2F21A

Human pin1 fip mutant
Total Genus 48
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
48
sequence length
162
structure length
153
Chain Sequence
MADEEKLPPGWEKRMSADGRVYYFNHITNASQWERPSGQGEPARVRCSHLLVKHSQSRRPSSWRQEKITRTKEEALELINGYIQKIKSGEEDFESLASQFSDCSSAKARGDLGAFSRGQMQKPFEDASFALRTGEMSGPVFTDSGIHIILRTE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Isomerase
molecule keywords Peptidyl-prolyl cis-trans isomerase NIMA-interacting 1
publication title Structure-function-folding relationship in a WW domain.
pubmed doi rcsb
source organism Homo sapiens
total genus 48
structure length 153
sequence length 162
ec nomenclature ec 5.2.1.8: Peptidylprolyl isomerase.
pdb deposition date 2005-11-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00397 WW WW domain
A PF00639 Rotamase PPIC-type PPIASE domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.20.70.10 Mainly Beta Single Sheet Ubiquitin Ligase Nedd4; Chain: W; Ubiquitin Ligase Nedd4; Chain: W; 2f21A01
3.10.50.40 Alpha Beta Roll Chitinase A; domain 3 Chitinase A; domain 3 2f21A02
2ITKA 2M1IA 2K8IA 2DWVA 4TW7A 3KAGA 4DIPA 2PV2A 3TCZA 1J6YA 3TDBA 2KXQA 2DG4A 3NTPA 2YSBA 4QT3A 4TX0A 3ODKA 3I6CA 2DMVA 4GIVA 1TK7A 4DRJA 2UZ5A 4ODNA 2L2SA 1EG3A 2DJYA 4N19A 3O5QA 1FKTA 2KFWA 2Q5AA 4U84A 1ZK6A 3O5IA 3O5OA 1FD9A 2MNTA 3IHZA 4REXA 1L1PA 4J4NA 3UQBA 2RUDA 4FAPA 4TNSA 1EQ3A 3PA7A 2RUQA 3O5FA 4G50A 2XP5A 3PRBA 4LAWA 5HT1A 3WH0A 3UI6A 3GPKA 1T11A 2M8JA 2M08A 2YSFA 3KAIA 2M3OW 1YATA 4DZ2A 3B7XA 4LAVA 5GPGA 3O5GA 1FKFA 2MDIA 3IK8A 3KAFA 4IQCA 3CGNA 2F4EA 4DRHA 2JZVA 2RURA 1P5QA 4JFMA 2YSIA 1M5YA 5DITA 2D9FA 3M85A 1FKKA 4DZ3A 4JYSA 1QPFA 3EY6A 5HTGA 4MSPA 3O5EA 4JFLA 2XP8A 1EYMA 3KZ7A 3L4HA 2M2AA 1Y0OA 4O2TA 4W9QA 3UQAA 4MGVA 4DRQA 3IKGA 3OOBA 2DG3A 2Y78A 4ODPA 5AHTA 2LPVA 4J4OA 1JMQA 2XP6A 3O5PA 4JFIA 3LE4A 4DT4A 1B6CA 2XP7A 2PBCA 2PPNA 1NMVA 2LGOA 2XP9A 3RFWA 2ZQTA 2F21A 5HUAA 1W26A 1QPLA 5HWBA 2DK7A 2M8IA 3H9RB 3JYMA 1C9HA 1KT1A 2ZQSA 2XPAA 2JXWA 4E5RA 3KABA 1WMVA 1J4IA 2E45A 2MPHA 2XP4A 1K9QA 2PPOA 4U86A 3O5LA 3O5JA 3O5DA 2XPBA 2VCDA 5DIVA 3PRDA 3NI6A 2MF9A 2DK1A 1J4HA 5J6EA 2RQSA 2N87A 5B8IC 5I98A 1FKLA 2PV3A 4TW8A 5HKGA 1Q6HA 4ODLA 1BKFA 2ZAJA 2ZR5A 3NRKA 3KAHA 4W9PA 4IPXA 1NSGA 1J4RA 1JNSA 4ITZA 1FKGA 4TYOA 2JMFA 1ZCNA 2FAPA 3UF8A 4DRNA 1O6WA 1R9HA 2JV4A 1FKDA 2IF4A 1YW5A 4BF8A 2XP3A 3LUOA 2LJ4A 1D7HA 2RSEA 1U79A 1F8AB 3TC5A 4ODMA 3CNGA 4QT2A 4ODOA 2YSHA 3O5RA 3O5KA 1HXVA 1JVWA 2VN1A 5DIUA 3MDYB 3O5MA 1ROUA 4TW6A 2BA1A 1FAPA 4LAXA 2OFNA 1N1AA 1FKJA 4JFJA 4ODKA 4DRKA 2KI3A 2AWGA 3UI4A 5HW6A 3M7NA 1KT0A 3CGMA 1FKRA 4U85A 1EG4A 5CQ2A 2ZR6A 2RUCA 2ZQUA 1QZ2A 4DRPA 4ODRA 1D7JA 3FAPA 4W9OA 1K9RA 2LAJA 2YSGA 3IKDA 4QIBA 2EZ5W 1F40A 2FKEA 2KE0A 1A7XA 1FKIA 2MLZA 2MLYA 4G2PA 4DRIA 2KR7A 3KCEA 5BXJA 1Q1CA 2KGJA 1FJDA 1I5HW 4GGQA 1ROTA 1FKSA 2RE3A 2PPPA 1PINA 1TCOC 3KADA 4FN2A 1Q6UA 4R0XA 2LKNA 1FKHA 4DRMA 2MLXA 5HW8A 2ZQVA 4NNRA 1D7IA 1NMWA 3VAWA 2PV1A 4LAYA 4JFKA 1Q6IA 2DG9A 1PBKA 1JNTA 4ODQA 4DROA 3UI5A 2ZR4A 5HWCA 4DH0A 3KACA 3JXVA 2L4JA 3UQIA 3JYJA 1FKBA 5HW7A 1BL4A 2KO7A 2JX8A 3RGCA 4IQ2A 1WR7A 1D6OA 5D75A 4C02B 2F2DA
chains in the Genus database with same CATH superfamily
4MPKA 4DWSB 2ITKA 2M1IA 2K8IA 2DWVA 2A3AA 4TW7A 3KAGA 1HJVA 4DIPA 1H0IA 2PV2A 3TCZA 1J6YA 3TDBA 4ZPVR 2YAJB 4P8VA 2KXQA 4MAVA 2DG4A 3NTPA 2YSBA 4QT3A 4TX0A 3BXWA 2YBUA 1HKIA 2WLYA 2QRVA 3MCBA 3ODKA 3I6CA 2DMVA 4GIVA 1TK7A 4DRJA 2UZ5A 4ODNA 2EULA 2L2SA 1EG3A 1E9LA 2DJYA 4N19A 3O5QA 1JNDA 1FKTA 1FFRA 2KFWA 2Q5AA 4U84A 1OWQA 1ZK6A 3O5IA 3O5OA 1FD9A 4KR0B 3EIPA 2MNTA 3IHZA 1CTNA 2G8ZA 4REXA 1L1PA 4J4NA 3MQHA 3CHDA 3UQBA 2RUDA 4FAPA 2DSUA 3RM4A 4TNSA 1EQ3A 3PA7A 2RUQA 3O5FA 4G50A 2XP5A 3PRBA 1RP5A 4LAWA 5HT1A 3WH0A 4NZCA 2ESCA 2B31A 3UI6A 1X6LA 1IX5A 2OWOA 3GPKA 1T11A 2M8JA 4Z2HA 1NWTA 2M08A 2YSFA 3KAIA 2M3OW 1YATA 1GOIA 2G41A 4DZ2A 3B7XA 4LAVA 4Z2GA 5GPGA 3ARZA 3O5GA 1FKFA 4DWSD 2MDIA 3IK8A 3KAFA 2IUZA 1W1YA 4HARA 4IQCA 1JCHB 1OGBA 1X6NA 3CGNA 2DT1A 2F4EA 4L72B 4DRHA 3CHCA 2JZVA 2RURA 1WNOA 4MNLA 1P5QA 3ARUA 4JFMA 2YSIA 1E15A 4ML4A 2DPEA 1D2KA 3FS8A 1M5YA 3ARXA 3FY1A 3ALGA 3CZ8A 5E62A 5DITA 3CH9A 2D9FA 3M85A 2WLZA 3ARYA 1FKKA 1EIBA 2WAEA 4PTMA 4WKFA 4JYSA 4GLXA 4DZ3A 5HBFA 4MNMA 4Z2JA 1QPFA 2PI6A 3EY6A 5HTGA 4MSPA 4ZPTR 3O5EA 3FSBA 4JFLA 2XP8A 1EYMA 3KZ7A 3L4HA 2M2AA 4ZS6A 1E6ZA 1Y0OA 2DSZA 4XAKA 3ALFA 4O2TA 1HJXA 3B8SA 4WKHA 4W9QA 1GRJA 4MGVA 5E65A 3UQAA 3B9DA 4DRQA 3IKGA 3OOBA 2DG3A 2Y78A 4ODPA 5AHTA 2LPVA 2O9OA 4URIA 1LQ0A 1LL6A 4J4OA 1JMQA 1W9VA 2XP6A 1UR9A 1JNEA 2YBTA 3O5PA 3LKXB 4JFIA 4S3JA 3LE4A 4DT4A 1B6CA 1LL7A 2XP7A 1NWRA 3PQHA 2PBCA 3ARQA 2PPNA 1NMVA 2LGOA 2XP9A 3RFWA 1HKJA 3PRAA 2A3EA 1W1PA 2ZQTA 3BMBA 1W1TA 3WD0A 2WM0A 2F21A 5HUAA 1W26A 2DSVA 1QPLA 5HWBA 1FLCA 4WJXA 2DK7A 3ARWA 2M8IA 3H9RB 3JYMA 1HKKA 1C9HA 4A0UA 1KT1A 2ZQSA 1NWUA 2XPAA 2JXWA 4E5RA 1LJYA 4QZVB 3KABA 4R5EA 1WMVA 1J4IA 2DT2A 3WQWA 3LKXA 2E45A 2MPHA 2XP4A 1E6NA 3WKZA 1K9QA 2PPOA 4U86A 1W9PA 3O5LA 1TR8A 3O5JA 1H0GA 3O5DA 2XPBA 1ZBKA 2VCDA 4Z2KA 1ITXA 3B9AA 2DT3A 5DIVA 3PRDA 3NI6A 2MF9A 2DK1A 1J4HA 5J6EA 2RQSA 2WADA 1GPFA 2N87A 5B8IC 1K9TA 2DSWA 5I98A 4HBOA 1FKLA 2PV3A 4LGXA 4TW8A 3G6LA 4Q7NA 1OGGA 1NWSA 5HKGA 1Q6HA 3WD1A 4IT4A 1EHNA 4ODLA 1BKFA 3AQUA 1FFQA 3AROA 2ZAJA 1ZB5A 2ZR5A 3NRKA 3KAHA 4MTVA 4W9PA 1HKMA 1ZBVA 2Y8NB 1RD6A 4IPXA 5GPRA 1NSGA 1J4RA 3RMEA 1JNSA 5GQBA 4ITZA 1FKGA 4WK9A 2ETNA 2PN0A 4TYOA 1XRVA 2JMFA 1ZCNA 2FAPA 2O92A 3B9EA 3UF8A 4DRNA 1O6WA 4P8WA 1R9HA 2A3CA 2JV4A 3FXYA 3MQGA 1FKDA 5DO2A 3ARPA 2IF4A 3ARRA 2OLHA 1YW5A 1UR8A 3ARVA 4BF8A 2XP3A 3LUOA 3WD2A 2LJ4A 1XHGA 1D7HA 1ZU8A 2P4VA 3RM8A 4IT6A 4W5UA 2RSEA 1U79A 4L3NA 5U47A 4WKAA 1F8AB 3TC5A 4ODMA 3CNGA 5E5WA 4QT2A 4ODOA 4P8UA 2YSHA 3O5RA 3O5KA 1HXVA 1JVWA 2A3BA 2VN1A 2F23A 4HBEA 2AOSA 5DIUA 3MDYB 3O5MA 1ROUA 1E6PA 4TW6A 3OA5A 4P8XA 2BA1A 5DEZA 3PR9A 3WIJA 1SR0A 1FAPA 4LAXA 2OFNA 1N1AA 1ZBWA 2DT0A 1FKJA 4JFJA 1VF8A 4ODKA 4DRKA 1WB0A 2KI3A 1O6IA 2AWGA 3UI4A 5HW6A 3WD4A 1LG2A 3M7NA 2WK2A 5JH8A 1ZBCA 4S3KA 1KT0A 3CGMA 5E64A 1FKRA 4U85A 1EG4A 2B5UB 5CQ2A 2ZR6A 3AS1A 4NSBA 2RUCA 2ZQUA 3ARTA 1QZ2A 1WAWA 4DRPA 4DWSA 4KQZA 4ODRA 1D7JA 3CHEA 3FAPA 3GU0A 4W9OA 4MNKA 1K9RA 2LAJA 2YSGA 3AS2A 3AS0A 3IKDA 2EZ5W 4QIBA 3RM9A 3FSCA 1W1VA 1F40A 2FKEA 4UDMA 2KE0A 1A7XA 1FKIA 2MLZA 2MLYA 1HJWA 3G6MA 4AY1A 4G2PA 4DRIA 2KR7A 1W9UA 3WD3A 3KCEA 3WL1A 5BXJA 3WQVA 1Q1CA 2KGJA 1LL4A 3ARSA 1FJDA 1I5HW 4GGQA 1ROTA 1FKSA 2RE3A 2PPPA 1PINA 1TCOC 3KADA 1E44A 4FN2A 1Q6UA 4MNJA 4R0XA 2LKNA 1FKHA 4Q22A 4DRMA 2MLXA 5HW8A 3QOKA 4Z2LA 2ZQVA 4NNRA 1D7IA 1NMWA 3VAWA 2PV1A 4LAYA 2FDMA 1EDQA 2QF8A 4JFKA 1GUVA 1Q6IA 4ZPWR 2DG9A 1PBKA 1NH6A 3AS3A 3GTYX 1JNTA 4ODQA 4DROA 1TFVA 3UI5A 1E6RA 4A0TA 2ZR4A 4Z2IA 1SYTA 1ZL1A 1KFWA 5DF0A 5HWCA 3W4RA 3MCBB 3KACA 3JXVA 4DH0A 2L4JA 3UQIA 5E66A 3JYJA 1FKBA 4WIWA 5HW7A 3WL0A 4DWSC 1BL4A 1LG1A 2KO7A 2JX8A 3CHFA 3RGCA 4IQ2A 1WR7A 1D6OA 5D75A 4C02B 2F2DA
chains in the Genus database with same CATH topology
4MPKA 4DWSB 2ITKA 2M1IA 2K8IA 2DWVA 2A3AA 4TW7A 3KAGA 1HJVA 4DIPA 1H0IA 2PV2A 3TCZA 1J6YA 3TDBA 4ZPVR 2YAJB 4P8VA 2KXQA 4MAVA 2DG4A 3NTPA 2YSBA 4QT3A 4TX0A 3BXWA 2YBUA 1HKIA 2WLYA 2QRVA 3MCBA 3ODKA 3I6CA 2DMVA 4GIVA 1TK7A 4DRJA 2UZ5A 4ODNA 2L2SA 1EG3A 1E9LA 2DJYA 4N19A 3O5QA 1JNDA 1FKTA 1FFRA 2KFWA 2Q5AA 4U84A 1OWQA 1ZK6A 3O5IA 3O5OA 1FD9A 4KR0B 2MNTA 3IHZA 1CTNA 2G8ZA 4REXA 1L1PA 4J4NA 3MQHA 3CHDA 3UQBA 2RUDA 4FAPA 2DSUA 3RM4A 4TNSA 1EQ3A 3PA7A 2RUQA 3O5FA 4G50A 2XP5A 3PRBA 1RP5A 4LAWA 5HT1A 3WH0A 4NZCA 2ESCA 2B31A 3UI6A 1X6LA 1IX5A 2OWOA 3GPKA 1T11A 2M8JA 4Z2HA 1NWTA 2M08A 2YSFA 3KAIA 2M3OW 1YATA 1GOIA 2G41A 4DZ2A 3B7XA 4LAVA 4Z2GA 5GPGA 3ARZA 3O5GA 1FKFA 4DWSD 2MDIA 3IK8A 3KAFA 2IUZA 1W1YA 4HARA 4IQCA 1OGBA 1X6NA 3CGNA 2DT1A 2F4EA 4L72B 4DRHA 3CHCA 2JZVA 2RURA 1WNOA 4MNLA 1P5QA 3ARUA 4JFMA 2YSIA 1E15A 4ML4A 2DPEA 1D2KA 3FS8A 1M5YA 3ARXA 3FY1A 3ALGA 3CZ8A 5E62A 5DITA 3CH9A 2D9FA 3M85A 2WLZA 3ARYA 1FKKA 1EIBA 2WAEA 4PTMA 4WKFA 4JYSA 4GLXA 4DZ3A 5HBFA 4MNMA 4Z2JA 1QPFA 2PI6A 3EY6A 5HTGA 4MSPA 4ZPTR 3O5EA 3FSBA 4JFLA 2XP8A 1EYMA 3KZ7A 3L4HA 2M2AA 4ZS6A 1E6ZA 1Y0OA 2DSZA 4XAKA 3ALFA 4O2TA 1HJXA 3B8SA 4WKHA 4W9QA 3UQAA 4MGVA 5E65A 3B9DA 4DRQA 3IKGA 3OOBA 2DG3A 2Y78A 4ODPA 5AHTA 2LPVA 2O9OA 4URIA 1LQ0A 1LL6A 4J4OA 1JMQA 1W9VA 2XP6A 1UR9A 1JNEA 2YBTA 3O5PA 3LKXB 4JFIA 4S3JA 3LE4A 4DT4A 1B6CA 1LL7A 2XP7A 1NWRA 3PQHA 2PBCA 3ARQA 2PPNA 1NMVA 2LGOA 2XP9A 3RFWA 1HKJA 3PRAA 2A3EA 1W1PA 2ZQTA 1W1TA 3WD0A 2WM0A 2F21A 5HUAA 1W26A 2DSVA 1QPLA 5HWBA 1FLCA 4WJXA 2DK7A 3ARWA 2M8IA 3H9RB 3JYMA 1HKKA 1C9HA 4A0UA 1KT1A 2ZQSA 1NWUA 2XPAA 2JXWA 4E5RA 1LJYA 4QZVB 3KABA 4R5EA 1WMVA 1J4IA 2DT2A 3WQWA 3LKXA 2E45A 2MPHA 2XP4A 1E6NA 3WKZA 1K9QA 2PPOA 4U86A 1W9PA 3O5LA 1TR8A 3O5JA 1H0GA 3O5DA 2XPBA 1ZBKA 2VCDA 4Z2KA 1ITXA 3B9AA 2DT3A 5DIVA 3PRDA 3NI6A 2MF9A 2DK1A 1J4HA 5J6EA 2RQSA 2WADA 1GPFA 2N87A 5B8IC 1K9TA 2DSWA 5I98A 4HBOA 1FKLA 2PV3A 4LGXA 4TW8A 3G6LA 4Q7NA 1OGGA 1NWSA 5HKGA 1Q6HA 3WD1A 4IT4A 1EHNA 4ODLA 1BKFA 3AQUA 1FFQA 3AROA 2ZAJA 1ZB5A 2ZR5A 3NRKA 3KAHA 4MTVA 4W9PA 1HKMA 1ZBVA 2Y8NB 1RD6A 4IPXA 5GPRA 1NSGA 1J4RA 3RMEA 1JNSA 5GQBA 4ITZA 1FKGA 4WK9A 4TYOA 1XRVA 2JMFA 1ZCNA 2FAPA 2O92A 3B9EA 3UF8A 4DRNA 1O6WA 4P8WA 1R9HA 2A3CA 2JV4A 3FXYA 3MQGA 1FKDA 5DO2A 3ARPA 2IF4A 3ARRA 2OLHA 1YW5A 1UR8A 3ARVA 4BF8A 2XP3A 3LUOA 3WD2A 2LJ4A 1XHGA 1D7HA 1ZU8A 3RM8A 4IT6A 4W5UA 2RSEA 1U79A 4L3NA 5U47A 4WKAA 1F8AB 3TC5A 4ODMA 3CNGA 5E5WA 4QT2A 4ODOA 4P8UA 2YSHA 3O5RA 3O5KA 1HXVA 1JVWA 2A3BA 2VN1A 4HBEA 2AOSA 5DIUA 3MDYB 3O5MA 1ROUA 1E6PA 4TW6A 3OA5A 4P8XA 2BA1A 5DEZA 3PR9A 3WIJA 1SR0A 1FAPA 4LAXA 2OFNA 1N1AA 1ZBWA 2DT0A 1FKJA 4JFJA 1VF8A 4ODKA 4DRKA 1WB0A 2KI3A 1O6IA 2AWGA 3UI4A 5HW6A 3WD4A 1LG2A 3M7NA 2WK2A 5JH8A 1ZBCA 4S3KA 1KT0A 3CGMA 5E64A 1FKRA 4U85A 1EG4A 5CQ2A 2ZR6A 3AS1A 4NSBA 2RUCA 2ZQUA 3ARTA 1QZ2A 1WAWA 4DRPA 4DWSA 4KQZA 4ODRA 1D7JA 3CHEA 3FAPA 4W9OA 4MNKA 1K9RA 2LAJA 2YSGA 3AS2A 3AS0A 3IKDA 2EZ5W 4QIBA 3RM9A 3FSCA 1W1VA 1F40A 2FKEA 2KE0A 1A7XA 1FKIA 2MLZA 2MLYA 1HJWA 3G6MA 4AY1A 4G2PA 4DRIA 2KR7A 1W9UA 3WD3A 3KCEA 3WL1A 5BXJA 3WQVA 1Q1CA 2KGJA 1LL4A 3ARSA 1FJDA 1I5HW 4GGQA 1ROTA 1FKSA 2RE3A 2PPPA 1PINA 1TCOC 3KADA 4FN2A 1Q6UA 4MNJA 4R0XA 2LKNA 1FKHA 4Q22A 4DRMA 2MLXA 5HW8A 3QOKA 4Z2LA 2ZQVA 4NNRA 1D7IA 1NMWA 3VAWA 2PV1A 4LAYA 2FDMA 1EDQA 2QF8A 4JFKA 1GUVA 1Q6IA 4ZPWR 2DG9A 1PBKA 1NH6A 3AS3A 1JNTA 4ODQA 4DROA 1TFVA 3UI5A 1E6RA 4A0TA 2ZR4A 4Z2IA 1SYTA 1ZL1A 1KFWA 5DF0A 5HWCA 3W4RA 3MCBB 3KACA 3JXVA 4DH0A 2L4JA 3UQIA 5E66A 3JYJA 1FKBA 4WIWA 5HW7A 3WL0A 4DWSC 1BL4A 1LG1A 2KO7A 2JX8A 3CHFA 3RGCA 4IQ2A 1WR7A 1D6OA 5D75A 4C02B 2F2DA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2ITK A;  2M1I A;  2K8I A;  2DWV A;  4TW7 A;  3KAG A;  4DIP A;  2PV2 A;  3TCZ A;  1J6Y A;  3TDB A;  2KXQ A;  2DG4 A;  3NTP A;  2YSB A;  4QT3 A;  4TX0 A;  3ODK A;  3I6C A;  2DMV A;  4GIV A;  1TK7 A;  4DRJ A;  2UZ5 A;  4ODN A;  2L2S A;  1EG3 A;  2DJY A;  4N19 A;  3O5Q A;  1FKT A;  2KFW A;  2Q5A A;  4U84 A;  1ZK6 A;  3O5I A;  3O5O A;  1FD9 A;  2MNT A;  3IHZ A;  4REX A;  1L1P A;  4J4N A;  3UQB A;  2RUD A;  4FAP A;  4TNS A;  1EQ3 A;  3PA7 A;  2RUQ A;  3O5F A;  4G50 A;  2XP5 A;  3PRB A;  4LAW A;  5HT1 A;  3WH0 A;  3UI6 A;  3GPK A;  1T11 A;  2M8J A;  2M08 A;  2YSF A;  3KAI A;  2M3O W;  1YAT A;  4DZ2 A;  3B7X A;  4LAV A;  5GPG A;  3O5G A;  1FKF A;  2MDI A;  3IK8 A;  3KAF A;  4IQC A;  3CGN A;  2F4E A;  4DRH A;  2JZV A;  2RUR A;  1P5Q A;  4JFM A;  2YSI A;  1M5Y A;  5DIT A;  2D9F A;  3M85 A;  1FKK A;  4DZ3 A;  4JYS A;  1QPF A;  3EY6 A;  5HTG A;  4MSP A;  3O5E A;  4JFL A;  2XP8 A;  1EYM A;  3KZ7 A;  3L4H A;  2M2A A;  1Y0O A;  4O2T A;  4W9Q A;  3UQA A;  4MGV A;  4DRQ A;  3IKG A;  3OOB A;  2DG3 A;  2Y78 A;  4ODP A;  5AHT A;  2LPV A;  4J4O A;  1JMQ A;  2XP6 A;  3O5P A;  4JFI A;  3LE4 A;  4DT4 A;  1B6C A;  2XP7 A;  2PBC A;  2PPN A;  1NMV A;  2LGO A;  2XP9 A;  3RFW A;  2ZQT A;  2F21 A;  5HUA A;  1W26 A;  1QPL A;  5HWB A;  2DK7 A;  2M8I A;  3H9R B;  3JYM A;  1C9H A;  1KT1 A;  2ZQS A;  2XPA A;  2JXW A;  4E5R A;  3KAB A;  1WMV A;  1J4I A;  2E45 A;  2MPH A;  2XP4 A;  1K9Q A;  2PPO A;  4U86 A;  3O5L A;  3O5J A;  3O5D A;  2XPB A;  2VCD A;  5DIV A;  3PRD A;  3NI6 A;  2MF9 A;  2DK1 A;  1J4H A;  5J6E A;  2RQS A;  2N87 A;  5B8I C;  5I98 A;  1FKL A;  2PV3 A;  4TW8 A;  5HKG A;  1Q6H A;  4ODL A;  1BKF A;  2ZAJ A;  2ZR5 A;  3NRK A;  3KAH A;  4W9P A;  4IPX A;  1NSG A;  1J4R A;  1JNS A;  4ITZ A;  1FKG A;  4TYO A;  2JMF A;  1ZCN A;  2FAP A;  3UF8 A;  4DRN A;  1O6W A;  1R9H A;  2JV4 A;  1FKD A;  2IF4 A;  1YW5 A;  4BF8 A;  2XP3 A;  3LUO A;  2LJ4 A;  1D7H A;  2RSE A;  1U79 A;  1F8A B;  3TC5 A;  4ODM A;  3CNG A;  4QT2 A;  4ODO A;  2YSH A;  3O5R A;  3O5K A;  1HXV A;  1JVW A;  2VN1 A;  5DIU A;  3MDY B;  3O5M A;  1ROU A;  4TW6 A;  2BA1 A;  1FAP A;  4LAX A;  2OFN A;  1N1A A;  1FKJ A;  4JFJ A;  4ODK A;  4DRK A;  2KI3 A;  2AWG A;  3UI4 A;  5HW6 A;  3M7N A;  1KT0 A;  3CGM A;  1FKR A;  4U85 A;  1EG4 A;  5CQ2 A;  2ZR6 A;  2RUC A;  2ZQU A;  1QZ2 A;  4DRP A;  4ODR A;  1D7J A;  3FAP A;  4W9O A;  1K9R A;  2LAJ A;  2YSG A;  3IKD A;  4QIB A;  2EZ5 W;  1F40 A;  2FKE A;  2KE0 A;  1A7X A;  1FKI A;  2MLZ A;  2MLY A;  4G2P A;  4DRI A;  2KR7 A;  3KCE A;  5BXJ A;  1Q1C A;  2KGJ A;  1FJD A;  1I5H W;  4GGQ A;  1ROT A;  1FKS A;  2RE3 A;  2PPP A;  1PIN A;  1TCO C;  3KAD A;  4FN2 A;  1Q6U A;  4R0X A;  2LKN A;  1FKH A;  4DRM A;  2MLX A;  5HW8 A;  2ZQV A;  4NNR A;  1D7I A;  1NMW A;  3VAW A;  2PV1 A;  4LAY A;  4JFK A;  1Q6I A;  2DG9 A;  1PBK A;  1JNT A;  4ODQ A;  4DRO A;  3UI5 A;  2ZR4 A;  5HWC A;  4DH0 A;  3KAC A;  3JXV A;  2L4J A;  3UQI A;  3JYJ A;  1FKB A;  5HW7 A;  1BL4 A;  2KO7 A;  2JX8 A;  3RGC A;  4IQ2 A;  1WR7 A;  1D6O A;  5D75 A;  4C02 B;  2F2D A; 
#chains in the Genus database with same CATH topology
 4MPK A;  4DWS B;  2ITK A;  2M1I A;  2K8I A;  2DWV A;  2A3A A;  4TW7 A;  3KAG A;  1HJV A;  4DIP A;  1H0I A;  2PV2 A;  3TCZ A;  1J6Y A;  3TDB A;  4ZPV R;  2YAJ B;  4P8V A;  2KXQ A;  4MAV A;  2DG4 A;  3NTP A;  2YSB A;  4QT3 A;  4TX0 A;  3BXW A;  2YBU A;  1HKI A;  2WLY A;  2QRV A;  3MCB A;  3ODK A;  3I6C A;  2DMV A;  4GIV A;  1TK7 A;  4DRJ A;  2UZ5 A;  4ODN A;  2EUL A;  2L2S A;  1EG3 A;  1E9L A;  2DJY A;  4N19 A;  3O5Q A;  1JND A;  1FKT A;  1FFR A;  2KFW A;  2Q5A A;  4U84 A;  1OWQ A;  1ZK6 A;  3O5I A;  3O5O A;  1FD9 A;  4KR0 B;  3EIP A;  2MNT A;  3IHZ A;  1CTN A;  2G8Z A;  4REX A;  1L1P A;  4J4N A;  3MQH A;  3CHD A;  3UQB A;  2RUD A;  4FAP A;  2DSU A;  3RM4 A;  4TNS A;  1EQ3 A;  3PA7 A;  2RUQ A;  3O5F A;  4G50 A;  2XP5 A;  3PRB A;  1RP5 A;  4LAW A;  5HT1 A;  3WH0 A;  4NZC A;  2ESC A;  2B31 A;  3UI6 A;  1X6L A;  1IX5 A;  2OWO A;  3GPK A;  1T11 A;  2M8J A;  4Z2H A;  1NWT A;  2M08 A;  2YSF A;  3KAI A;  2M3O W;  1YAT A;  1GOI A;  2G41 A;  4DZ2 A;  3B7X A;  4LAV A;  4Z2G A;  5GPG A;  3ARZ A;  3O5G A;  1FKF A;  4DWS D;  2MDI A;  3IK8 A;  3KAF A;  2IUZ A;  1W1Y A;  4HAR A;  4IQC A;  1JCH B;  1OGB A;  1X6N A;  3CGN A;  2DT1 A;  2F4E A;  4L72 B;  4DRH A;  3CHC A;  2JZV A;  2RUR A;  1WNO A;  4MNL A;  1P5Q A;  3ARU A;  4JFM A;  2YSI A;  1E15 A;  4ML4 A;  2DPE A;  1D2K A;  3FS8 A;  1M5Y A;  3ARX A;  3FY1 A;  3ALG A;  3CZ8 A;  5E62 A;  5DIT A;  3CH9 A;  2D9F A;  3M85 A;  2WLZ A;  3ARY A;  1FKK A;  1EIB A;  2WAE A;  4PTM A;  4WKF A;  4JYS A;  4GLX A;  4DZ3 A;  5HBF A;  4MNM A;  4Z2J A;  1QPF A;  2PI6 A;  3EY6 A;  5HTG A;  4MSP A;  4ZPT R;  3O5E A;  3FSB A;  4JFL A;  2XP8 A;  1EYM A;  3KZ7 A;  3L4H A;  2M2A A;  4ZS6 A;  1E6Z A;  1Y0O A;  2DSZ A;  4XAK A;  3ALF A;  4O2T A;  1HJX A;  3B8S A;  4WKH A;  4W9Q A;  1GRJ A;  4MGV A;  5E65 A;  3UQA A;  3B9D A;  4DRQ A;  3IKG A;  3OOB A;  2DG3 A;  2Y78 A;  4ODP A;  5AHT A;  2LPV A;  2O9O A;  4URI A;  1LQ0 A;  1LL6 A;  4J4O A;  1JMQ A;  1W9V A;  2XP6 A;  1UR9 A;  1JNE A;  2YBT A;  3O5P A;  3LKX B;  4JFI A;  4S3J A;  3LE4 A;  4DT4 A;  1B6C A;  1LL7 A;  2XP7 A;  1NWR A;  3PQH A;  2PBC A;  3ARQ A;  2PPN A;  1NMV A;  2LGO A;  2XP9 A;  3RFW A;  1HKJ A;  3PRA A;  2A3E A;  1W1P A;  2ZQT A;  3BMB A;  1W1T A;  3WD0 A;  2WM0 A;  2F21 A;  5HUA A;  1W26 A;  2DSV A;  1QPL A;  5HWB A;  1FLC A;  4WJX A;  2DK7 A;  3ARW A;  2M8I A;  3H9R B;  3JYM A;  1HKK A;  1C9H A;  4A0U A;  1KT1 A;  2ZQS A;  1NWU A;  2XPA A;  2JXW A;  4E5R A;  1LJY A;  4QZV B;  3KAB A;  4R5E A;  1WMV A;  1J4I A;  2DT2 A;  3WQW A;  3LKX A;  2E45 A;  2MPH A;  2XP4 A;  1E6N A;  3WKZ A;  1K9Q A;  2PPO A;  4U86 A;  1W9P A;  3O5L A;  1TR8 A;  3O5J A;  1H0G A;  3O5D A;  2XPB A;  1ZBK A;  2VCD A;  4Z2K A;  1ITX A;  3B9A A;  2DT3 A;  5DIV A;  3PRD A;  3NI6 A;  2MF9 A;  2DK1 A;  1J4H A;  5J6E A;  2RQS A;  2WAD A;  1GPF A;  2N87 A;  5B8I C;  1K9T A;  2DSW A;  5I98 A;  4HBO A;  1FKL A;  2PV3 A;  4LGX A;  4TW8 A;  3G6L A;  4Q7N A;  1OGG A;  1NWS A;  5HKG A;  1Q6H A;  3WD1 A;  4IT4 A;  1EHN A;  4ODL A;  1BKF A;  3AQU A;  1FFQ A;  3ARO A;  2ZAJ A;  1ZB5 A;  2ZR5 A;  3NRK A;  3KAH A;  4MTV A;  4W9P A;  1HKM A;  1ZBV A;  2Y8N B;  1RD6 A;  4IPX A;  5GPR A;  1NSG A;  1J4R A;  3RME A;  1JNS A;  5GQB A;  4ITZ A;  1FKG A;  4WK9 A;  2ETN A;  2PN0 A;  4TYO A;  1XRV A;  2JMF A;  1ZCN A;  2FAP A;  2O92 A;  3B9E A;  3UF8 A;  4DRN A;  1O6W A;  4P8W A;  1R9H A;  2A3C A;  2JV4 A;  3FXY A;  3MQG A;  1FKD A;  5DO2 A;  3ARP A;  2IF4 A;  3ARR A;  2OLH A;  1YW5 A;  1UR8 A;  3ARV A;  4BF8 A;  2XP3 A;  3LUO A;  3WD2 A;  2LJ4 A;  1XHG A;  1D7H A;  1ZU8 A;  2P4V A;  3RM8 A;  4IT6 A;  4W5U A;  2RSE A;  1U79 A;  4L3N A;  5U47 A;  4WKA A;  1F8A B;  3TC5 A;  4ODM A;  3CNG A;  5E5W A;  4QT2 A;  4ODO A;  4P8U A;  2YSH A;  3O5R A;  3O5K A;  1HXV A;  1JVW A;  2A3B A;  2VN1 A;  2F23 A;  4HBE A;  2AOS A;  5DIU A;  3MDY B;  3O5M A;  1ROU A;  1E6P A;  4TW6 A;  3OA5 A;  4P8X A;  2BA1 A;  5DEZ A;  3PR9 A;  3WIJ A;  1SR0 A;  1FAP A;  4LAX A;  2OFN A;  1N1A A;  1ZBW A;  2DT0 A;  1FKJ A;  4JFJ A;  1VF8 A;  4ODK A;  4DRK A;  1WB0 A;  2KI3 A;  1O6I A;  2AWG A;  3UI4 A;  5HW6 A;  3WD4 A;  1LG2 A;  3M7N A;  2WK2 A;  5JH8 A;  1ZBC A;  4S3K A;  1KT0 A;  3CGM A;  5E64 A;  1FKR A;  4U85 A;  1EG4 A;  2B5U B;  5CQ2 A;  2ZR6 A;  3AS1 A;  4NSB A;  2RUC A;  2ZQU A;  3ART A;  1QZ2 A;  1WAW A;  4DRP A;  4DWS A;  4KQZ A;  4ODR A;  1D7J A;  3CHE A;  3FAP A;  3GU0 A;  4W9O A;  4MNK A;  1K9R A;  2LAJ A;  2YSG A;  3AS2 A;  3AS0 A;  3IKD A;  2EZ5 W;  4QIB A;  3RM9 A;  3FSC A;  1W1V A;  1F40 A;  2FKE A;  4UDM A;  2KE0 A;  1A7X A;  1FKI A;  2MLZ A;  2MLY A;  1HJW A;  3G6M A;  4AY1 A;  4G2P A;  4DRI A;  2KR7 A;  1W9U A;  3WD3 A;  3KCE A;  3WL1 A;  5BXJ A;  3WQV A;  1Q1C A;  2KGJ A;  1LL4 A;  3ARS A;  1FJD A;  1I5H W;  4GGQ A;  1ROT A;  1FKS A;  2RE3 A;  2PPP A;  1PIN A;  1TCO C;  3KAD A;  1E44 A;  4FN2 A;  1Q6U A;  4MNJ A;  4R0X A;  2LKN A;  1FKH A;  4Q22 A;  4DRM A;  2MLX A;  5HW8 A;  3QOK A;  4Z2L A;  2ZQV A;  4NNR A;  1D7I A;  1NMW A;  3VAW A;  2PV1 A;  4LAY A;  2FDM A;  1EDQ A;  2QF8 A;  4JFK A;  1GUV A;  1Q6I A;  4ZPW R;  2DG9 A;  1PBK A;  1NH6 A;  3AS3 A;  3GTY X;  1JNT A;  4ODQ A;  4DRO A;  1TFV A;  3UI5 A;  1E6R A;  4A0T A;  2ZR4 A;  4Z2I A;  1SYT A;  1ZL1 A;  1KFW A;  5DF0 A;  5HWC A;  3W4R A;  3MCB B;  3KAC A;  3JXV A;  4DH0 A;  2L4J A;  3UQI A;  5E66 A;  3JYJ A;  1FKB A;  4WIW A;  5HW7 A;  3WL0 A;  4DWS C;  1BL4 A;  1LG1 A;  2KO7 A;  2JX8 A;  3CHF A;  3RGC A;  4IQ2 A;  1WR7 A;  1D6O A;  5D75 A;  4C02 B;  2F2D A; 
#chains in the Genus database with same CATH homology
 4MPK A;  4DWS B;  2ITK A;  2M1I A;  2K8I A;  2DWV A;  2A3A A;  4TW7 A;  3KAG A;  1HJV A;  4DIP A;  1H0I A;  2PV2 A;  3TCZ A;  1J6Y A;  3TDB A;  4ZPV R;  2YAJ B;  4P8V A;  2KXQ A;  4MAV A;  2DG4 A;  3NTP A;  2YSB A;  4QT3 A;  4TX0 A;  3BXW A;  2YBU A;  1HKI A;  2WLY A;  2QRV A;  3MCB A;  3ODK A;  3I6C A;  2DMV A;  4GIV A;  1TK7 A;  4DRJ A;  2UZ5 A;  4ODN A;  2L2S A;  1EG3 A;  1E9L A;  2DJY A;  4N19 A;  3O5Q A;  1JND A;  1FKT A;  1FFR A;  2KFW A;  2Q5A A;  4U84 A;  1OWQ A;  1ZK6 A;  3O5I A;  3O5O A;  1FD9 A;  4KR0 B;  2MNT A;  3IHZ A;  1CTN A;  2G8Z A;  4REX A;  1L1P A;  4J4N A;  3MQH A;  3CHD A;  3UQB A;  2RUD A;  4FAP A;  2DSU A;  3RM4 A;  4TNS A;  1EQ3 A;  3PA7 A;  2RUQ A;  3O5F A;  4G50 A;  2XP5 A;  3PRB A;  1RP5 A;  4LAW A;  5HT1 A;  3WH0 A;  4NZC A;  2ESC A;  2B31 A;  3UI6 A;  1X6L A;  1IX5 A;  2OWO A;  3GPK A;  1T11 A;  2M8J A;  4Z2H A;  1NWT A;  2M08 A;  2YSF A;  3KAI A;  2M3O W;  1YAT A;  1GOI A;  2G41 A;  4DZ2 A;  3B7X A;  4LAV A;  4Z2G A;  5GPG A;  3ARZ A;  3O5G A;  1FKF A;  4DWS D;  2MDI A;  3IK8 A;  3KAF A;  2IUZ A;  1W1Y A;  4HAR A;  4IQC A;  1OGB A;  1X6N A;  3CGN A;  2DT1 A;  2F4E A;  4L72 B;  4DRH A;  3CHC A;  2JZV A;  2RUR A;  1WNO A;  4MNL A;  1P5Q A;  3ARU A;  4JFM A;  2YSI A;  1E15 A;  4ML4 A;  2DPE A;  1D2K A;  3FS8 A;  1M5Y A;  3ARX A;  3FY1 A;  3ALG A;  3CZ8 A;  5E62 A;  5DIT A;  3CH9 A;  2D9F A;  3M85 A;  2WLZ A;  3ARY A;  1FKK A;  1EIB A;  2WAE A;  4PTM A;  4WKF A;  4JYS A;  4GLX A;  4DZ3 A;  5HBF A;  4MNM A;  4Z2J A;  1QPF A;  2PI6 A;  3EY6 A;  5HTG A;  4MSP A;  4ZPT R;  3O5E A;  3FSB A;  4JFL A;  2XP8 A;  1EYM A;  3KZ7 A;  3L4H A;  2M2A A;  4ZS6 A;  1E6Z A;  1Y0O A;  2DSZ A;  4XAK A;  3ALF A;  4O2T A;  1HJX A;  3B8S A;  4WKH A;  4W9Q A;  3UQA A;  4MGV A;  5E65 A;  3B9D A;  4DRQ A;  3IKG A;  3OOB A;  2DG3 A;  2Y78 A;  4ODP A;  5AHT A;  2LPV A;  2O9O A;  4URI A;  1LQ0 A;  1LL6 A;  4J4O A;  1JMQ A;  1W9V A;  2XP6 A;  1UR9 A;  1JNE A;  2YBT A;  3O5P A;  3LKX B;  4JFI A;  4S3J A;  3LE4 A;  4DT4 A;  1B6C A;  1LL7 A;  2XP7 A;  1NWR A;  3PQH A;  2PBC A;  3ARQ A;  2PPN A;  1NMV A;  2LGO A;  2XP9 A;  3RFW A;  1HKJ A;  3PRA A;  2A3E A;  1W1P A;  2ZQT A;  1W1T A;  3WD0 A;  2WM0 A;  2F21 A;  5HUA A;  1W26 A;  2DSV A;  1QPL A;  5HWB A;  1FLC A;  4WJX A;  2DK7 A;  3ARW A;  2M8I A;  3H9R B;  3JYM A;  1HKK A;  1C9H A;  4A0U A;  1KT1 A;  2ZQS A;  1NWU A;  2XPA A;  2JXW A;  4E5R A;  1LJY A;  4QZV B;  3KAB A;  4R5E A;  1WMV A;  1J4I A;  2DT2 A;  3WQW A;  3LKX A;  2E45 A;  2MPH A;  2XP4 A;  1E6N A;  3WKZ A;  1K9Q A;  2PPO A;  4U86 A;  1W9P A;  3O5L A;  1TR8 A;  3O5J A;  1H0G A;  3O5D A;  2XPB A;  1ZBK A;  2VCD A;  4Z2K A;  1ITX A;  3B9A A;  2DT3 A;  5DIV A;  3PRD A;  3NI6 A;  2MF9 A;  2DK1 A;  1J4H A;  5J6E A;  2RQS A;  2WAD A;  1GPF A;  2N87 A;  5B8I C;  1K9T A;  2DSW A;  5I98 A;  4HBO A;  1FKL A;  2PV3 A;  4LGX A;  4TW8 A;  3G6L A;  4Q7N A;  1OGG A;  1NWS A;  5HKG A;  1Q6H A;  3WD1 A;  4IT4 A;  1EHN A;  4ODL A;  1BKF A;  3AQU A;  1FFQ A;  3ARO A;  2ZAJ A;  1ZB5 A;  2ZR5 A;  3NRK A;  3KAH A;  4MTV A;  4W9P A;  1HKM A;  1ZBV A;  2Y8N B;  1RD6 A;  4IPX A;  5GPR A;  1NSG A;  1J4R A;  3RME A;  1JNS A;  5GQB A;  4ITZ A;  1FKG A;  4WK9 A;  4TYO A;  1XRV A;  2JMF A;  1ZCN A;  2FAP A;  2O92 A;  3B9E A;  3UF8 A;  4DRN A;  1O6W A;  4P8W A;  1R9H A;  2A3C A;  2JV4 A;  3FXY A;  3MQG A;  1FKD A;  5DO2 A;  3ARP A;  2IF4 A;  3ARR A;  2OLH A;  1YW5 A;  1UR8 A;  3ARV A;  4BF8 A;  2XP3 A;  3LUO A;  3WD2 A;  2LJ4 A;  1XHG A;  1D7H A;  1ZU8 A;  3RM8 A;  4IT6 A;  4W5U A;  2RSE A;  1U79 A;  4L3N A;  5U47 A;  4WKA A;  1F8A B;  3TC5 A;  4ODM A;  3CNG A;  5E5W A;  4QT2 A;  4ODO A;  4P8U A;  2YSH A;  3O5R A;  3O5K A;  1HXV A;  1JVW A;  2A3B A;  2VN1 A;  4HBE A;  2AOS A;  5DIU A;  3MDY B;  3O5M A;  1ROU A;  1E6P A;  4TW6 A;  3OA5 A;  4P8X A;  2BA1 A;  5DEZ A;  3PR9 A;  3WIJ A;  1SR0 A;  1FAP A;  4LAX A;  2OFN A;  1N1A A;  1ZBW A;  2DT0 A;  1FKJ A;  4JFJ A;  1VF8 A;  4ODK A;  4DRK A;  1WB0 A;  2KI3 A;  1O6I A;  2AWG A;  3UI4 A;  5HW6 A;  3WD4 A;  1LG2 A;  3M7N A;  2WK2 A;  5JH8 A;  1ZBC A;  4S3K A;  1KT0 A;  3CGM A;  5E64 A;  1FKR A;  4U85 A;  1EG4 A;  5CQ2 A;  2ZR6 A;  3AS1 A;  4NSB A;  2RUC A;  2ZQU A;  3ART A;  1QZ2 A;  1WAW A;  4DRP A;  4DWS A;  4KQZ A;  4ODR A;  1D7J A;  3CHE A;  3FAP A;  4W9O A;  4MNK A;  1K9R A;  2LAJ A;  2YSG A;  3AS2 A;  3AS0 A;  3IKD A;  2EZ5 W;  4QIB A;  3RM9 A;  3FSC A;  1W1V A;  1F40 A;  2FKE A;  2KE0 A;  1A7X A;  1FKI A;  2MLZ A;  2MLY A;  1HJW A;  3G6M A;  4AY1 A;  4G2P A;  4DRI A;  2KR7 A;  1W9U A;  3WD3 A;  3KCE A;  3WL1 A;  5BXJ A;  3WQV A;  1Q1C A;  2KGJ A;  1LL4 A;  3ARS A;  1FJD A;  1I5H W;  4GGQ A;  1ROT A;  1FKS A;  2RE3 A;  2PPP A;  1PIN A;  1TCO C;  3KAD A;  4FN2 A;  1Q6U A;  4MNJ A;  4R0X A;  2LKN A;  1FKH A;  4Q22 A;  4DRM A;  2MLX A;  5HW8 A;  3QOK A;  4Z2L A;  2ZQV A;  4NNR A;  1D7I A;  1NMW A;  3VAW A;  2PV1 A;  4LAY A;  2FDM A;  1EDQ A;  2QF8 A;  4JFK A;  1GUV A;  1Q6I A;  4ZPW R;  2DG9 A;  1PBK A;  1NH6 A;  3AS3 A;  1JNT A;  4ODQ A;  4DRO A;  1TFV A;  3UI5 A;  1E6R A;  4A0T A;  2ZR4 A;  4Z2I A;  1SYT A;  1ZL1 A;  1KFW A;  5DF0 A;  5HWC A;  3W4R A;  3MCB B;  3KAC A;  3JXV A;  4DH0 A;  2L4J A;  3UQI A;  5E66 A;  3JYJ A;  1FKB A;  4WIW A;  5HW7 A;  3WL0 A;  4DWS C;  1BL4 A;  1LG1 A;  2KO7 A;  2JX8 A;  3CHF A;  3RGC A;  4IQ2 A;  1WR7 A;  1D6O A;  5D75 A;  4C02 B;  2F2D A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...