2F21A

Human pin1 fip mutant
Total Genus 48
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
48
sequence length
162
structure length
153
Chain Sequence
MADEEKLPPGWEKRMSADGRVYYFNHITNASQWERPSGQGEPARVRCSHLLVKHSQSRRPSSWRQEKITRTKEEALELINGYIQKIKSGEEDFESLASQFSDCSSAKARGDLGAFSRGQMQKPFEDASFALRTGEMSGPVFTDSGIHIILRTE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Peptidyl-prolyl cis-trans isomerase NIMA-interacting 1
publication title Structure-function-folding relationship in a WW domain.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Isomerase
total genus 48
structure length 153
sequence length 162
ec nomenclature ec 5.2.1.8: Peptidylprolyl isomerase.
pdb deposition date 2005-11-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00397 WW WW domain
A PF00639 Rotamase PPIC-type PPIASE domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.20.70.10 Mainly Beta Single Sheet Ubiquitin Ligase Nedd4; Chain: W; Ubiquitin Ligase Nedd4; Chain: W; 2f21A01
3.10.50.40 Alpha Beta Roll Chitinase A; domain 3 Chitinase A; domain 3 2f21A02
1I5HW 3JYMA 3UQBA 3TDBA 2PV2A 2JXWA 3O5KA 1W26A 4E5RA 4TYOA 4TW8A 3O5PA 3NI6A 4C02B 4BF8A 5HW8A 4NNRA 2KXQA 1YATA 2KE0A 4IPXA 1J6YA 3EY6A 2PPPA 3KZ7A 4DRIA 2UZ5A 3VAWA 2ZR4A 4DRNA 3OOBA 4GIVA 4DRJA 2RUQA 1TK7A 4JFIA 2DK1A 2DMVA 3O5DA 1FKIA 3O5OA 3KAFA 2MLYA 2XP8A 5J6EA 1WR7A 4ITZA 4DIPA 1K9RA 2MF9A 2EZ5W 4JYSA 3O5RA 2KGJA 4DRMA 2JZVA 1BKFA 2YSHA 2M3OW 4QT2A 1PINA 4REXA 2N87A 1J4IA 4U86A 4U84A 1FJDA 2PPOA 1JVWA 2KO7A 2VCDA 1HXVA 2ZQTA 4TW7A 3O5GA 1FKTA 3KADA 1ZCNA 2K8IA 3GPKA 3O5JA 1JNSA 3ODKA 3KAGA 2MNTA 1FKFA 1EG4A 5DIUA 2XP5A 3PA7A 5CQ2A 3UQAA 1EG3A 3IK8A 1NMVA 3M7NA 3RGCA 2F4EA 4ODRA 4ODMA 1EQ3A 1M5YA 2PV3A 1P5QA 1NSGA 3IKDA 4O2TA 1EYMA 5AHTA 1O6WA 1ROTA 3UI6A 1WMVA 1U79A 2RSEA 4W9PA 3KAIA 2YSIA 3O5FA 3LUOA 4QIBA 3IHZA 1D7JA 5GPGA 1NMWA 1FKDA 2Y78A 4DZ2A 4TW6A 2JMFA 2LPVA 2DG3A 4LAYA 1PBKA 1F8AB 2XP4A 2ITKA 3LE4A 2XP9A 4JFMA 2DJYA 2YSFA 1ROUA 4ODNA 1FKRA 2VN1A 2MPHA 2D9FA 2ZQSA 3CGMA 4DH0A 3TCZA 1KT1A 1FKBA 4J4OA 2Q5AA 2RQSA 1Q6IA 2AWGA 3NRKA 2ZQVA 3O5EA 1J4HA 2KFWA 2M08A 4GGQA 3PRDA 3NTPA 4G2PA 3UI5A 1K9QA 1L1PA 2M2AA 1FAPA 1FKSA 2XP3A 3I6CA 5HW6A 2M1IA 4JFLA 3CGNA 2YSGA 2LJ4A 1B6CA 4QT3A 2M8IA 1A7XA 2ZR5A 2RUCA 5B8IC 1C9HA 2PPNA 5HW7A 2PV1A 2MDIA 1FKKA 1Q1CA 3WH0A 4W9OA 5HKGA 4TX0A 4DRPA 2LGOA 1TCOC 2KR7A 4DRQA 1QZ2A 4DZ3A 3UF8A 2XPBA 1FKJA 1R9HA 2L4JA 2XP7A 1BL4A 2RE3A 4TNSA 1T11A 2FAPA 1FKLA 2ZAJA 1JMQA 4ODOA 5HT1A 2LKNA 2DWVA 1KT0A 2F2DA 3JYJA 3L4HA 3RFWA 5HWBA 2RUDA 3KACA 4DRHA 1J4RA 3UI4A 2KI3A 4FN2A 4LAWA 2JV4A 1ZK6A 2MLXA 1FKHA 1QPLA 4DROA 1Y0OA 4JFKA 1D7IA 1D6OA 4MSPA 3TC5A 3B7XA 3O5MA 3O5LA 2LAJA 4N19A 5HWCA 4W9QA 3CNGA 3O5QA 1JNTA 2L2SA 4R0XA 2DG9A 4LAXA 3UQIA 2OFNA 3MDYB 4J4NA 2XP6A 3KABA 4ODPA 5I98A 3KAHA 4LAVA 4DT4A 2M8JA 2YSBA 2XPAA 5BXJA 2RURA 3JXVA 4IQCA 2E45A 1YW5A 3H9RB 3FAPA 2F21A 2FKEA 5DITA 2DG4A 2MLZA 4DRKA 4FAPA 2IF4A 4IQ2A 5HTGA 1QPFA 2DK7A 2ZR6A 2BA1A 3PRBA 1N1AA 2ZQUA 5D75A 4MGVA 2PBCA 3O5IA 1FD9A 1Q6UA 4JFJA 2JX8A 4G50A 1F40A 4ODKA 5HUAA 4ODLA 4U85A 3M85A 5DIVA 1D7HA 3IKGA 3KCEA 1Q6HA 1FKGA 4ODQA
chains in the Genus database with same CATH superfamily
5E62A 1I5HW 2QRVA 1SR0A 1VF8A 3JYMA 3TDBA 1W1TA 2PV2A 3UQBA 2JXWA 3O5KA 1W26A 5JH8A 3ARUA 4E5RA 2ESCA 4TYOA 4W5UA 1NH6A 4TW8A 3O5PA 3NI6A 2WAEA 4C02B 1EHNA 4BF8A 4WJXA 5HW8A 4NNRA 2KXQA 1E15A 1YATA 2KE0A 4IPXA 3WIJA 4KR0B 1ZBCA 1J6YA 3EY6A 2PPPA 1KFWA 3KZ7A 4DRIA 2QF8A 2UZ5A 4MNKA 1JNEA 3VAWA 2ZR4A 4DRNA 1WAWA 3OOBA 2DSUA 4GIVA 4DRJA 3WL1A 3WL0A 3WD3A 2RUQA 1TK7A 4JFIA 4NSBA 2G41A 2DK1A 2DMVA 1OGGA 3O5DA 1FKIA 3O5OA 1LL6A 3KAFA 2MLYA 2XP8A 1X6NA 1RP5A 3LKXB 3B9AA 4MNMA 1WR7A 5J6EA 1LG2A 4ITZA 1HJWA 4DIPA 1K9RA 2MF9A 1HKIA 2EZ5W 3BXWA 3MCBB 4L72B 1GRJA 1LL7A 4JYSA 3O5RA 1LL4A 2KGJA 4DRMA 4LGXA 2JZVA 1BKFA 2YSHA 3CHEA 2M3OW 4QT2A 2A3AA 3OA5A 2FDMA 1PINA 3B9EA 1W9PA 4S3JA 4REXA 2N87A 4DWSB 2WADA 1J4IA 3WKZA 2OLHA 4U86A 1LJYA 2P4VA 4U84A 1FJDA 4IT6A 2PPOA 2F23A 1JVWA 2KO7A 2VCDA 4HBEA 1HXVA 1UR8A 2AOSA 2ZQTA 4PTMA 4TW7A 3FY1A 3O5GA 1FKTA 1NWUA 4WIWA 3KADA 3LKXA 2DSZA 1ZCNA 3G6MA 2K8IA 2DT0A 3GPKA 1E6RA 3O5JA 3MCBA 1JNSA 3ODKA 3KAGA 1LQ0A 5U47A 1FKFA 2MNTA 1EG4A 5DIUA 5DEZA 2XP5A 3PA7A 5CQ2A 4Z2HA 1FFQA 1H0GA 4WKHA 3UQAA 1EG3A 3WD4A 4WKAA 3IK8A 3ALFA 1NMVA 3M7NA 3RGCA 3W4RA 2F4EA 4P8UA 4ODRA 4ODMA 1E6NA 1OGBA 4HBOA 4IT4A 1D2KA 1LG1A 1EQ3A 4DWSA 2O92A 4S3KA 1GPFA 1M5YA 3ARYA 2PV3A 4Z2GA 2Y8NB 4MTVA 4Q7NA 3CHCA 2IUZA 1P5QA 1NSGA 3IKDA 4O2TA 4XAKA 1EYMA 5AHTA 1O6WA 1ROTA 3UI6A 1IX5A 1WMVA 1U79A 2OWOA 4UDMA 2RSEA 4W9PA 3KAIA 3AS2A 2YSIA 4P8XA 2A3CA 3O5FA 3LUOA 2A3EA 4QIBA 3RM8A 3IHZA 1H0IA 1EDQA 3ARXA 1D7JA 5GPGA 1NMWA 1O6IA 1FKDA 2Y78A 4DZ2A 4TW6A 3ARVA 2JMFA 3ARZA 2O9OA 2LPVA 2DG3A 4LAYA 1PBKA 1F8AB 1FLCA 2XP4A 2ITKA 3GTYX 3LE4A 2XP9A 4Z2LA 4JFMA 3CHDA 1GUVA 2DJYA 2YSFA 1ROUA 4ODNA 2DSWA 3RMEA 1FKRA 2VN1A 2MPHA 2D9FA 3QOKA 4URIA 2ZQSA 3CGMA 1HKMA 3FXYA 4DH0A 4ML4A 4DWSD 3TCZA 1KT1A 3WQWA 1FKBA 4J4OA 2PI6A 2Q5AA 2RQSA 4ZPTR 1Q6IA 2AWGA 3NRKA 2ZQVA 3O5EA 1J4HA 5E5WA 3AS3A 2KFWA 4R5EA 3ARQA 3CH9A 2M08A 3CHFA 4GGQA 5DO2A 2G8ZA 3PRDA 3NTPA 3RM4A 5E65A 4G2PA 3UI5A 1NWSA 2PN0A 1K9QA 1OWQA 1L1PA 2M2AA 1FAPA 1FKSA 2XP3A 3I6CA 5HW6A 2M1IA 3GU0A 4JFLA 5GPRA 3CGNA 2YSGA 2DT2A 3FSCA 3ARWA 2LJ4A 3ARTA 1B6CA 4QT3A 2M8IA 1A7XA 2ZR5A 2RUCA 3AQUA 5B8IC 1C9HA 3B9DA 2PPNA 5HW7A 2PV1A 2MDIA 1JCHB 1FKKA 1Q1CA 3WH0A 4MPKA 1ZL1A 2DT3A 4AY1A 4W9OA 4L3NA 5HKGA 4TX0A 1RD6A 2YBUA 4DRPA 2LGOA 4ZS6A 1TCOC 5E66A 2KR7A 3ARSA 3FS8A 4MAVA 4DRQA 1QZ2A 4DZ3A 3UF8A 2XPBA 1FKJA 1R9HA 2L4JA 1ZU8A 2XP7A 1E6PA 5HBFA 3MQGA 1BL4A 1UR9A 1E44A 2RE3A 4WK9A 2DPEA 4MNJA 3EIPA 4TNSA 1T11A 2FAPA 1FKLA 2ZAJA 1JMQA 1SYTA 1W1PA 3BMBA 3WD0A 4ODOA 5HT1A 2LKNA 2DWVA 1NWRA 1KT0A 2F2DA 3JYJA 3L4HA 2YBTA 3RFWA 1TR8A 3G6LA 4MNLA 4ZPVR 5HWBA 4Q22A 4KQZA 3FSBA 4A0TA 1ZBKA 2RUDA 3KACA 4DRHA 1J4RA 3UI4A 4Z2KA 2KI3A 1EIBA 4FN2A 3PRAA 4LAWA 2JV4A 1ZK6A 4NZCA 4P8VA 2WM0A 1WNOA 1FKHA 2MLXA 3MQHA 1QPLA 4DROA 1XRVA 1Y0OA 4JFKA 1D7IA 1D6OA 1W1VA 4A0UA 4MSPA 3TC5A 2YAJB 3B7XA 3O5LA 2LAJA 3O5MA 4N19A 5HWCA 4W9QA 3CZ8A 3CNGA 3O5QA 2ETNA 1JNTA 1FFRA 2L2SA 4R0XA 1CTNA 3AS1A 2DG9A 3AS0A 4LAXA 3UQIA 1HJVA 2OFNA 3MDYB 1HKJA 2DSVA 4J4NA 2XP6A 3ALGA 3KABA 4ODPA 3PQHA 4GLXA 3ARPA 3KAHA 5I98A 1X6LA 4LAVA 4DT4A 4HARA 2M8JA 2YSBA 4ZPWR 1NWTA 1WB0A 2XPAA 1ZBVA 5BXJA 2RURA 1TFVA 3JXVA 4IQCA 2E45A 1YW5A 3H9RB 3FAPA 4P8WA 2F21A 3B8SA 2FKEA 4WKFA 5DITA 1ZBWA 2DG4A 1HJXA 2MLZA 4QZVB 4DRKA 1ITXA 4FAPA 2IF4A 4IQ2A 5HTGA 1QPFA 2DK7A 2ZR6A 1W9VA 2WLZA 2WK2A 2WLYA 3ARRA 2BA1A 4Z2JA 3PRBA 1N1AA 3WQVA 2ZQUA 1K9TA 3AROA 2EULA 5DF0A 1XHGA 4MGVA 5D75A 3RM9A 2B5UB 2PBCA 3O5IA 5GQBA 1FD9A 3WD1A 1Q6UA 4JFJA 1HKKA 1JNDA 2JX8A 3WD2A 4G50A 1F40A 4ODKA 5E64A 5HUAA 4ODLA 4U85A 3M85A 2A3BA 4DWSC 5DIVA 1D7HA 1ZB5A 3IKGA 4Z2IA 1GOIA 1W9UA 3KCEA 1Q6HA 2B31A 2DT1A 1W1YA 1FKGA 3PR9A 1E9LA 4ODQA 1E6ZA
chains in the Genus database with same CATH topology
5E62A 1I5HW 2QRVA 1SR0A 1VF8A 3JYMA 3TDBA 1W1TA 2PV2A 3UQBA 2JXWA 3O5KA 1W26A 5JH8A 3ARUA 4E5RA 2ESCA 4TYOA 4W5UA 1NH6A 4TW8A 3O5PA 3NI6A 2WAEA 4C02B 1EHNA 4BF8A 4WJXA 5HW8A 4NNRA 2KXQA 1E15A 1YATA 2KE0A 4IPXA 3WIJA 4KR0B 1ZBCA 1J6YA 3EY6A 2PPPA 1KFWA 3KZ7A 4DRIA 2QF8A 2UZ5A 4MNKA 1JNEA 3VAWA 2ZR4A 4DRNA 1WAWA 3OOBA 2DSUA 4GIVA 4DRJA 3WL1A 3WL0A 3WD3A 2RUQA 1TK7A 4JFIA 4NSBA 2G41A 2DK1A 2DMVA 1OGGA 3O5DA 1FKIA 3O5OA 1LL6A 3KAFA 2MLYA 2XP8A 1X6NA 1RP5A 3LKXB 3B9AA 4MNMA 1WR7A 5J6EA 1LG2A 4ITZA 1HJWA 4DIPA 1K9RA 2MF9A 1HKIA 2EZ5W 3BXWA 3MCBB 4L72B 1LL7A 4JYSA 3O5RA 1LL4A 2KGJA 4DRMA 4LGXA 2JZVA 1BKFA 2YSHA 3CHEA 2M3OW 4QT2A 2A3AA 3OA5A 2FDMA 1PINA 3B9EA 1W9PA 4S3JA 4REXA 2N87A 4DWSB 2WADA 1J4IA 3WKZA 2OLHA 4U86A 1LJYA 4U84A 1FJDA 4IT6A 2PPOA 1JVWA 2KO7A 2VCDA 4HBEA 1HXVA 1UR8A 2AOSA 2ZQTA 4PTMA 4TW7A 3FY1A 3O5GA 1FKTA 1NWUA 4WIWA 3KADA 3LKXA 2DSZA 1ZCNA 3G6MA 2K8IA 2DT0A 3GPKA 1E6RA 3O5JA 3MCBA 1JNSA 3ODKA 3KAGA 1LQ0A 5U47A 1FKFA 2MNTA 1EG4A 5DIUA 5DEZA 2XP5A 3PA7A 5CQ2A 4Z2HA 1FFQA 1H0GA 4WKHA 3UQAA 1EG3A 3WD4A 4WKAA 3IK8A 3ALFA 1NMVA 3M7NA 3RGCA 3W4RA 2F4EA 4P8UA 4ODRA 4ODMA 1E6NA 1OGBA 4HBOA 4IT4A 1D2KA 1LG1A 1EQ3A 4DWSA 2O92A 4S3KA 1GPFA 1M5YA 3ARYA 2PV3A 4Z2GA 2Y8NB 4MTVA 4Q7NA 3CHCA 2IUZA 1P5QA 1NSGA 3IKDA 4O2TA 4XAKA 1EYMA 5AHTA 1O6WA 1ROTA 3UI6A 1IX5A 1WMVA 1U79A 2OWOA 2RSEA 4W9PA 3KAIA 3AS2A 2YSIA 4P8XA 2A3CA 3O5FA 3LUOA 2A3EA 4QIBA 3RM8A 3IHZA 1H0IA 1EDQA 3ARXA 1D7JA 5GPGA 1NMWA 1O6IA 1FKDA 2Y78A 4DZ2A 4TW6A 3ARVA 2JMFA 3ARZA 2O9OA 2LPVA 2DG3A 4LAYA 1PBKA 1F8AB 1FLCA 2XP4A 2ITKA 3LE4A 2XP9A 4Z2LA 4JFMA 3CHDA 1GUVA 2DJYA 2YSFA 1ROUA 4ODNA 2DSWA 3RMEA 1FKRA 2VN1A 2MPHA 2D9FA 3QOKA 4URIA 2ZQSA 3CGMA 1HKMA 3FXYA 4DH0A 4ML4A 4DWSD 3TCZA 1KT1A 3WQWA 1FKBA 4J4OA 2PI6A 2Q5AA 2RQSA 4ZPTR 1Q6IA 2AWGA 3NRKA 2ZQVA 3O5EA 1J4HA 5E5WA 3AS3A 2KFWA 4R5EA 3ARQA 3CH9A 2M08A 3CHFA 4GGQA 5DO2A 2G8ZA 3PRDA 3NTPA 3RM4A 5E65A 4G2PA 3UI5A 1NWSA 1K9QA 1OWQA 1L1PA 2M2AA 1FAPA 1FKSA 2XP3A 3I6CA 5HW6A 2M1IA 4JFLA 5GPRA 3CGNA 2YSGA 2DT2A 3FSCA 3ARWA 2LJ4A 3ARTA 1B6CA 4QT3A 2M8IA 1A7XA 2ZR5A 2RUCA 3AQUA 5B8IC 1C9HA 3B9DA 2PPNA 5HW7A 2PV1A 2MDIA 1FKKA 1Q1CA 3WH0A 4MPKA 1ZL1A 2DT3A 4AY1A 4W9OA 4L3NA 5HKGA 4TX0A 1RD6A 2YBUA 4DRPA 2LGOA 4ZS6A 1TCOC 5E66A 2KR7A 3ARSA 3FS8A 4MAVA 4DRQA 1QZ2A 4DZ3A 3UF8A 2XPBA 1FKJA 1R9HA 2L4JA 1ZU8A 2XP7A 1E6PA 5HBFA 3MQGA 1BL4A 1UR9A 2RE3A 4WK9A 2DPEA 4MNJA 4TNSA 1T11A 2FAPA 1FKLA 2ZAJA 1JMQA 1SYTA 1W1PA 3WD0A 4ODOA 5HT1A 2LKNA 2DWVA 1NWRA 1KT0A 2F2DA 3JYJA 3L4HA 2YBTA 3RFWA 1TR8A 3G6LA 4MNLA 4ZPVR 5HWBA 4Q22A 4KQZA 3FSBA 4A0TA 1ZBKA 2RUDA 3KACA 4DRHA 1J4RA 3UI4A 4Z2KA 2KI3A 1EIBA 4FN2A 3PRAA 4LAWA 2JV4A 1ZK6A 4NZCA 4P8VA 2WM0A 1WNOA 1FKHA 2MLXA 3MQHA 1QPLA 4DROA 1XRVA 1Y0OA 4JFKA 1D7IA 1D6OA 1W1VA 4A0UA 4MSPA 3TC5A 2YAJB 3B7XA 3O5LA 2LAJA 3O5MA 4N19A 5HWCA 4W9QA 3CZ8A 3CNGA 3O5QA 1JNTA 1FFRA 2L2SA 4R0XA 1CTNA 3AS1A 2DG9A 3AS0A 4LAXA 3UQIA 1HJVA 2OFNA 3MDYB 1HKJA 2DSVA 4J4NA 2XP6A 3ALGA 3KABA 4ODPA 3PQHA 4GLXA 3ARPA 3KAHA 5I98A 1X6LA 4LAVA 4DT4A 4HARA 2M8JA 2YSBA 4ZPWR 1NWTA 1WB0A 2XPAA 1ZBVA 5BXJA 2RURA 1TFVA 3JXVA 4IQCA 2E45A 1YW5A 3H9RB 3FAPA 4P8WA 2F21A 3B8SA 2FKEA 4WKFA 5DITA 1ZBWA 2DG4A 1HJXA 2MLZA 4QZVB 4DRKA 1ITXA 4FAPA 2IF4A 4IQ2A 5HTGA 1QPFA 2DK7A 2ZR6A 1W9VA 2WLZA 2WK2A 2WLYA 3ARRA 2BA1A 4Z2JA 3PRBA 1N1AA 3WQVA 2ZQUA 1K9TA 3AROA 5DF0A 1XHGA 4MGVA 5D75A 3RM9A 2PBCA 3O5IA 5GQBA 1FD9A 3WD1A 1Q6UA 4JFJA 1HKKA 1JNDA 2JX8A 3WD2A 4G50A 1F40A 4ODKA 5E64A 5HUAA 4ODLA 4U85A 3M85A 2A3BA 4DWSC 5DIVA 1D7HA 1ZB5A 3IKGA 4Z2IA 1GOIA 1W9UA 3KCEA 1Q6HA 2B31A 2DT1A 1W1YA 1FKGA 3PR9A 1E9LA 4ODQA 1E6ZA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1I5H W;  3JYM A;  3UQB A;  3TDB A;  2PV2 A;  2JXW A;  3O5K A;  1W26 A;  4E5R A;  4TYO A;  4TW8 A;  3O5P A;  3NI6 A;  4C02 B;  4BF8 A;  5HW8 A;  4NNR A;  2KXQ A;  1YAT A;  2KE0 A;  4IPX A;  1J6Y A;  3EY6 A;  2PPP A;  3KZ7 A;  4DRI A;  2UZ5 A;  3VAW A;  2ZR4 A;  4DRN A;  3OOB A;  4GIV A;  4DRJ A;  2RUQ A;  1TK7 A;  4JFI A;  2DK1 A;  2DMV A;  3O5D A;  1FKI A;  3O5O A;  3KAF A;  2MLY A;  2XP8 A;  5J6E A;  1WR7 A;  4ITZ A;  4DIP A;  1K9R A;  2MF9 A;  2EZ5 W;  4JYS A;  3O5R A;  2KGJ A;  4DRM A;  2JZV A;  1BKF A;  2YSH A;  2M3O W;  4QT2 A;  1PIN A;  4REX A;  2N87 A;  1J4I A;  4U86 A;  4U84 A;  1FJD A;  2PPO A;  1JVW A;  2KO7 A;  2VCD A;  1HXV A;  2ZQT A;  4TW7 A;  3O5G A;  1FKT A;  3KAD A;  1ZCN A;  2K8I A;  3GPK A;  3O5J A;  1JNS A;  3ODK A;  3KAG A;  2MNT A;  1FKF A;  1EG4 A;  5DIU A;  2XP5 A;  3PA7 A;  5CQ2 A;  3UQA A;  1EG3 A;  3IK8 A;  1NMV A;  3M7N A;  3RGC A;  2F4E A;  4ODR A;  4ODM A;  1EQ3 A;  1M5Y A;  2PV3 A;  1P5Q A;  1NSG A;  3IKD A;  4O2T A;  1EYM A;  5AHT A;  1O6W A;  1ROT A;  3UI6 A;  1WMV A;  1U79 A;  2RSE A;  4W9P A;  3KAI A;  2YSI A;  3O5F A;  3LUO A;  4QIB A;  3IHZ A;  1D7J A;  5GPG A;  1NMW A;  1FKD A;  2Y78 A;  4DZ2 A;  4TW6 A;  2JMF A;  2LPV A;  2DG3 A;  4LAY A;  1PBK A;  1F8A B;  2XP4 A;  2ITK A;  3LE4 A;  2XP9 A;  4JFM A;  2DJY A;  2YSF A;  1ROU A;  4ODN A;  1FKR A;  2VN1 A;  2MPH A;  2D9F A;  2ZQS A;  3CGM A;  4DH0 A;  3TCZ A;  1KT1 A;  1FKB A;  4J4O A;  2Q5A A;  2RQS A;  1Q6I A;  2AWG A;  3NRK A;  2ZQV A;  3O5E A;  1J4H A;  2KFW A;  2M08 A;  4GGQ A;  3PRD A;  3NTP A;  4G2P A;  3UI5 A;  1K9Q A;  1L1P A;  2M2A A;  1FAP A;  1FKS A;  2XP3 A;  3I6C A;  5HW6 A;  2M1I A;  4JFL A;  3CGN A;  2YSG A;  2LJ4 A;  1B6C A;  4QT3 A;  2M8I A;  1A7X A;  2ZR5 A;  2RUC A;  5B8I C;  1C9H A;  2PPN A;  5HW7 A;  2PV1 A;  2MDI A;  1FKK A;  1Q1C A;  3WH0 A;  4W9O A;  5HKG A;  4TX0 A;  4DRP A;  2LGO A;  1TCO C;  2KR7 A;  4DRQ A;  1QZ2 A;  4DZ3 A;  3UF8 A;  2XPB A;  1FKJ A;  1R9H A;  2L4J A;  2XP7 A;  1BL4 A;  2RE3 A;  4TNS A;  1T11 A;  2FAP A;  1FKL A;  2ZAJ A;  1JMQ A;  4ODO A;  5HT1 A;  2LKN A;  2DWV A;  1KT0 A;  2F2D A;  3JYJ A;  3L4H A;  3RFW A;  5HWB A;  2RUD A;  3KAC A;  4DRH A;  1J4R A;  3UI4 A;  2KI3 A;  4FN2 A;  4LAW A;  2JV4 A;  1ZK6 A;  2MLX A;  1FKH A;  1QPL A;  4DRO A;  1Y0O A;  4JFK A;  1D7I A;  1D6O A;  4MSP A;  3TC5 A;  3B7X A;  3O5M A;  3O5L A;  2LAJ A;  4N19 A;  5HWC A;  4W9Q A;  3CNG A;  3O5Q A;  1JNT A;  2L2S A;  4R0X A;  2DG9 A;  4LAX A;  3UQI A;  2OFN A;  3MDY B;  4J4N A;  2XP6 A;  3KAB A;  4ODP A;  5I98 A;  3KAH A;  4LAV A;  4DT4 A;  2M8J A;  2YSB A;  2XPA A;  5BXJ A;  2RUR A;  3JXV A;  4IQC A;  2E45 A;  1YW5 A;  3H9R B;  3FAP A;  2F21 A;  2FKE A;  5DIT A;  2DG4 A;  2MLZ A;  4DRK A;  4FAP A;  2IF4 A;  4IQ2 A;  5HTG A;  1QPF A;  2DK7 A;  2ZR6 A;  2BA1 A;  3PRB A;  1N1A A;  2ZQU A;  5D75 A;  4MGV A;  2PBC A;  3O5I A;  1FD9 A;  1Q6U A;  4JFJ A;  2JX8 A;  4G50 A;  1F40 A;  4ODK A;  5HUA A;  4ODL A;  4U85 A;  3M85 A;  5DIV A;  1D7H A;  3IKG A;  3KCE A;  1Q6H A;  1FKG A;  4ODQ A; 
#chains in the Genus database with same CATH topology
 5E62 A;  1I5H W;  2QRV A;  1SR0 A;  1VF8 A;  3JYM A;  3TDB A;  1W1T A;  2PV2 A;  3UQB A;  2JXW A;  3O5K A;  1W26 A;  5JH8 A;  3ARU A;  4E5R A;  2ESC A;  4TYO A;  4W5U A;  1NH6 A;  4TW8 A;  3O5P A;  3NI6 A;  2WAE A;  4C02 B;  1EHN A;  4BF8 A;  4WJX A;  5HW8 A;  4NNR A;  2KXQ A;  1E15 A;  1YAT A;  2KE0 A;  4IPX A;  3WIJ A;  4KR0 B;  1ZBC A;  1J6Y A;  3EY6 A;  2PPP A;  1KFW A;  3KZ7 A;  4DRI A;  2QF8 A;  2UZ5 A;  4MNK A;  1JNE A;  3VAW A;  2ZR4 A;  4DRN A;  1WAW A;  3OOB A;  2DSU A;  4GIV A;  4DRJ A;  3WL1 A;  3WL0 A;  3WD3 A;  2RUQ A;  1TK7 A;  4JFI A;  4NSB A;  2G41 A;  2DK1 A;  2DMV A;  1OGG A;  3O5D A;  1FKI A;  3O5O A;  1LL6 A;  3KAF A;  2MLY A;  2XP8 A;  1X6N A;  1RP5 A;  3LKX B;  3B9A A;  4MNM A;  1WR7 A;  5J6E A;  1LG2 A;  4ITZ A;  1HJW A;  4DIP A;  1K9R A;  2MF9 A;  1HKI A;  2EZ5 W;  3BXW A;  3MCB B;  4L72 B;  1GRJ A;  1LL7 A;  4JYS A;  3O5R A;  1LL4 A;  2KGJ A;  4DRM A;  4LGX A;  2JZV A;  1BKF A;  2YSH A;  3CHE A;  2M3O W;  4QT2 A;  2A3A A;  3OA5 A;  2FDM A;  1PIN A;  3B9E A;  1W9P A;  4S3J A;  4REX A;  2N87 A;  4DWS B;  2WAD A;  1J4I A;  3WKZ A;  2OLH A;  4U86 A;  1LJY A;  2P4V A;  4U84 A;  1FJD A;  4IT6 A;  2PPO A;  2F23 A;  1JVW A;  2KO7 A;  2VCD A;  4HBE A;  1HXV A;  1UR8 A;  2AOS A;  2ZQT A;  4PTM A;  4TW7 A;  3FY1 A;  3O5G A;  1FKT A;  1NWU A;  4WIW A;  3KAD A;  3LKX A;  2DSZ A;  1ZCN A;  3G6M A;  2K8I A;  2DT0 A;  3GPK A;  1E6R A;  3O5J A;  3MCB A;  1JNS A;  3ODK A;  3KAG A;  1LQ0 A;  5U47 A;  1FKF A;  2MNT A;  1EG4 A;  5DIU A;  5DEZ A;  2XP5 A;  3PA7 A;  5CQ2 A;  4Z2H A;  1FFQ A;  1H0G A;  4WKH A;  3UQA A;  1EG3 A;  3WD4 A;  4WKA A;  3IK8 A;  3ALF A;  1NMV A;  3M7N A;  3RGC A;  3W4R A;  2F4E A;  4P8U A;  4ODR A;  4ODM A;  1E6N A;  1OGB A;  4HBO A;  4IT4 A;  1D2K A;  1LG1 A;  1EQ3 A;  4DWS A;  2O92 A;  4S3K A;  1GPF A;  1M5Y A;  3ARY A;  2PV3 A;  4Z2G A;  2Y8N B;  4MTV A;  4Q7N A;  3CHC A;  2IUZ A;  1P5Q A;  1NSG A;  3IKD A;  4O2T A;  4XAK A;  1EYM A;  5AHT A;  1O6W A;  1ROT A;  3UI6 A;  1IX5 A;  1WMV A;  1U79 A;  2OWO A;  4UDM A;  2RSE A;  4W9P A;  3KAI A;  3AS2 A;  2YSI A;  4P8X A;  2A3C A;  3O5F A;  3LUO A;  2A3E A;  4QIB A;  3RM8 A;  3IHZ A;  1H0I A;  1EDQ A;  3ARX A;  1D7J A;  5GPG A;  1NMW A;  1O6I A;  1FKD A;  2Y78 A;  4DZ2 A;  4TW6 A;  3ARV A;  2JMF A;  3ARZ A;  2O9O A;  2LPV A;  2DG3 A;  4LAY A;  1PBK A;  1F8A B;  1FLC A;  2XP4 A;  2ITK A;  3GTY X;  3LE4 A;  2XP9 A;  4Z2L A;  4JFM A;  3CHD A;  1GUV A;  2DJY A;  2YSF A;  1ROU A;  4ODN A;  2DSW A;  3RME A;  1FKR A;  2VN1 A;  2MPH A;  2D9F A;  3QOK A;  4URI A;  2ZQS A;  3CGM A;  1HKM A;  3FXY A;  4DH0 A;  4ML4 A;  4DWS D;  3TCZ A;  1KT1 A;  3WQW A;  1FKB A;  4J4O A;  2PI6 A;  2Q5A A;  2RQS A;  4ZPT R;  1Q6I A;  2AWG A;  3NRK A;  2ZQV A;  3O5E A;  1J4H A;  5E5W A;  3AS3 A;  2KFW A;  4R5E A;  3ARQ A;  3CH9 A;  2M08 A;  3CHF A;  4GGQ A;  5DO2 A;  2G8Z A;  3PRD A;  3NTP A;  3RM4 A;  5E65 A;  4G2P A;  3UI5 A;  1NWS A;  2PN0 A;  1K9Q A;  1OWQ A;  1L1P A;  2M2A A;  1FAP A;  1FKS A;  2XP3 A;  3I6C A;  5HW6 A;  2M1I A;  3GU0 A;  4JFL A;  5GPR A;  3CGN A;  2YSG A;  2DT2 A;  3FSC A;  3ARW A;  2LJ4 A;  3ART A;  1B6C A;  4QT3 A;  2M8I A;  1A7X A;  2ZR5 A;  2RUC A;  3AQU A;  5B8I C;  1C9H A;  3B9D A;  2PPN A;  5HW7 A;  2PV1 A;  2MDI A;  1JCH B;  1FKK A;  1Q1C A;  3WH0 A;  4MPK A;  1ZL1 A;  2DT3 A;  4AY1 A;  4W9O A;  4L3N A;  5HKG A;  4TX0 A;  1RD6 A;  2YBU A;  4DRP A;  2LGO A;  4ZS6 A;  1TCO C;  5E66 A;  2KR7 A;  3ARS A;  3FS8 A;  4MAV A;  4DRQ A;  1QZ2 A;  4DZ3 A;  3UF8 A;  2XPB A;  1FKJ A;  1R9H A;  2L4J A;  1ZU8 A;  2XP7 A;  1E6P A;  5HBF A;  3MQG A;  1BL4 A;  1UR9 A;  1E44 A;  2RE3 A;  4WK9 A;  2DPE A;  4MNJ A;  3EIP A;  4TNS A;  1T11 A;  2FAP A;  1FKL A;  2ZAJ A;  1JMQ A;  1SYT A;  1W1P A;  3BMB A;  3WD0 A;  4ODO A;  5HT1 A;  2LKN A;  2DWV A;  1NWR A;  1KT0 A;  2F2D A;  3JYJ A;  3L4H A;  2YBT A;  3RFW A;  1TR8 A;  3G6L A;  4MNL A;  4ZPV R;  5HWB A;  4Q22 A;  4KQZ A;  3FSB A;  4A0T A;  1ZBK A;  2RUD A;  3KAC A;  4DRH A;  1J4R A;  3UI4 A;  4Z2K A;  2KI3 A;  1EIB A;  4FN2 A;  3PRA A;  4LAW A;  2JV4 A;  1ZK6 A;  4NZC A;  4P8V A;  2WM0 A;  1WNO A;  1FKH A;  2MLX A;  3MQH A;  1QPL A;  4DRO A;  1XRV A;  1Y0O A;  4JFK A;  1D7I A;  1D6O A;  1W1V A;  4A0U A;  4MSP A;  3TC5 A;  2YAJ B;  3B7X A;  3O5L A;  2LAJ A;  3O5M A;  4N19 A;  5HWC A;  4W9Q A;  3CZ8 A;  3CNG A;  3O5Q A;  2ETN A;  1JNT A;  1FFR A;  2L2S A;  4R0X A;  1CTN A;  3AS1 A;  2DG9 A;  3AS0 A;  4LAX A;  3UQI A;  1HJV A;  2OFN A;  3MDY B;  1HKJ A;  2DSV A;  4J4N A;  2XP6 A;  3ALG A;  3KAB A;  4ODP A;  3PQH A;  4GLX A;  3ARP A;  3KAH A;  5I98 A;  1X6L A;  4LAV A;  4DT4 A;  4HAR A;  2M8J A;  2YSB A;  4ZPW R;  1NWT A;  1WB0 A;  2XPA A;  1ZBV A;  5BXJ A;  2RUR A;  1TFV A;  3JXV A;  4IQC A;  2E45 A;  1YW5 A;  3H9R B;  3FAP A;  4P8W A;  2F21 A;  3B8S A;  2FKE A;  4WKF A;  5DIT A;  1ZBW A;  2DG4 A;  1HJX A;  2MLZ A;  4QZV B;  4DRK A;  1ITX A;  4FAP A;  2IF4 A;  4IQ2 A;  5HTG A;  1QPF A;  2DK7 A;  2ZR6 A;  1W9V A;  2WLZ A;  2WK2 A;  2WLY A;  3ARR A;  2BA1 A;  4Z2J A;  3PRB A;  1N1A A;  3WQV A;  2ZQU A;  1K9T A;  3ARO A;  2EUL A;  5DF0 A;  1XHG A;  4MGV A;  5D75 A;  3RM9 A;  2B5U B;  2PBC A;  3O5I A;  5GQB A;  1FD9 A;  3WD1 A;  1Q6U A;  4JFJ A;  1HKK A;  1JND A;  2JX8 A;  3WD2 A;  4G50 A;  1F40 A;  4ODK A;  5E64 A;  5HUA A;  4ODL A;  4U85 A;  3M85 A;  2A3B A;  4DWS C;  5DIV A;  1D7H A;  1ZB5 A;  3IKG A;  4Z2I A;  1GOI A;  1W9U A;  3KCE A;  1Q6H A;  2B31 A;  2DT1 A;  1W1Y A;  1FKG A;  3PR9 A;  1E9L A;  4ODQ A;  1E6Z A; 
#chains in the Genus database with same CATH homology
 5E62 A;  1I5H W;  2QRV A;  1SR0 A;  1VF8 A;  3JYM A;  3TDB A;  1W1T A;  2PV2 A;  3UQB A;  2JXW A;  3O5K A;  1W26 A;  5JH8 A;  3ARU A;  4E5R A;  2ESC A;  4TYO A;  4W5U A;  1NH6 A;  4TW8 A;  3O5P A;  3NI6 A;  2WAE A;  4C02 B;  1EHN A;  4BF8 A;  4WJX A;  5HW8 A;  4NNR A;  2KXQ A;  1E15 A;  1YAT A;  2KE0 A;  4IPX A;  3WIJ A;  4KR0 B;  1ZBC A;  1J6Y A;  3EY6 A;  2PPP A;  1KFW A;  3KZ7 A;  4DRI A;  2QF8 A;  2UZ5 A;  4MNK A;  1JNE A;  3VAW A;  2ZR4 A;  4DRN A;  1WAW A;  3OOB A;  2DSU A;  4GIV A;  4DRJ A;  3WL1 A;  3WL0 A;  3WD3 A;  2RUQ A;  1TK7 A;  4JFI A;  4NSB A;  2G41 A;  2DK1 A;  2DMV A;  1OGG A;  3O5D A;  1FKI A;  3O5O A;  1LL6 A;  3KAF A;  2MLY A;  2XP8 A;  1X6N A;  1RP5 A;  3LKX B;  3B9A A;  4MNM A;  1WR7 A;  5J6E A;  1LG2 A;  4ITZ A;  1HJW A;  4DIP A;  1K9R A;  2MF9 A;  1HKI A;  2EZ5 W;  3BXW A;  3MCB B;  4L72 B;  1LL7 A;  4JYS A;  3O5R A;  1LL4 A;  2KGJ A;  4DRM A;  4LGX A;  2JZV A;  1BKF A;  2YSH A;  3CHE A;  2M3O W;  4QT2 A;  2A3A A;  3OA5 A;  2FDM A;  1PIN A;  3B9E A;  1W9P A;  4S3J A;  4REX A;  2N87 A;  4DWS B;  2WAD A;  1J4I A;  3WKZ A;  2OLH A;  4U86 A;  1LJY A;  4U84 A;  1FJD A;  4IT6 A;  2PPO A;  1JVW A;  2KO7 A;  2VCD A;  4HBE A;  1HXV A;  1UR8 A;  2AOS A;  2ZQT A;  4PTM A;  4TW7 A;  3FY1 A;  3O5G A;  1FKT A;  1NWU A;  4WIW A;  3KAD A;  3LKX A;  2DSZ A;  1ZCN A;  3G6M A;  2K8I A;  2DT0 A;  3GPK A;  1E6R A;  3O5J A;  3MCB A;  1JNS A;  3ODK A;  3KAG A;  1LQ0 A;  5U47 A;  1FKF A;  2MNT A;  1EG4 A;  5DIU A;  5DEZ A;  2XP5 A;  3PA7 A;  5CQ2 A;  4Z2H A;  1FFQ A;  1H0G A;  4WKH A;  3UQA A;  1EG3 A;  3WD4 A;  4WKA A;  3IK8 A;  3ALF A;  1NMV A;  3M7N A;  3RGC A;  3W4R A;  2F4E A;  4P8U A;  4ODR A;  4ODM A;  1E6N A;  1OGB A;  4HBO A;  4IT4 A;  1D2K A;  1LG1 A;  1EQ3 A;  4DWS A;  2O92 A;  4S3K A;  1GPF A;  1M5Y A;  3ARY A;  2PV3 A;  4Z2G A;  2Y8N B;  4MTV A;  4Q7N A;  3CHC A;  2IUZ A;  1P5Q A;  1NSG A;  3IKD A;  4O2T A;  4XAK A;  1EYM A;  5AHT A;  1O6W A;  1ROT A;  3UI6 A;  1IX5 A;  1WMV A;  1U79 A;  2OWO A;  2RSE A;  4W9P A;  3KAI A;  3AS2 A;  2YSI A;  4P8X A;  2A3C A;  3O5F A;  3LUO A;  2A3E A;  4QIB A;  3RM8 A;  3IHZ A;  1H0I A;  1EDQ A;  3ARX A;  1D7J A;  5GPG A;  1NMW A;  1O6I A;  1FKD A;  2Y78 A;  4DZ2 A;  4TW6 A;  3ARV A;  2JMF A;  3ARZ A;  2O9O A;  2LPV A;  2DG3 A;  4LAY A;  1PBK A;  1F8A B;  1FLC A;  2XP4 A;  2ITK A;  3LE4 A;  2XP9 A;  4Z2L A;  4JFM A;  3CHD A;  1GUV A;  2DJY A;  2YSF A;  1ROU A;  4ODN A;  2DSW A;  3RME A;  1FKR A;  2VN1 A;  2MPH A;  2D9F A;  3QOK A;  4URI A;  2ZQS A;  3CGM A;  1HKM A;  3FXY A;  4DH0 A;  4ML4 A;  4DWS D;  3TCZ A;  1KT1 A;  3WQW A;  1FKB A;  4J4O A;  2PI6 A;  2Q5A A;  2RQS A;  4ZPT R;  1Q6I A;  2AWG A;  3NRK A;  2ZQV A;  3O5E A;  1J4H A;  5E5W A;  3AS3 A;  2KFW A;  4R5E A;  3ARQ A;  3CH9 A;  2M08 A;  3CHF A;  4GGQ A;  5DO2 A;  2G8Z A;  3PRD A;  3NTP A;  3RM4 A;  5E65 A;  4G2P A;  3UI5 A;  1NWS A;  1K9Q A;  1OWQ A;  1L1P A;  2M2A A;  1FAP A;  1FKS A;  2XP3 A;  3I6C A;  5HW6 A;  2M1I A;  4JFL A;  5GPR A;  3CGN A;  2YSG A;  2DT2 A;  3FSC A;  3ARW A;  2LJ4 A;  3ART A;  1B6C A;  4QT3 A;  2M8I A;  1A7X A;  2ZR5 A;  2RUC A;  3AQU A;  5B8I C;  1C9H A;  3B9D A;  2PPN A;  5HW7 A;  2PV1 A;  2MDI A;  1FKK A;  1Q1C A;  3WH0 A;  4MPK A;  1ZL1 A;  2DT3 A;  4AY1 A;  4W9O A;  4L3N A;  5HKG A;  4TX0 A;  1RD6 A;  2YBU A;  4DRP A;  2LGO A;  4ZS6 A;  1TCO C;  5E66 A;  2KR7 A;  3ARS A;  3FS8 A;  4MAV A;  4DRQ A;  1QZ2 A;  4DZ3 A;  3UF8 A;  2XPB A;  1FKJ A;  1R9H A;  2L4J A;  1ZU8 A;  2XP7 A;  1E6P A;  5HBF A;  3MQG A;  1BL4 A;  1UR9 A;  2RE3 A;  4WK9 A;  2DPE A;  4MNJ A;  4TNS A;  1T11 A;  2FAP A;  1FKL A;  2ZAJ A;  1JMQ A;  1SYT A;  1W1P A;  3WD0 A;  4ODO A;  5HT1 A;  2LKN A;  2DWV A;  1NWR A;  1KT0 A;  2F2D A;  3JYJ A;  3L4H A;  2YBT A;  3RFW A;  1TR8 A;  3G6L A;  4MNL A;  4ZPV R;  5HWB A;  4Q22 A;  4KQZ A;  3FSB A;  4A0T A;  1ZBK A;  2RUD A;  3KAC A;  4DRH A;  1J4R A;  3UI4 A;  4Z2K A;  2KI3 A;  1EIB A;  4FN2 A;  3PRA A;  4LAW A;  2JV4 A;  1ZK6 A;  4NZC A;  4P8V A;  2WM0 A;  1WNO A;  1FKH A;  2MLX A;  3MQH A;  1QPL A;  4DRO A;  1XRV A;  1Y0O A;  4JFK A;  1D7I A;  1D6O A;  1W1V A;  4A0U A;  4MSP A;  3TC5 A;  2YAJ B;  3B7X A;  3O5L A;  2LAJ A;  3O5M A;  4N19 A;  5HWC A;  4W9Q A;  3CZ8 A;  3CNG A;  3O5Q A;  1JNT A;  1FFR A;  2L2S A;  4R0X A;  1CTN A;  3AS1 A;  2DG9 A;  3AS0 A;  4LAX A;  3UQI A;  1HJV A;  2OFN A;  3MDY B;  1HKJ A;  2DSV A;  4J4N A;  2XP6 A;  3ALG A;  3KAB A;  4ODP A;  3PQH A;  4GLX A;  3ARP A;  3KAH A;  5I98 A;  1X6L A;  4LAV A;  4DT4 A;  4HAR A;  2M8J A;  2YSB A;  4ZPW R;  1NWT A;  1WB0 A;  2XPA A;  1ZBV A;  5BXJ A;  2RUR A;  1TFV A;  3JXV A;  4IQC A;  2E45 A;  1YW5 A;  3H9R B;  3FAP A;  4P8W A;  2F21 A;  3B8S A;  2FKE A;  4WKF A;  5DIT A;  1ZBW A;  2DG4 A;  1HJX A;  2MLZ A;  4QZV B;  4DRK A;  1ITX A;  4FAP A;  2IF4 A;  4IQ2 A;  5HTG A;  1QPF A;  2DK7 A;  2ZR6 A;  1W9V A;  2WLZ A;  2WK2 A;  2WLY A;  3ARR A;  2BA1 A;  4Z2J A;  3PRB A;  1N1A A;  3WQV A;  2ZQU A;  1K9T A;  3ARO A;  5DF0 A;  1XHG A;  4MGV A;  5D75 A;  3RM9 A;  2PBC A;  3O5I A;  5GQB A;  1FD9 A;  3WD1 A;  1Q6U A;  4JFJ A;  1HKK A;  1JND A;  2JX8 A;  3WD2 A;  4G50 A;  1F40 A;  4ODK A;  5E64 A;  5HUA A;  4ODL A;  4U85 A;  3M85 A;  2A3B A;  4DWS C;  5DIV A;  1D7H A;  1ZB5 A;  3IKG A;  4Z2I A;  1GOI A;  1W9U A;  3KCE A;  1Q6H A;  2B31 A;  2DT1 A;  1W1Y A;  1FKG A;  3PR9 A;  1E9L A;  4ODQ A;  1E6Z A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...