2F21A

Human pin1 fip mutant
Total Genus 48
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
48
sequence length
162
structure length
153
Chain Sequence
b'MADEEKLPPGWEKRMSADGRVYYFNHITNASQWERPSGQGEPARVRCSHLLVKHSQSRRPSSWRQEKITRTKEEALELINGYIQKIKSGEEDFESLASQFSDCSSAKARGDLGAFSRGQMQKPFEDASFALRTGEMSGPVFTDSGIHIILRTE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Peptidyl-prolyl cis-trans isomerase NIMA-interacting 1
publication title Structure-function-folding relationship in a WW domain.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Isomerase
total genus 48
structure length 153
sequence length 162
ec nomenclature ec 5.2.1.8: Peptidylprolyl isomerase.
pdb deposition date 2005-11-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00397 WW WW domain
A PF00639 Rotamase PPIC-type PPIASE domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.20.70.10 Mainly Beta Single Sheet Ubiquitin Ligase Nedd4; Chain: W; Ubiquitin Ligase Nedd4; Chain: W; 2f21A01
3.10.50.40 Alpha Beta Roll Chitinase A; domain 3 Chitinase A; domain 3 2f21A02
1D7IA 1NMVA 4O2TA 1PINA 3KAIA 4IQCA 2LPVA 2MNTA 4JYSA 2D9FA 3JYMA 4LAYA 4ODKA 2M3OW 3UQBA 1J4RA 1K9RA 2KFWA 3PA7A 3O5KA 4N19A 1K9QA 2DG9A 5HTGA 2PV2A 1J6YA 1ROUA 1P5QA 3ODKA 5BXJA 3PRDA 3GPKA 1YATA 2JXWA 1QPLA 2M2AA 4DRNA 5HKGA 4QT3A 3LE4A 4C02B 4DRIA 2FKEA 2M8IA 2ZR4A 2PV1A 2XP5A 3O5IA 1M5YA 2PPOA 4TNSA 1I5HW 3O5MA 5HW7A 3O5EA 3PRBA 2F4EA 3CGNA 2JMFA 2ZQUA 3NTPA 2YSHA 1B6CA 1BL4A 3KAHA 4ODLA 1L1PA 3M85A 1FKDA 2LAJA 2PPNA 2XPBA 4J4OA 4MSPA 2FAPA 1D6OA 2RE3A 2KO7A 1Y0OA 2LKNA 4TW6A 2RQSA 1A7XA 3OOBA 2RURA 5CQ2A 2M1IA 4ODRA 2ZR5A 3TCZA 2XP7A 2YSIA 4DZ2A 4DZ3A 2JX8A 3O5FA 2PBCA 2MDIA 1FKTA 3UQAA 1Q6UA 2RUDA 4NNRA 2RUQA 3O5LA 1FKSA 3IHZA 4MGVA 3O5OA 4ITZA 1C9HA 5D75A 2YSBA 3O5QA 3FAPA 5DIVA 4DRMA 2XP9A 1EYMA 4DH0A 5B8IC 2L4JA 4JFIA 1FKJA 2MLZA 4JFJA 2XPAA 4LAXA 5HT1A 2OFNA 1NSGA 2F2DA 4R0XA 1JMQA 1QZ2A 4DRKA 2DMVA 4DRPA 4DRQA 2ZQTA 4TW7A 2MF9A 4U86A 2KR7A 1BKFA 2DWVA 1FAPA 2KXQA 3JYJA 4TX0A 1F8AB 1PBKA 1Q6HA 1N1AA 3TC5A 3KZ7A 3RFWA 1TK7A 2MPHA 2L2SA 4TW8A 4QIBA 1FKFA 3O5PA 4ODMA 4GIVA 1ROTA 1FKIA 3UF8A 2MLYA 3M7NA 4U85A 1FKGA 4U84A 4W9QA 1TCOC 2VN1A 1JVWA 3KCEA 2K8IA 3KAFA 1EQ3A 3KABA 2E45A 2RSEA 1R9HA 2DJYA 4DT4A 4ODOA 2MLXA 4QT2A 1T11A 3NI6A 1JNTA 3KACA 3UI6A 4DROA 2KI3A 2LGOA 4JFLA 4LAWA 5HW8A 3IK8A 4W9PA 3IKGA 1J4HA 1O6WA 3UI5A 2ZQSA 5DIUA 1D7HA 1Q6IA 4FAPA 3O5DA 4DRHA 3O5RA 3MDYB 2YSFA 4ODPA 3UQIA 3IKDA 4W9OA 4JFKA 2XP4A 2UZ5A 2XP3A 1KT1A 2DK7A 2KE0A 4G50A 4E5RA 5AHTA 1FKBA 3O5GA 5I98A 1ZK6A 5HW6A 3KAGA 1HXVA 1JNSA 1F40A 4DRJA 5J6EA 5DITA 3JXVA 2Q5AA 2ITKA 1Q1CA 4BF8A 1U79A 2JV4A 1J4IA 1FKHA 1FKKA 4DIPA 1WMVA 2JZVA 2ZAJA 2F21A 1KT0A 4IPXA 2IF4A 4G2PA 4ODNA 2EZ5W 3UI4A 2DG4A 1EG3A 2Y78A 4JFMA 2PPPA 2RUCA 2AWGA 1QPFA 5HWCA 2BA1A 2M8JA 2N87A 3O5JA 3L4HA 4ODQA 2XP8A 2PV3A 3NRKA 2DG3A 3LUOA 1FKRA 2ZQVA 1NMWA 2VCDA 2XP6A 1FJDA 3CGMA 2M08A 4J4NA 3RGCA 2LJ4A 5GPGA 3I6CA 3CNGA 1ZCNA 4TYOA 5HUAA 3TDBA 2ZR6A 1EG4A 4REXA 5HWBA 3B7XA 2DK1A 4FN2A 3H9RB 3VAWA 1FD9A 4GGQA 4LAVA 1W26A 2KGJA 3WH0A 3EY6A 1WR7A 4IQ2A 1YW5A 1FKLA 1D7JA 3KADA 2YSGA
chains in the Genus database with same CATH superfamily
2PN0A 1D7IA 1NMVA 4O2TA 3PR9A 3ARQA 1W1VA 1PINA 3KAIA 4IQCA 2LPVA 3OA5A 2MNTA 4JYSA 2D9FA 3JYMA 4LAYA 4ODKA 3FS8A 2M3OW 2PI6A 1ITXA 3UQBA 1W9UA 1J4RA 1K9RA 2KFWA 3PA7A 3O5KA 5E64A 3WD4A 2FDMA 1K9QA 4N19A 2DG9A 2ESCA 5HTGA 2DSZA 2A3AA 2PV2A 4L72B 1CTNA 1J6YA 1ROUA 1P5QA 3ODKA 5BXJA 1W9VA 3PRAA 3ALGA 3PRDA 1E9LA 3GPKA 1GUVA 1YATA 1OGBA 2JXWA 1QPLA 1LL4A 2M2AA 4DRNA 3CHDA 5HKGA 4QT3A 1E15A 3LE4A 4C02B 1NWRA 3WD1A 4S3JA 4DRIA 1D2KA 2FKEA 4ZS6A 4ZPWR 4WKAA 1ZBCA 3AQUA 2M8IA 2ZR4A 2PV1A 4W5UA 4DWSD 2XP5A 3O5IA 3B9AA 1M5YA 2PPOA 3ARRA 4TNSA 1I5HW 3O5MA 4UDMA 5HW7A 4DWSC 2EULA 2WK2A 3O5EA 3PRBA 2DT1A 2F4EA 3CGNA 3ARXA 1KFWA 2JMFA 2ZQUA 2YSHA 3NTPA 1E44A 1B6CA 1RP5A 1BL4A 2G8ZA 3KAHA 3WD3A 4ODLA 3FSBA 1L1PA 3M85A 2A3BA 1FKDA 3MCBA 2LAJA 1WNOA 2PPNA 4WKFA 2XPBA 3FXYA 3MCBB 1NWTA 3RM9A 4J4OA 4MSPA 2FAPA 1W1TA 1D6OA 4IT6A 1LQ0A 3MQGA 2RE3A 4GLXA 3ARSA 2KO7A 1Y0OA 2LKNA 4TW6A 3B8SA 1E6PA 1OGGA 2RQSA 1A7XA 3OOBA 1VF8A 2RURA 5CQ2A 2M1IA 2ZR5A 4MNKA 4ODRA 2QRVA 3AS0A 1K9TA 3TCZA 1JNEA 2XP7A 1LG1A 1FLCA 4URIA 4WIWA 2YSIA 4DZ2A 4DZ3A 2JX8A 3O5FA 5HBFA 4DWSB 1NH6A 4LGXA 4Z2LA 2PBCA 2MDIA 1FKTA 1NWUA 3RM8A 3UQAA 1E6RA 1Q6UA 2RUDA 4NZCA 4NNRA 2RUQA 4WK9A 3O5LA 5GPRA 2O9OA 1FKSA 3IHZA 4MGVA 3O5OA 1WB0A 1GPFA 2WLZA 4ITZA 1C9HA 5D75A 2A3EA 3AROA 2YSBA 3O5QA 3FAPA 4WKHA 4L3NA 5DIVA 3CZ8A 4DRMA 2XP9A 3B9DA 1EYMA 4DH0A 5E62A 1EDQA 5B8IC 1SYTA 1HKKA 2WM0A 2L4JA 4JFIA 3RMEA 1FKJA 2MLZA 4JFJA 4ML4A 3CH9A 2XPAA 4A0UA 4LAXA 5HT1A 1NWSA 2OFNA 1NSGA 2F2DA 4R0XA 1JMQA 1QZ2A 4DRKA 4P8WA 3GU0A 1HJXA 2DMVA 1LL6A 1ZL1A 1O6IA 4DRPA 4MNMA 4DRQA 2ZQTA 5U47A 4TW7A 3ARTA 2IUZA 2MF9A 4U86A 2KR7A 1BKFA 3AS1A 2DWVA 5E5WA 2KXQA 1FAPA 3JYJA 1F8AB 1PBKA 1Q6HA 4P8UA 4TX0A 1W9PA 1N1AA 1H0IA 3QOKA 1E6ZA 3TC5A 3KZ7A 1X6LA 1OWQA 3RFWA 1TK7A 2DSWA 2MPHA 2L2SA 2QF8A 4TW8A 4ZPTR 4KQZA 4QIBA 1E6NA 1FKFA 3O5PA 2G41A 4S3KA 4ODMA 1HJVA 4Z2HA 2B31A 2Y8NB 2ETNA 4GIVA 3EIPA 4IT4A 1ROTA 3WQWA 3ARYA 1FKIA 3UF8A 2MLYA 4A0TA 1LG2A 1ZB5A 1EHNA 3M7NA 4U85A 4R5EA 1GRJA 4Z2JA 1FKGA 3ARWA 3WKZA 4U84A 4W9QA 4QZVB 2YBUA 3RM4A 3WL0A 3LKXA 1TCOC 1W1PA 2VN1A 1JVWA 3KCEA 2WADA 2O92A 2K8IA 3KAFA 1EQ3A 3KABA 3LKXB 1W1YA 2E45A 2RSEA 2F23A 4WJXA 1R9HA 3G6LA 2DJYA 4DT4A 4ODOA 2YBTA 2MLXA 4QT2A 5DO2A 1T11A 3NI6A 1JNTA 3KACA 2P4VA 5DEZA 3UI6A 3WL1A 3ARZA 2DSUA 3BXWA 3ARVA 4DROA 3CHFA 2KI3A 5GQBA 2LGOA 4JFLA 4LAWA 1HKIA 1XHGA 4NSBA 5HW8A 1GOIA 3IK8A 4W9PA 3IKGA 1J4HA 1HJWA 1O6WA 3UI5A 4MAVA 4XAKA 4ZPVR 2ZQSA 1X6NA 5DIUA 2WLYA 4MPKA 1D7HA 1Q6IA 1JNDA 4FAPA 1LL7A 4HBOA 3O5DA 4DRHA 3O5RA 3G6MA 3MDYB 1SR0A 2YSFA 4ODPA 3CHCA 4HARA 3UQIA 3IKDA 4W9OA 4JFKA 2XP4A 2UZ5A 2XP3A 2YAJB 1KT1A 2DK7A 3B9EA 3AS2A 1IX5A 2KE0A 1H0GA 4G50A 4E5RA 1ZBWA 4Q22A 1RD6A 5AHTA 1FKBA 2DPEA 1TFVA 3O5GA 5I98A 4AY1A 1ZK6A 5HW6A 3KAGA 5E66A 1TR8A 1HXVA 1JNSA 1F40A 3BMBA 4DRJA 5J6EA 5DITA 1ZU8A 1LJYA 3MQHA 4MNLA 4Z2GA 3JXVA 2Q5AA 2ITKA 1EIBA 3WIJA 1Q1CA 4Q7NA 4BF8A 1U79A 2JV4A 4PTMA 4MTVA 4P8VA 2DT0A 4Z2KA 1J4IA 1FKHA 1FKKA 4DIPA 4KR0B 1WMVA 2JZVA 2ZAJA 3ALFA 2F21A 5E65A 1KT0A 4IPXA 1FFRA 1UR9A 2IF4A 4G2PA 4ODNA 2EZ5W 3ARPA 3UI4A 2DG4A 3GTYX 1EG3A 2Y78A 4JFMA 2PPPA 2RUCA 1XRVA 2AWGA 4MNJA 1QPFA 5JH8A 5HWCA 2A3CA 2BA1A 2M8JA 2N87A 3O5JA 3PQHA 4Z2IA 3L4HA 2B5UB 4ODQA 2XP8A 2PV3A 3NRKA 3W4RA 2DG3A 2OLHA 3FY1A 3LUOA 1FKRA 2ZQVA 1NMWA 2DT2A 2VCDA 2XP6A 1FJDA 1UR8A 3CGMA 1HKMA 2M08A 3WD0A 4J4NA 3RGCA 2LJ4A 5GPGA 3I6CA 3CNGA 1ZCNA 4TYOA 5HUAA 3TDBA 2ZR6A 1FFQA 1EG4A 4REXA 5HWBA 4DWSA 3B7XA 2DK1A 2OWOA 3H9RB 4FN2A 3VAWA 2WAEA 1FD9A 4GGQA 4LAVA 1W26A 2KGJA 1ZBVA 3WH0A 3WQVA 5DF0A 3EY6A 4P8XA 3CHEA 1WR7A 2DSVA 3FSCA 1WAWA 2AOSA 1ZBKA 3WD2A 3AS3A 4IQ2A 2DT3A 1JCHB 4HBEA 1YW5A 1FKLA 3ARUA 1D7JA 3KADA 1HKJA 2YSGA
chains in the Genus database with same CATH topology
1D7IA 1NMVA 4O2TA 3PR9A 3ARQA 1W1VA 1PINA 3KAIA 4IQCA 2LPVA 3OA5A 2MNTA 4JYSA 2D9FA 3JYMA 4LAYA 4ODKA 3FS8A 2M3OW 2PI6A 1ITXA 3UQBA 1W9UA 1J4RA 1K9RA 2KFWA 3PA7A 3O5KA 5E64A 3WD4A 2FDMA 1K9QA 4N19A 2DG9A 2ESCA 5HTGA 2DSZA 2A3AA 2PV2A 4L72B 1CTNA 1J6YA 1ROUA 1P5QA 3ODKA 5BXJA 1W9VA 3PRAA 3ALGA 3PRDA 1E9LA 3GPKA 1GUVA 1YATA 1OGBA 2JXWA 1QPLA 1LL4A 2M2AA 4DRNA 3CHDA 5HKGA 4QT3A 1E15A 3LE4A 4C02B 1NWRA 3WD1A 4S3JA 4DRIA 1D2KA 2FKEA 4ZS6A 4ZPWR 4WKAA 1ZBCA 3AQUA 2M8IA 2ZR4A 2PV1A 4W5UA 4DWSD 2XP5A 3O5IA 3B9AA 1M5YA 2PPOA 3ARRA 4TNSA 1I5HW 3O5MA 5HW7A 4DWSC 2WK2A 3O5EA 3PRBA 2DT1A 2F4EA 3CGNA 3ARXA 1KFWA 2JMFA 2ZQUA 2YSHA 3NTPA 1B6CA 1RP5A 1BL4A 2G8ZA 3KAHA 3WD3A 4ODLA 3FSBA 1L1PA 3M85A 2A3BA 1FKDA 3MCBA 2LAJA 1WNOA 2PPNA 4WKFA 2XPBA 3FXYA 3MCBB 1NWTA 3RM9A 4J4OA 4MSPA 2FAPA 1W1TA 1D6OA 4IT6A 1LQ0A 3MQGA 2RE3A 4GLXA 3ARSA 2KO7A 1Y0OA 2LKNA 4TW6A 3B8SA 1E6PA 1OGGA 2RQSA 1A7XA 3OOBA 1VF8A 2RURA 5CQ2A 2M1IA 2ZR5A 4MNKA 4ODRA 2QRVA 3AS0A 1K9TA 3TCZA 1JNEA 2XP7A 1LG1A 1FLCA 4URIA 4WIWA 2YSIA 4DZ2A 4DZ3A 2JX8A 3O5FA 5HBFA 4DWSB 1NH6A 4LGXA 4Z2LA 2PBCA 2MDIA 1FKTA 1NWUA 3RM8A 3UQAA 1E6RA 1Q6UA 2RUDA 4NZCA 4NNRA 2RUQA 4WK9A 3O5LA 5GPRA 2O9OA 1FKSA 3IHZA 4MGVA 3O5OA 1WB0A 1GPFA 2WLZA 4ITZA 1C9HA 5D75A 2A3EA 3AROA 2YSBA 3O5QA 3FAPA 4WKHA 4L3NA 5DIVA 3CZ8A 4DRMA 2XP9A 3B9DA 1EYMA 4DH0A 5E62A 1EDQA 5B8IC 1SYTA 1HKKA 2WM0A 2L4JA 4JFIA 3RMEA 1FKJA 2MLZA 4JFJA 4ML4A 3CH9A 2XPAA 4A0UA 4LAXA 5HT1A 1NWSA 2OFNA 1NSGA 2F2DA 4R0XA 1JMQA 1QZ2A 4DRKA 4P8WA 1HJXA 2DMVA 1LL6A 1ZL1A 1O6IA 4DRPA 4MNMA 4DRQA 2ZQTA 5U47A 4TW7A 3ARTA 2IUZA 2MF9A 4U86A 2KR7A 1BKFA 3AS1A 2DWVA 5E5WA 2KXQA 1FAPA 3JYJA 1F8AB 1PBKA 1Q6HA 4P8UA 4TX0A 1W9PA 1N1AA 1H0IA 3QOKA 1E6ZA 3TC5A 3KZ7A 1X6LA 1OWQA 3RFWA 1TK7A 2DSWA 2MPHA 2L2SA 2QF8A 4TW8A 4ZPTR 4KQZA 4QIBA 1E6NA 1FKFA 3O5PA 2G41A 4S3KA 4ODMA 1HJVA 4Z2HA 2B31A 2Y8NB 4GIVA 4IT4A 1ROTA 3WQWA 3ARYA 1FKIA 3UF8A 2MLYA 4A0TA 1LG2A 1ZB5A 1EHNA 3M7NA 4U85A 4R5EA 4Z2JA 1FKGA 3ARWA 3WKZA 4U84A 4W9QA 4QZVB 2YBUA 3RM4A 3WL0A 3LKXA 1TCOC 1W1PA 2VN1A 1JVWA 3KCEA 2WADA 2O92A 2K8IA 3KAFA 1EQ3A 3KABA 3LKXB 1W1YA 2E45A 2RSEA 4WJXA 1R9HA 3G6LA 2DJYA 4DT4A 4ODOA 2YBTA 2MLXA 4QT2A 5DO2A 1T11A 3NI6A 1JNTA 3KACA 5DEZA 3UI6A 3WL1A 3ARZA 2DSUA 3BXWA 3ARVA 4DROA 3CHFA 2KI3A 5GQBA 2LGOA 4JFLA 4LAWA 1HKIA 1XHGA 4NSBA 5HW8A 1GOIA 3IK8A 4W9PA 3IKGA 1J4HA 1HJWA 1O6WA 3UI5A 4MAVA 4XAKA 4ZPVR 2ZQSA 1X6NA 5DIUA 2WLYA 4MPKA 1D7HA 1Q6IA 1JNDA 4FAPA 1LL7A 4HBOA 3O5DA 4DRHA 3O5RA 3G6MA 3MDYB 1SR0A 2YSFA 4ODPA 3CHCA 4HARA 3UQIA 3IKDA 4W9OA 4JFKA 2XP4A 2UZ5A 2XP3A 2YAJB 1KT1A 2DK7A 3B9EA 3AS2A 1IX5A 2KE0A 1H0GA 4G50A 4E5RA 1ZBWA 4Q22A 1RD6A 5AHTA 1FKBA 2DPEA 1TFVA 3O5GA 5I98A 4AY1A 1ZK6A 5HW6A 3KAGA 5E66A 1TR8A 1HXVA 1JNSA 1F40A 4DRJA 5J6EA 5DITA 1ZU8A 1LJYA 3MQHA 4MNLA 4Z2GA 3JXVA 2Q5AA 2ITKA 1EIBA 3WIJA 1Q1CA 4Q7NA 4BF8A 1U79A 2JV4A 4PTMA 4MTVA 4P8VA 2DT0A 4Z2KA 1J4IA 1FKHA 1FKKA 4DIPA 4KR0B 1WMVA 2JZVA 2ZAJA 3ALFA 2F21A 5E65A 1KT0A 4IPXA 1FFRA 1UR9A 2IF4A 4G2PA 4ODNA 2EZ5W 3ARPA 3UI4A 2DG4A 1EG3A 2Y78A 4JFMA 2PPPA 2RUCA 1XRVA 2AWGA 4MNJA 1QPFA 5JH8A 5HWCA 2A3CA 2BA1A 2M8JA 2N87A 3O5JA 3PQHA 4Z2IA 3L4HA 4ODQA 2XP8A 2PV3A 3NRKA 3W4RA 2DG3A 2OLHA 3FY1A 3LUOA 1FKRA 2ZQVA 1NMWA 2DT2A 2VCDA 2XP6A 1FJDA 1UR8A 3CGMA 1HKMA 2M08A 3WD0A 4J4NA 3RGCA 2LJ4A 5GPGA 3I6CA 3CNGA 1ZCNA 4TYOA 5HUAA 3TDBA 2ZR6A 1FFQA 1EG4A 4REXA 5HWBA 4DWSA 3B7XA 2DK1A 2OWOA 3H9RB 4FN2A 3VAWA 2WAEA 1FD9A 4GGQA 4LAVA 1W26A 2KGJA 1ZBVA 3WH0A 3WQVA 5DF0A 3EY6A 4P8XA 3CHEA 1WR7A 2DSVA 3FSCA 1WAWA 2AOSA 1ZBKA 3WD2A 3AS3A 4IQ2A 2DT3A 4HBEA 1YW5A 1FKLA 3ARUA 1D7JA 3KADA 1HKJA 2YSGA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1D7I A;  1NMV A;  4O2T A;  1PIN A;  3KAI A;  4IQC A;  2LPV A;  2MNT A;  4JYS A;  2D9F A;  3JYM A;  4LAY A;  4ODK A;  2M3O W;  3UQB A;  1J4R A;  1K9R A;  2KFW A;  3PA7 A;  3O5K A;  4N19 A;  1K9Q A;  2DG9 A;  5HTG A;  2PV2 A;  1J6Y A;  1ROU A;  1P5Q A;  3ODK A;  5BXJ A;  3PRD A;  3GPK A;  1YAT A;  2JXW A;  1QPL A;  2M2A A;  4DRN A;  5HKG A;  4QT3 A;  3LE4 A;  4C02 B;  4DRI A;  2FKE A;  2M8I A;  2ZR4 A;  2PV1 A;  2XP5 A;  3O5I A;  1M5Y A;  2PPO A;  4TNS A;  1I5H W;  3O5M A;  5HW7 A;  3O5E A;  3PRB A;  2F4E A;  3CGN A;  2JMF A;  2ZQU A;  3NTP A;  2YSH A;  1B6C A;  1BL4 A;  3KAH A;  4ODL A;  1L1P A;  3M85 A;  1FKD A;  2LAJ A;  2PPN A;  2XPB A;  4J4O A;  4MSP A;  2FAP A;  1D6O A;  2RE3 A;  2KO7 A;  1Y0O A;  2LKN A;  4TW6 A;  2RQS A;  1A7X A;  3OOB A;  2RUR A;  5CQ2 A;  2M1I A;  4ODR A;  2ZR5 A;  3TCZ A;  2XP7 A;  2YSI A;  4DZ2 A;  4DZ3 A;  2JX8 A;  3O5F A;  2PBC A;  2MDI A;  1FKT A;  3UQA A;  1Q6U A;  2RUD A;  4NNR A;  2RUQ A;  3O5L A;  1FKS A;  3IHZ A;  4MGV A;  3O5O A;  4ITZ A;  1C9H A;  5D75 A;  2YSB A;  3O5Q A;  3FAP A;  5DIV A;  4DRM A;  2XP9 A;  1EYM A;  4DH0 A;  5B8I C;  2L4J A;  4JFI A;  1FKJ A;  2MLZ A;  4JFJ A;  2XPA A;  4LAX A;  5HT1 A;  2OFN A;  1NSG A;  2F2D A;  4R0X A;  1JMQ A;  1QZ2 A;  4DRK A;  2DMV A;  4DRP A;  4DRQ A;  2ZQT A;  4TW7 A;  2MF9 A;  4U86 A;  2KR7 A;  1BKF A;  2DWV A;  1FAP A;  2KXQ A;  3JYJ A;  4TX0 A;  1F8A B;  1PBK A;  1Q6H A;  1N1A A;  3TC5 A;  3KZ7 A;  3RFW A;  1TK7 A;  2MPH A;  2L2S A;  4TW8 A;  4QIB A;  1FKF A;  3O5P A;  4ODM A;  4GIV A;  1ROT A;  1FKI A;  3UF8 A;  2MLY A;  3M7N A;  4U85 A;  1FKG A;  4U84 A;  4W9Q A;  1TCO C;  2VN1 A;  1JVW A;  3KCE A;  2K8I A;  3KAF A;  1EQ3 A;  3KAB A;  2E45 A;  2RSE A;  1R9H A;  2DJY A;  4DT4 A;  4ODO A;  2MLX A;  4QT2 A;  1T11 A;  3NI6 A;  1JNT A;  3KAC A;  3UI6 A;  4DRO A;  2KI3 A;  2LGO A;  4JFL A;  4LAW A;  5HW8 A;  3IK8 A;  4W9P A;  3IKG A;  1J4H A;  1O6W A;  3UI5 A;  2ZQS A;  5DIU A;  1D7H A;  1Q6I A;  4FAP A;  3O5D A;  4DRH A;  3O5R A;  3MDY B;  2YSF A;  4ODP A;  3UQI A;  3IKD A;  4W9O A;  4JFK A;  2XP4 A;  2UZ5 A;  2XP3 A;  1KT1 A;  2DK7 A;  2KE0 A;  4G50 A;  4E5R A;  5AHT A;  1FKB A;  3O5G A;  5I98 A;  1ZK6 A;  5HW6 A;  3KAG A;  1HXV A;  1JNS A;  1F40 A;  4DRJ A;  5J6E A;  5DIT A;  3JXV A;  2Q5A A;  2ITK A;  1Q1C A;  4BF8 A;  1U79 A;  2JV4 A;  1J4I A;  1FKH A;  1FKK A;  4DIP A;  1WMV A;  2JZV A;  2ZAJ A;  2F21 A;  1KT0 A;  4IPX A;  2IF4 A;  4G2P A;  4ODN A;  2EZ5 W;  3UI4 A;  2DG4 A;  1EG3 A;  2Y78 A;  4JFM A;  2PPP A;  2RUC A;  2AWG A;  1QPF A;  5HWC A;  2BA1 A;  2M8J A;  2N87 A;  3O5J A;  3L4H A;  4ODQ A;  2XP8 A;  2PV3 A;  3NRK A;  2DG3 A;  3LUO A;  1FKR A;  2ZQV A;  1NMW A;  2VCD A;  2XP6 A;  1FJD A;  3CGM A;  2M08 A;  4J4N A;  3RGC A;  2LJ4 A;  5GPG A;  3I6C A;  3CNG A;  1ZCN A;  4TYO A;  5HUA A;  3TDB A;  2ZR6 A;  1EG4 A;  4REX A;  5HWB A;  3B7X A;  2DK1 A;  4FN2 A;  3H9R B;  3VAW A;  1FD9 A;  4GGQ A;  4LAV A;  1W26 A;  2KGJ A;  3WH0 A;  3EY6 A;  1WR7 A;  4IQ2 A;  1YW5 A;  1FKL A;  1D7J A;  3KAD A;  2YSG A; 
#chains in the Genus database with same CATH topology
 2PN0 A;  1D7I A;  1NMV A;  4O2T A;  3PR9 A;  3ARQ A;  1W1V A;  1PIN A;  3KAI A;  4IQC A;  2LPV A;  3OA5 A;  2MNT A;  4JYS A;  2D9F A;  3JYM A;  4LAY A;  4ODK A;  3FS8 A;  2M3O W;  2PI6 A;  1ITX A;  3UQB A;  1W9U A;  1J4R A;  1K9R A;  2KFW A;  3PA7 A;  3O5K A;  5E64 A;  3WD4 A;  2FDM A;  1K9Q A;  4N19 A;  2DG9 A;  2ESC A;  5HTG A;  2DSZ A;  2A3A A;  2PV2 A;  4L72 B;  1CTN A;  1J6Y A;  1ROU A;  1P5Q A;  3ODK A;  5BXJ A;  1W9V A;  3PRA A;  3ALG A;  3PRD A;  1E9L A;  3GPK A;  1GUV A;  1YAT A;  1OGB A;  2JXW A;  1QPL A;  1LL4 A;  2M2A A;  4DRN A;  3CHD A;  5HKG A;  4QT3 A;  1E15 A;  3LE4 A;  4C02 B;  1NWR A;  3WD1 A;  4S3J A;  4DRI A;  1D2K A;  2FKE A;  4ZS6 A;  4ZPW R;  4WKA A;  1ZBC A;  3AQU A;  2M8I A;  2ZR4 A;  2PV1 A;  4W5U A;  4DWS D;  2XP5 A;  3O5I A;  3B9A A;  1M5Y A;  2PPO A;  3ARR A;  4TNS A;  1I5H W;  3O5M A;  4UDM A;  5HW7 A;  4DWS C;  2EUL A;  2WK2 A;  3O5E A;  3PRB A;  2DT1 A;  2F4E A;  3CGN A;  3ARX A;  1KFW A;  2JMF A;  2ZQU A;  2YSH A;  3NTP A;  1E44 A;  1B6C A;  1RP5 A;  1BL4 A;  2G8Z A;  3KAH A;  3WD3 A;  4ODL A;  3FSB A;  1L1P A;  3M85 A;  2A3B A;  1FKD A;  3MCB A;  2LAJ A;  1WNO A;  2PPN A;  4WKF A;  2XPB A;  3FXY A;  3MCB B;  1NWT A;  3RM9 A;  4J4O A;  4MSP A;  2FAP A;  1W1T A;  1D6O A;  4IT6 A;  1LQ0 A;  3MQG A;  2RE3 A;  4GLX A;  3ARS A;  2KO7 A;  1Y0O A;  2LKN A;  4TW6 A;  3B8S A;  1E6P A;  1OGG A;  2RQS A;  1A7X A;  3OOB A;  1VF8 A;  2RUR A;  5CQ2 A;  2M1I A;  2ZR5 A;  4MNK A;  4ODR A;  2QRV A;  3AS0 A;  1K9T A;  3TCZ A;  1JNE A;  2XP7 A;  1LG1 A;  1FLC A;  4URI A;  4WIW A;  2YSI A;  4DZ2 A;  4DZ3 A;  2JX8 A;  3O5F A;  5HBF A;  4DWS B;  1NH6 A;  4LGX A;  4Z2L A;  2PBC A;  2MDI A;  1FKT A;  1NWU A;  3RM8 A;  3UQA A;  1E6R A;  1Q6U A;  2RUD A;  4NZC A;  4NNR A;  2RUQ A;  4WK9 A;  3O5L A;  5GPR A;  2O9O A;  1FKS A;  3IHZ A;  4MGV A;  3O5O A;  1WB0 A;  1GPF A;  2WLZ A;  4ITZ A;  1C9H A;  5D75 A;  2A3E A;  3ARO A;  2YSB A;  3O5Q A;  3FAP A;  4WKH A;  4L3N A;  5DIV A;  3CZ8 A;  4DRM A;  2XP9 A;  3B9D A;  1EYM A;  4DH0 A;  5E62 A;  1EDQ A;  5B8I C;  1SYT A;  1HKK A;  2WM0 A;  2L4J A;  4JFI A;  3RME A;  1FKJ A;  2MLZ A;  4JFJ A;  4ML4 A;  3CH9 A;  2XPA A;  4A0U A;  4LAX A;  5HT1 A;  1NWS A;  2OFN A;  1NSG A;  2F2D A;  4R0X A;  1JMQ A;  1QZ2 A;  4DRK A;  4P8W A;  3GU0 A;  1HJX A;  2DMV A;  1LL6 A;  1ZL1 A;  1O6I A;  4DRP A;  4MNM A;  4DRQ A;  2ZQT A;  5U47 A;  4TW7 A;  3ART A;  2IUZ A;  2MF9 A;  4U86 A;  2KR7 A;  1BKF A;  3AS1 A;  2DWV A;  5E5W A;  2KXQ A;  1FAP A;  3JYJ A;  1F8A B;  1PBK A;  1Q6H A;  4P8U A;  4TX0 A;  1W9P A;  1N1A A;  1H0I A;  3QOK A;  1E6Z A;  3TC5 A;  3KZ7 A;  1X6L A;  1OWQ A;  3RFW A;  1TK7 A;  2DSW A;  2MPH A;  2L2S A;  2QF8 A;  4TW8 A;  4ZPT R;  4KQZ A;  4QIB A;  1E6N A;  1FKF A;  3O5P A;  2G41 A;  4S3K A;  4ODM A;  1HJV A;  4Z2H A;  2B31 A;  2Y8N B;  2ETN A;  4GIV A;  3EIP A;  4IT4 A;  1ROT A;  3WQW A;  3ARY A;  1FKI A;  3UF8 A;  2MLY A;  4A0T A;  1LG2 A;  1ZB5 A;  1EHN A;  3M7N A;  4U85 A;  4R5E A;  1GRJ A;  4Z2J A;  1FKG A;  3ARW A;  3WKZ A;  4U84 A;  4W9Q A;  4QZV B;  2YBU A;  3RM4 A;  3WL0 A;  3LKX A;  1TCO C;  1W1P A;  2VN1 A;  1JVW A;  3KCE A;  2WAD A;  2O92 A;  2K8I A;  3KAF A;  1EQ3 A;  3KAB A;  3LKX B;  1W1Y A;  2E45 A;  2RSE A;  2F23 A;  4WJX A;  1R9H A;  3G6L A;  2DJY A;  4DT4 A;  4ODO A;  2YBT A;  2MLX A;  4QT2 A;  5DO2 A;  1T11 A;  3NI6 A;  1JNT A;  3KAC A;  2P4V A;  5DEZ A;  3UI6 A;  3WL1 A;  3ARZ A;  2DSU A;  3BXW A;  3ARV A;  4DRO A;  3CHF A;  2KI3 A;  5GQB A;  2LGO A;  4JFL A;  4LAW A;  1HKI A;  1XHG A;  4NSB A;  5HW8 A;  1GOI A;  3IK8 A;  4W9P A;  3IKG A;  1J4H A;  1HJW A;  1O6W A;  3UI5 A;  4MAV A;  4XAK A;  4ZPV R;  2ZQS A;  1X6N A;  5DIU A;  2WLY A;  4MPK A;  1D7H A;  1Q6I A;  1JND A;  4FAP A;  1LL7 A;  4HBO A;  3O5D A;  4DRH A;  3O5R A;  3G6M A;  3MDY B;  1SR0 A;  2YSF A;  4ODP A;  3CHC A;  4HAR A;  3UQI A;  3IKD A;  4W9O A;  4JFK A;  2XP4 A;  2UZ5 A;  2XP3 A;  2YAJ B;  1KT1 A;  2DK7 A;  3B9E A;  3AS2 A;  1IX5 A;  2KE0 A;  1H0G A;  4G50 A;  4E5R A;  1ZBW A;  4Q22 A;  1RD6 A;  5AHT A;  1FKB A;  2DPE A;  1TFV A;  3O5G A;  5I98 A;  4AY1 A;  1ZK6 A;  5HW6 A;  3KAG A;  5E66 A;  1TR8 A;  1HXV A;  1JNS A;  1F40 A;  3BMB A;  4DRJ A;  5J6E A;  5DIT A;  1ZU8 A;  1LJY A;  3MQH A;  4MNL A;  4Z2G A;  3JXV A;  2Q5A A;  2ITK A;  1EIB A;  3WIJ A;  1Q1C A;  4Q7N A;  4BF8 A;  1U79 A;  2JV4 A;  4PTM A;  4MTV A;  4P8V A;  2DT0 A;  4Z2K A;  1J4I A;  1FKH A;  1FKK A;  4DIP A;  4KR0 B;  1WMV A;  2JZV A;  2ZAJ A;  3ALF A;  2F21 A;  5E65 A;  1KT0 A;  4IPX A;  1FFR A;  1UR9 A;  2IF4 A;  4G2P A;  4ODN A;  2EZ5 W;  3ARP A;  3UI4 A;  2DG4 A;  3GTY X;  1EG3 A;  2Y78 A;  4JFM A;  2PPP A;  2RUC A;  1XRV A;  2AWG A;  4MNJ A;  1QPF A;  5JH8 A;  5HWC A;  2A3C A;  2BA1 A;  2M8J A;  2N87 A;  3O5J A;  3PQH A;  4Z2I A;  3L4H A;  2B5U B;  4ODQ A;  2XP8 A;  2PV3 A;  3NRK A;  3W4R A;  2DG3 A;  2OLH A;  3FY1 A;  3LUO A;  1FKR A;  2ZQV A;  1NMW A;  2DT2 A;  2VCD A;  2XP6 A;  1FJD A;  1UR8 A;  3CGM A;  1HKM A;  2M08 A;  3WD0 A;  4J4N A;  3RGC A;  2LJ4 A;  5GPG A;  3I6C A;  3CNG A;  1ZCN A;  4TYO A;  5HUA A;  3TDB A;  2ZR6 A;  1FFQ A;  1EG4 A;  4REX A;  5HWB A;  4DWS A;  3B7X A;  2DK1 A;  2OWO A;  3H9R B;  4FN2 A;  3VAW A;  2WAE A;  1FD9 A;  4GGQ A;  4LAV A;  1W26 A;  2KGJ A;  1ZBV A;  3WH0 A;  3WQV A;  5DF0 A;  3EY6 A;  4P8X A;  3CHE A;  1WR7 A;  2DSV A;  3FSC A;  1WAW A;  2AOS A;  1ZBK A;  3WD2 A;  3AS3 A;  4IQ2 A;  2DT3 A;  1JCH B;  4HBE A;  1YW5 A;  1FKL A;  3ARU A;  1D7J A;  3KAD A;  1HKJ A;  2YSG A; 
#chains in the Genus database with same CATH homology
 1D7I A;  1NMV A;  4O2T A;  3PR9 A;  3ARQ A;  1W1V A;  1PIN A;  3KAI A;  4IQC A;  2LPV A;  3OA5 A;  2MNT A;  4JYS A;  2D9F A;  3JYM A;  4LAY A;  4ODK A;  3FS8 A;  2M3O W;  2PI6 A;  1ITX A;  3UQB A;  1W9U A;  1J4R A;  1K9R A;  2KFW A;  3PA7 A;  3O5K A;  5E64 A;  3WD4 A;  2FDM A;  1K9Q A;  4N19 A;  2DG9 A;  2ESC A;  5HTG A;  2DSZ A;  2A3A A;  2PV2 A;  4L72 B;  1CTN A;  1J6Y A;  1ROU A;  1P5Q A;  3ODK A;  5BXJ A;  1W9V A;  3PRA A;  3ALG A;  3PRD A;  1E9L A;  3GPK A;  1GUV A;  1YAT A;  1OGB A;  2JXW A;  1QPL A;  1LL4 A;  2M2A A;  4DRN A;  3CHD A;  5HKG A;  4QT3 A;  1E15 A;  3LE4 A;  4C02 B;  1NWR A;  3WD1 A;  4S3J A;  4DRI A;  1D2K A;  2FKE A;  4ZS6 A;  4ZPW R;  4WKA A;  1ZBC A;  3AQU A;  2M8I A;  2ZR4 A;  2PV1 A;  4W5U A;  4DWS D;  2XP5 A;  3O5I A;  3B9A A;  1M5Y A;  2PPO A;  3ARR A;  4TNS A;  1I5H W;  3O5M A;  5HW7 A;  4DWS C;  2WK2 A;  3O5E A;  3PRB A;  2DT1 A;  2F4E A;  3CGN A;  3ARX A;  1KFW A;  2JMF A;  2ZQU A;  2YSH A;  3NTP A;  1B6C A;  1RP5 A;  1BL4 A;  2G8Z A;  3KAH A;  3WD3 A;  4ODL A;  3FSB A;  1L1P A;  3M85 A;  2A3B A;  1FKD A;  3MCB A;  2LAJ A;  1WNO A;  2PPN A;  4WKF A;  2XPB A;  3FXY A;  3MCB B;  1NWT A;  3RM9 A;  4J4O A;  4MSP A;  2FAP A;  1W1T A;  1D6O A;  4IT6 A;  1LQ0 A;  3MQG A;  2RE3 A;  4GLX A;  3ARS A;  2KO7 A;  1Y0O A;  2LKN A;  4TW6 A;  3B8S A;  1E6P A;  1OGG A;  2RQS A;  1A7X A;  3OOB A;  1VF8 A;  2RUR A;  5CQ2 A;  2M1I A;  2ZR5 A;  4MNK A;  4ODR A;  2QRV A;  3AS0 A;  1K9T A;  3TCZ A;  1JNE A;  2XP7 A;  1LG1 A;  1FLC A;  4URI A;  4WIW A;  2YSI A;  4DZ2 A;  4DZ3 A;  2JX8 A;  3O5F A;  5HBF A;  4DWS B;  1NH6 A;  4LGX A;  4Z2L A;  2PBC A;  2MDI A;  1FKT A;  1NWU A;  3RM8 A;  3UQA A;  1E6R A;  1Q6U A;  2RUD A;  4NZC A;  4NNR A;  2RUQ A;  4WK9 A;  3O5L A;  5GPR A;  2O9O A;  1FKS A;  3IHZ A;  4MGV A;  3O5O A;  1WB0 A;  1GPF A;  2WLZ A;  4ITZ A;  1C9H A;  5D75 A;  2A3E A;  3ARO A;  2YSB A;  3O5Q A;  3FAP A;  4WKH A;  4L3N A;  5DIV A;  3CZ8 A;  4DRM A;  2XP9 A;  3B9D A;  1EYM A;  4DH0 A;  5E62 A;  1EDQ A;  5B8I C;  1SYT A;  1HKK A;  2WM0 A;  2L4J A;  4JFI A;  3RME A;  1FKJ A;  2MLZ A;  4JFJ A;  4ML4 A;  3CH9 A;  2XPA A;  4A0U A;  4LAX A;  5HT1 A;  1NWS A;  2OFN A;  1NSG A;  2F2D A;  4R0X A;  1JMQ A;  1QZ2 A;  4DRK A;  4P8W A;  1HJX A;  2DMV A;  1LL6 A;  1ZL1 A;  1O6I A;  4DRP A;  4MNM A;  4DRQ A;  2ZQT A;  5U47 A;  4TW7 A;  3ART A;  2IUZ A;  2MF9 A;  4U86 A;  2KR7 A;  1BKF A;  3AS1 A;  2DWV A;  5E5W A;  2KXQ A;  1FAP A;  3JYJ A;  1F8A B;  1PBK A;  1Q6H A;  4P8U A;  4TX0 A;  1W9P A;  1N1A A;  1H0I A;  3QOK A;  1E6Z A;  3TC5 A;  3KZ7 A;  1X6L A;  1OWQ A;  3RFW A;  1TK7 A;  2DSW A;  2MPH A;  2L2S A;  2QF8 A;  4TW8 A;  4ZPT R;  4KQZ A;  4QIB A;  1E6N A;  1FKF A;  3O5P A;  2G41 A;  4S3K A;  4ODM A;  1HJV A;  4Z2H A;  2B31 A;  2Y8N B;  4GIV A;  4IT4 A;  1ROT A;  3WQW A;  3ARY A;  1FKI A;  3UF8 A;  2MLY A;  4A0T A;  1LG2 A;  1ZB5 A;  1EHN A;  3M7N A;  4U85 A;  4R5E A;  4Z2J A;  1FKG A;  3ARW A;  3WKZ A;  4U84 A;  4W9Q A;  4QZV B;  2YBU A;  3RM4 A;  3WL0 A;  3LKX A;  1TCO C;  1W1P A;  2VN1 A;  1JVW A;  3KCE A;  2WAD A;  2O92 A;  2K8I A;  3KAF A;  1EQ3 A;  3KAB A;  3LKX B;  1W1Y A;  2E45 A;  2RSE A;  4WJX A;  1R9H A;  3G6L A;  2DJY A;  4DT4 A;  4ODO A;  2YBT A;  2MLX A;  4QT2 A;  5DO2 A;  1T11 A;  3NI6 A;  1JNT A;  3KAC A;  5DEZ A;  3UI6 A;  3WL1 A;  3ARZ A;  2DSU A;  3BXW A;  3ARV A;  4DRO A;  3CHF A;  2KI3 A;  5GQB A;  2LGO A;  4JFL A;  4LAW A;  1HKI A;  1XHG A;  4NSB A;  5HW8 A;  1GOI A;  3IK8 A;  4W9P A;  3IKG A;  1J4H A;  1HJW A;  1O6W A;  3UI5 A;  4MAV A;  4XAK A;  4ZPV R;  2ZQS A;  1X6N A;  5DIU A;  2WLY A;  4MPK A;  1D7H A;  1Q6I A;  1JND A;  4FAP A;  1LL7 A;  4HBO A;  3O5D A;  4DRH A;  3O5R A;  3G6M A;  3MDY B;  1SR0 A;  2YSF A;  4ODP A;  3CHC A;  4HAR A;  3UQI A;  3IKD A;  4W9O A;  4JFK A;  2XP4 A;  2UZ5 A;  2XP3 A;  2YAJ B;  1KT1 A;  2DK7 A;  3B9E A;  3AS2 A;  1IX5 A;  2KE0 A;  1H0G A;  4G50 A;  4E5R A;  1ZBW A;  4Q22 A;  1RD6 A;  5AHT A;  1FKB A;  2DPE A;  1TFV A;  3O5G A;  5I98 A;  4AY1 A;  1ZK6 A;  5HW6 A;  3KAG A;  5E66 A;  1TR8 A;  1HXV A;  1JNS A;  1F40 A;  4DRJ A;  5J6E A;  5DIT A;  1ZU8 A;  1LJY A;  3MQH A;  4MNL A;  4Z2G A;  3JXV A;  2Q5A A;  2ITK A;  1EIB A;  3WIJ A;  1Q1C A;  4Q7N A;  4BF8 A;  1U79 A;  2JV4 A;  4PTM A;  4MTV A;  4P8V A;  2DT0 A;  4Z2K A;  1J4I A;  1FKH A;  1FKK A;  4DIP A;  4KR0 B;  1WMV A;  2JZV A;  2ZAJ A;  3ALF A;  2F21 A;  5E65 A;  1KT0 A;  4IPX A;  1FFR A;  1UR9 A;  2IF4 A;  4G2P A;  4ODN A;  2EZ5 W;  3ARP A;  3UI4 A;  2DG4 A;  1EG3 A;  2Y78 A;  4JFM A;  2PPP A;  2RUC A;  1XRV A;  2AWG A;  4MNJ A;  1QPF A;  5JH8 A;  5HWC A;  2A3C A;  2BA1 A;  2M8J A;  2N87 A;  3O5J A;  3PQH A;  4Z2I A;  3L4H A;  4ODQ A;  2XP8 A;  2PV3 A;  3NRK A;  3W4R A;  2DG3 A;  2OLH A;  3FY1 A;  3LUO A;  1FKR A;  2ZQV A;  1NMW A;  2DT2 A;  2VCD A;  2XP6 A;  1FJD A;  1UR8 A;  3CGM A;  1HKM A;  2M08 A;  3WD0 A;  4J4N A;  3RGC A;  2LJ4 A;  5GPG A;  3I6C A;  3CNG A;  1ZCN A;  4TYO A;  5HUA A;  3TDB A;  2ZR6 A;  1FFQ A;  1EG4 A;  4REX A;  5HWB A;  4DWS A;  3B7X A;  2DK1 A;  2OWO A;  3H9R B;  4FN2 A;  3VAW A;  2WAE A;  1FD9 A;  4GGQ A;  4LAV A;  1W26 A;  2KGJ A;  1ZBV A;  3WH0 A;  3WQV A;  5DF0 A;  3EY6 A;  4P8X A;  3CHE A;  1WR7 A;  2DSV A;  3FSC A;  1WAW A;  2AOS A;  1ZBK A;  3WD2 A;  3AS3 A;  4IQ2 A;  2DT3 A;  4HBE A;  1YW5 A;  1FKL A;  3ARU A;  1D7J A;  3KAD A;  1HKJ A;  2YSG A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...