  3FY1 A;  4IQ2 A;  1E6Z A;  3KAG A;  3IK8 A;  3ARS A;  1M5Y A;  4W9Q A;  2DG4 A;  2A3B A;  3ARU A;  3O5L A;  1ROU A;  2MDI A;  1TR8 A;  1LL7 A;  3O5Q A;  4QT2 A;  2PI6 A;  1JCH B;  2MPH A;  3RGC A;  2E45 A;  2PPN A;  4DT4 A;  2DWV A;  1XHG A;  1O6W A;  1EIB A;  4G50 A;  3O5K A;  2ESC A;  3ARR A;  1HJV A;  3WKZ A;  4C02 B;  1TFV A;  1NWS A;  1FKI A;  3KAC A;  4ODM A;  3M7N A;  2AWG A;  2DG3 A;  4AY1 A;  3KAI A;  2PPP A;  1OGG A;  2LKN A;  4DZ3 A;  3KAD A;  1H0G A;  4KQZ A;  4TX0 A;  2DK1 A;  1FAP A;  4LAX A;  2ZR4 A;  1FKT A;  1U79 A;  1UR9 A;  3MQG A;  2PBC A;  4A0U A;  1FKH A;  3AS1 A;  3PQH A;  2YAJ B;  2XP8 A;  1W1Y A;  2ETN A;  5AHT A;  1JMQ A;  3UI6 A;  1Y0O A;  1J6Y A;  2PPO A;  5CQ2 A;  3GTY X;  3B9A A;  2YSF A;  4U86 A;  5J6E A;  3KAH A;  4ZPW R;  4ODL A;  5E66 A;  4JFL A;  1NMV A;  2ZQT A;  2A3C A;  3WL0 A;  3KCE A;  1W1T A;  5D75 A;  4HBO A;  1LL4 A;  1E6N A;  1EQ3 A;  2K8I A;  1W1P A;  2DSV A;  3UF8 A;  1QPF A;  1JNT A;  3UI5 A;  4XAK A;  1K9R A;  4Z2K A;  1T11 A;  3WD3 A;  1XRV A;  3AQU A;  2RUC A;  3PR9 A;  2PV2 A;  3WD1 A;  3MCB B;  3KAF A;  5HBF A;  1ITX A;  2RQS A;  3NTP A;  1E6R A;  4DWS B;  3H9R B;  1A7X A;  1HKM A;  3O5J A;  4Z2J A;  4URI A;  1ZCN A;  1EYM A;  4G2P A;  1FJD A;  2PV1 A;  3TDB A;  1ZK6 A;  3O5O A;  4MPK A;  2D9F A;  1FKG A;  3LUO A;  3UQB A;  4W9P A;  4LGX A;  4MGV A;  1ZU8 A;  4Q7N A;  2ZQS A;  4MNJ A;  3PRD A;  1B6C A;  2MLY A;  4JFJ A;  1FKS A;  3O5P A;  1KT1 A;  3JYM A;  4DZ2 A;  2Y8N B;  2O9O A;  2YSH A;  3WD2 A;  4MAV A;  4R0X A;  3PRA A;  4TW8 A;  4MNL A;  4W5U A;  2DSZ A;  4WJX A;  3AS3 A;  2WAD A;  3L4H A;  3GPK A;  3EIP A;  2QRV A;  5HWB A;  3LKX A;  1H0I A;  2FDM A;  2WLY A;  1JND A;  2UZ5 A;  4ODN A;  4TW7 A;  4MTV A;  5BXJ A;  2RSE A;  4HBE A;  3WQV A;  2MLZ A;  3MQH A;  3O5G A;  1EG3 A;  3W4R A;  4DRJ A;  2DMV A;  4GIV A;  4TYO A;  3AS2 A;  3B7X A;  1FKL A;  1FLC A;  4GGQ A;  4L72 B;  4MSP A;  1WNO A;  1NWR A;  2OWO A;  3IKD A;  5HTG A;  3OOB A;  2MNT A;  4DRK A;  4ZPV R;  3I6C A;  1JVW A;  1WR7 A;  5DIU A;  2FAP A;  5E5W A;  1WMV A;  2QF8 A;  5HT1 A;  1EHN A;  2KGJ A;  3CHF A;  4J4O A;  3O5I A;  3CNG A;  1FKB A;  2LGO A;  4GLX A;  2XP4 A;  1TK7 A;  1YW5 A;  4S3J A;  2JXW A;  1W9U A;  1D7I A;  1KFW A;  2M3O W;  1ZBW A;  3B9D A;  2P4V A;  1X6L A;  3JYJ A;  5JH8 A;  4JFM A;  4PTM A;  2DT3 A;  2Y78 A;  1IX5 A;  3OA5 A;  4DH0 A;  3UQA A;  1QPL A;  3ARP A;  1HJX A;  2RE3 A;  4U84 A;  3MDY B;  1ROT A;  5HW8 A;  1K9Q A;  1P5Q A;  2DJY A;  1FFR A;  4P8U A;  1W9V A;  1GUV A;  1J4H A;  2EUL A;  4DRM A;  5DIT A;  3CGM A;  1HKI A;  2M2A A;  3WH0 A;  2VN1 A;  4ODO A;  4IT6 A;  2IUZ A;  4P8X A;  4WIW A;  2OFN A;  1SR0 A;  1OWQ A;  4LAW A;  3IKG A;  2L2S A;  1NH6 A;  3PA7 A;  1LJY A;  2OLH A;  3FXY A;  2DT0 A;  1OGB A;  5E62 A;  3CHE A;  1ZBC A;  1CTN A;  2B31 A;  4NSB A;  2N87 A;  5I98 A;  1LL6 A;  1R9H A;  5GQB A;  1E6P A;  1E44 A;  2ZQU A;  1FKF A;  1JNE A;  2ITK A;  2JMF A;  4U85 A;  1BKF A;  4J4N A;  1E9L A;  2WAE A;  2KXQ A;  2XP6 A;  1D7H A;  3ARO A;  4ODQ A;  4LAV A;  1EDQ A;  4BF8 A;  3ARX A;  5GPG A;  1ZB5 A;  1NWT A;  5DIV A;  1FKJ A;  2DK7 A;  4R5E A;  2XP3 A;  4O2T A;  4A0T A;  3ODK A;  2KE0 A;  1PIN A;  4IPX A;  1GRJ A;  3BMB A;  2F21 A; 
#chains in the Genus database with same CATH homology
 5HKG A;  1Q6I A;  4IQC A;  1N1A A;  1KT0 A;  1Q6H A;  3RME A;  1Q1C A;  4E5R A;  1WB0 A;  2DT1 A;  2JV4 A;  5U47 A;  2AOS A;  4REX A;  4WKA A;  3O5D A;  2XPB A;  1GOI A;  4DWS C;  3ARV A;  1BL4 A;  3WD0 A;  3AS0 A;  3PRB A;  2XPA A;  4ZPT R;  3RM4 A;  3FSC A;  1LQ0 A;  4WKF A;  2A3A A;  3ARQ A;  4IT4 A;  3UI4 A;  2WM0 A;  3ARY A;  3NRK A;  4S3K A;  1W26 A;  3RM8 A;  4WKH A;  4QIB A;  2RUD A;  4ITZ A;  1I5H W;  2WK2 A;  3IHZ A;  2YSB A;  4DRQ A;  1GPF A;  2F4E A;  3G6L A;  4KR0 B;  2RUR A;  2ZR6 A;  5HWC A;  3JXV A;  4L3N A;  3O5M A;  2DT2 A;  3UQI A;  1C9H A;  5DF0 A;  1NSG A;  1EG4 A;  2DSU A;  2XP5 A;  2XP7 A;  4DWS D;  1X6N A;  3ARW A;  1FKR A;  1J4R A;  3LKX B;  4ODP A;  4NZC A;  1UR8 A;  3M85 A;  3BXW A;  3CGN A;  5B8I C;  2DG9 A;  4WK9 A;  2PV3 A;  4LAY A;  1PBK A;  2F2D A;  3NI6 A;  4TW6 A;  3ART A;  4ML4 A;  3MCB A;  2G8Z A;  1O6I A;  2IF4 A;  2KO7 A;  3O5F A;  4ODK A;  1Q6U A;  4P8V A;  4DWS A;  4FAP A;  3G6M A;  1ZBK A;  4W9O A;  3WIJ A;  3CHD A;  1FKD A;  2FKE A;  4JYS A;  4FN2 A;  3KAB A;  3LE4 A;  4DRH A;  2LJ4 A;  4DRP A;  3CHC A;  4JFI A;  1L1P A;  4DIP A;  5HUA A;  4DRO A;  2DPE A;  4DRN A;  2L4J A;  5GPR A;  4Z2G A;  3TC5 A;  3TCZ A;  1E15 A;  3RM9 A;  2DSW A;  4JFK A;  1HKK A;  1HKJ A;  1WAW A;  5DEZ A;  1NWU A;  3WQW A;  1RP5 A;  4QT3 A;  1VF8 A;  1F40 A;  1F8A B;  2YBT A;  2M8I A;  2ZR5 A;  1FFQ A;  2BA1 A;  2YSI A;  1K9T A;  2ZQV A;  4ODR A;  3ALG A;  1TCO C;  3RFW A;  1QZ2 A;  4DRI A;  1ZL1 A;  3WD4 A;  1FD9 A;  3FSB A;  5E64 A;  2MF9 A;  5DO2 A;  2M1I A;  5HW7 A;  3QOK A;  3KZ7 A;  2M8J A;  2LAJ A;  2YSG A;  1NMW A;  1YAT A;  2KFW A;  4Z2L A;  4MNM A;  4QZV B;  1LG1 A;  4TNS A;  4Z2H A;  4P8W A;  3B8S A;  3CZ8 A;  2A3E A;  2LPV A;  4NNR A;  2MLX A;  5E65 A;  3CH9 A;  4MNK A;  2JX8 A;  4Q22 A;  2EZ5 W;  3FS8 A;  1W9P A;  3FAP A;  2RUQ A;  4N19 A;  4Z2I A;  4ZS6 A;  3O5R A;  3EY6 A;  1HXV A;  2Q5A A;  4HAR A;  2KR7 A;  3O5E A;  3B9E A;  1FKK A;  1SYT A;  3ARZ A;  5HW6 A;  1D7J A;  2JZV A;  1HJW A;  2VCD A;  1JNS A;  2O92 A;  2XP9 A;  3VAW A;  3WL1 A;  1ZBV A;  2WLZ A;  3ALF A;  2ZAJ A;  2KI3 A;  2M08 A;  2G41 A;  2YBU A;  1LG2 A;  1W1V A;  1J4I A;  1D6O A;  1RD6 A;  1D2K A;  3FY1 A;  4IQ2 A;  1E6Z A;  3KAG A;  3IK8 A;  3ARS A;  1M5Y A;  4W9Q A;  2DG4 A;  2A3B A;  3ARU A;  3O5L A;  1ROU A;  2MDI A;  1TR8 A;  1LL7 A;  3O5Q A;  2PI6 A;  2MPH A;  3RGC A;  2E45 A;  2PPN A;  4DT4 A;  2DWV A;  1XHG A;  1O6W A;  1EIB A;  4G50 A;  3O5K A;  2ESC A;  3ARR A;  1HJV A;  3WKZ A;  4C02 B;  1TFV A;  1NWS A;  1FKI A;  3KAC A;  4ODM A;  3M7N A;  2AWG A;  2DG3 A;  4AY1 A;  3KAI A;  2PPP A;  1OGG A;  2LKN A;  4DZ3 A;  3KAD A;  1H0G A;  4KQZ A;  4TX0 A;  2DK1 A;  1FAP A;  4LAX A;  2ZR4 A;  1FKT A;  1U79 A;  1UR9 A;  3MQG A;  2PBC A;  4A0U A;  1FKH A;  3AS1 A;  3PQH A;  2YAJ B;  2XP8 A;  1W1Y A;  5AHT A;  1JMQ A;  3UI6 A;  1Y0O A;  1J6Y A;  2PPO A;  5CQ2 A;  3B9A A;  2YSF A;  4U86 A;  5J6E A;  3KAH A;  4ZPW R;  4ODL A;  5E66 A;  4JFL A;  1NMV A;  2ZQT A;  2A3C A;  3WL0 A;  3KCE A;  1W1T A;  5D75 A;  4HBO A;  1LL4 A;  1E6N A;  1EQ3 A;  2K8I A;  1W1P A;  2DSV A;  3UF8 A;  1QPF A;  1JNT A;  3UI5 A;  4XAK A;  1K9R A;  4Z2K A;  1T11 A;  3WD3 A;  1XRV A;  3AQU A;  2RUC A;  3PR9 A;  2PV2 A;  3WD1 A;  3MCB B;  3KAF A;  5HBF A;  1ITX A;  2RQS A;  3NTP A;  1E6R A;  4DWS B;  3H9R B;  1A7X A;  1HKM A;  3O5J A;  4Z2J A;  4URI A;  1ZCN A;  1EYM A;  4G2P A;  1FJD A;  2PV1 A;  3TDB A;  1ZK6 A;  3O5O A;  4MPK A;  2D9F A;  1FKG A;  3LUO A;  3UQB A;  4W9P A;  4LGX A;  4MGV A;  1ZU8 A;  4Q7N A;  2ZQS A;  4MNJ A;  3PRD A;  1B6C A;  2MLY A;  4JFJ A;  1FKS A;  3O5P A;  1KT1 A;  3JYM A;  4DZ2 A;  2Y8N B;  2O9O A;  2YSH A;  3WD2 A;  4MAV A;  4R0X A;  3PRA A;  4TW8 A;  4MNL A;  4W5U A;  2DSZ A;  4WJX A;  3AS3 A;  2WAD A;  3L4H A;  3GPK A;  2QRV A;  5HWB A;  3LKX A;  1H0I A;  2FDM A;  2WLY A;  1JND A;  2UZ5 A;  4ODN A;  4TW7 A;  4MTV A;  5BXJ A;  2RSE A;  4HBE A;  3WQV A;  2MLZ A;  3MQH A;  3O5G A;  1EG3 A;  3W4R A;  4DRJ A;  2DMV A;  4GIV A;  4TYO A;  3AS2 A;  3B7X A;  1FKL A;  1FLC A;  4GGQ A;  4L72 B;  4MSP A;  1WNO A;  1NWR A;  2OWO A;  3IKD A;  5HTG A;  3OOB A;  2MNT A;  4DRK A;  4ZPV R;  3I6C A;  1JVW A;  1WR7 A;  5DIU A;  2FAP A;  5E5W A;  1WMV A;  2QF8 A;  5HT1 A;  1EHN A;  2KGJ A;  3CHF A;  4J4O A;  3O5I A;  3CNG A;  1FKB A;  2LGO A;  4GLX A;  2XP4 A;  1TK7 A;  1YW5 A;  4S3J A;  2JXW A;  1W9U A;  1D7I A;  1KFW A;  2M3O W;  1ZBW A;  3B9D A;  1X6L A;  3JYJ A;  5JH8 A;  4JFM A;  4PTM A;  2DT3 A;  2Y78 A;  1IX5 A;  3OA5 A;  4DH0 A;  3UQA A;  1QPL A;  3ARP A;  1HJX A;  2RE3 A;  4U84 A;  3MDY B;  1ROT A;  5HW8 A;  1K9Q A;  1P5Q A;  2DJY A;  1FFR A;  1W9V A;  1GUV A;  1J4H A;  4DRM A;  5DIT A;  3CGM A;  1HKI A;  2M2A A;  3WH0 A;  2VN1 A;  4ODO A;  4IT6 A;  2IUZ A;  4P8X A;  4WIW A;  2OFN A;  1SR0 A;  1OWQ A;  4LAW A;  3IKG A;  2L2S A;  1NH6 A;  3PA7 A;  1LJY A;  2OLH A;  3FXY A;  2DT0 A;  1OGB A;  5E62 A;  3CHE A;  1ZBC A;  1CTN A;  2B31 A;  4NSB A;  2N87 A;  5I98 A;  1LL6 A;  1R9H A;  5GQB A;  1E6P A;  2ZQU A;  1FKF A;  1JNE A;  2ITK A;  2JMF A;  4U85 A;  1BKF A;  4J4N A;  1E9L A;  2WAE A;  2KXQ A;  2XP6 A;  1D7H A;  3ARO A;  4ODQ A;  4LAV A;  1EDQ A;  4BF8 A;  3ARX A;  5GPG A;  1ZB5 A;  1NWT A;  5DIV A;  1FKJ A;  2DK7 A;  4R5E A;  2XP3 A;  4O2T A;  4A0T A;  3ODK A;  2KE0 A;  1PIN A;  4IPX A;  4P8U A;  4QT2 A;  2F21 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...