4A0TA

Structure of the carboxy-terminal domain of bacteriophage t7 fibre gp17 containing residues 371-553.
Total Genus 44
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
44
sequence length
184
structure length
184
Chain Sequence
MGHVLQLESASDKAHYILSKDGNRNNWYIGRGSDNNNDCTFHSYVHGTTLTLKQDYAVVNKHFHVGQAVVATDGNIQGTKWGGKWLDAYLRDSFVAKSKAWTQVWSGSAGGGVSVTVSQDLRFRNIWIKCANNSWNFFRTGPDGIYFIASDGGWLRFQIHSNGLGFKNIADSRSVPNAIMVENE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords TAIL FIBER PROTEIN
publication title Structure of the receptor-binding carboxy-terminal domain of bacteriophage T7 tail fibers.
pubmed doi rcsb
source organism Enterobacteria phage t7
molecule tags Viral protein
total genus 44
structure length 184
sequence length 184
chains with identical sequence B, C
ec nomenclature
pdb deposition date 2011-09-12
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.20.70.120 Mainly Beta Single Sheet Ubiquitin Ligase Nedd4; Chain: W; Ubiquitin Ligase Nedd4; Chain: W; 4a0tA02
2.20.220.30 Mainly Beta Single Sheet Glycosyl hydrolase fold Glycosyl hydrolase fold 4a0tA01
2.60.320.30 Mainly Beta Sandwich mini-chromosome maintenance (MCM) complex, domain 2 mini-chromosome maintenance (MCM) complex, domain 2 4a0tA03
4A0TA 4A0UA
chains in the Genus database with same CATH superfamily
4QIBA 3TC5A 4U85A 2YQ2A 2E45A 4GLXA 4OBIA 2ZQTA 2GDVA 3LD7A 2YSIA 2ZR6A 2XP3A 2L4JA 2YSGA 2YSBA 5U47A 3L4HA 4A0UA 2YSFA 1M1HA 1EG4A 1NPPA 2F21A 3KAIA 3MCBB 4E5RA 2EZ5W 1FLCA 5E5WA 2JX8A 5E65A 1I5HW 2JXWA 3TCZA 2DK7A 1M1GA 2XP6A 2MDIA 2XPAA 3ODKA 3WITA 5E62A 1NMVA 2KPPA 5E66A 2M8JA 1K9RA 1EG3A 3KAHA 3MCBA 1K9QA 1WMVA 2DMVA 2ZQVA 3KCEA 3LE4A 4A0TA 5AHTA 1WR7A 2YAJB 4ESNA 1O6WA 5C8BB 3CNGA 2BA1A 1TK7A 3TDBA 1NPRA 2XP8A 2XP4A 3FSBA 3M7NA 4U86A 1TR8A 3KAFA 4REXA 3OOBA 2RE3A 1RP5A 5CQ2A 2XP9A 2WAEA 3FSCA 2M8IA 2YSHA 1PINA 1R7AA 1JMQA 3PQHA 2WADA 2DK1A 2DWVA 3LKXB 2Q5AA 2ZQSA 2JMFA 2ZQUA 3M85A 2XP5A 2M3OW 1F8AB 2QRVA 2DJYA 2LAJA 4U84A 5E64A 2ZR4A 3KABA 3FS8A 2XP7A 2ITKA 3LKXA 1YW5A 3KAGA 2OWOA 3MQHA 3KADA 3MQGA 2GDUA 3NTPA 2XPBA 3WH0A 2Y8NB 1ZCNA 2JV4A 2KXQA 2ZAJA 2ZR5A
chains in the Genus database with same CATH topology
4QIBA 3TC5A 4U85A 2YQ2A 2E45A 4GLXA 2ZQTA 2YSIA 2ZR6A 2XP3A 2L4JA 2YSGA 2YSBA 5U47A 3L4HA 4A0UA 2YSFA 1EG4A 2F21A 3KAIA 3MCBB 4E5RA 2EZ5W 1FLCA 5E5WA 2JX8A 5E65A 1I5HW 2JXWA 3TCZA 2DK7A 2XP6A 2MDIA 2XPAA 3ODKA 3WITA 5E62A 1NMVA 5E66A 2M8JA 1K9RA 1EG3A 3KAHA 3MCBA 1K9QA 1WMVA 2DMVA 2ZQVA 3KCEA 3LE4A 4A0TA 5AHTA 1WR7A 2YAJB 1O6WA 3CNGA 2BA1A 1TK7A 3TDBA 2XP8A 2XP4A 3FSBA 3M7NA 4U86A 1TR8A 3KAFA 4REXA 3OOBA 2RE3A 1RP5A 5CQ2A 2XP9A 2WAEA 3FSCA 2M8IA 2YSHA 1PINA 1JMQA 3PQHA 2WADA 2DK1A 2DWVA 3LKXB 2Q5AA 2ZQSA 2JMFA 2ZQUA 3M85A 2XP5A 2M3OW 1F8AB 2QRVA 2DJYA 2LAJA 4U84A 5E64A 2ZR4A 3KABA 3FS8A 2XP7A 2ITKA 3LKXA 1YW5A 3KAGA 2OWOA 3MQHA 3KADA 3MQGA 3NTPA 2XPBA 3WH0A 2Y8NB 1ZCNA 2JV4A 2KXQA 2ZAJA 2ZR5A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4A0T A;  4A0U A; 
#chains in the Genus database with same CATH topology
 4QIB A;  3TC5 A;  4U85 A;  2YQ2 A;  2E45 A;  4GLX A;  4OBI A;  2ZQT A;  2GDV A;  3LD7 A;  2YSI A;  2ZR6 A;  2XP3 A;  2L4J A;  2YSG A;  2YSB A;  5U47 A;  3L4H A;  4A0U A;  2YSF A;  1M1H A;  1EG4 A;  1NPP A;  2F21 A;  3KAI A;  3MCB B;  4E5R A;  2EZ5 W;  1FLC A;  5E5W A;  2JX8 A;  5E65 A;  1I5H W;  2JXW A;  3TCZ A;  2DK7 A;  1M1G A;  2XP6 A;  2MDI A;  2XPA A;  3ODK A;  3WIT A;  5E62 A;  1NMV A;  2KPP A;  5E66 A;  2M8J A;  1K9R A;  1EG3 A;  3KAH A;  3MCB A;  1K9Q A;  1WMV A;  2DMV A;  2ZQV A;  3KCE A;  3LE4 A;  4A0T A;  5AHT A;  1WR7 A;  2YAJ B;  4ESN A;  1O6W A;  5C8B B;  3CNG A;  2BA1 A;  1TK7 A;  3TDB A;  1NPR A;  2XP8 A;  2XP4 A;  3FSB A;  3M7N A;  4U86 A;  1TR8 A;  3KAF A;  4REX A;  3OOB A;  2RE3 A;  1RP5 A;  5CQ2 A;  2XP9 A;  2WAE A;  3FSC A;  2M8I A;  2YSH A;  1PIN A;  1R7A A;  1JMQ A;  3PQH A;  2WAD A;  2DK1 A;  2DWV A;  3LKX B;  2Q5A A;  2ZQS A;  2JMF A;  2ZQU A;  3M85 A;  2XP5 A;  2M3O W;  1F8A B;  2QRV A;  2DJY A;  2LAJ A;  4U84 A;  5E64 A;  2ZR4 A;  3KAB A;  3FS8 A;  2XP7 A;  2ITK A;  3LKX A;  1YW5 A;  3KAG A;  2OWO A;  3MQH A;  3KAD A;  3MQG A;  2GDU A;  3NTP A;  2XPB A;  3WH0 A;  2Y8N B;  1ZCN A;  2JV4 A;  2KXQ A;  2ZAJ A;  2ZR5 A; 
#chains in the Genus database with same CATH homology
 4QIB A;  3TC5 A;  4U85 A;  2YQ2 A;  2E45 A;  4GLX A;  2ZQT A;  2YSI A;  2ZR6 A;  2XP3 A;  2L4J A;  2YSG A;  2YSB A;  5U47 A;  3L4H A;  4A0U A;  2YSF A;  1EG4 A;  2F21 A;  3KAI A;  3MCB B;  4E5R A;  2EZ5 W;  1FLC A;  5E5W A;  2JX8 A;  5E65 A;  1I5H W;  2JXW A;  3TCZ A;  2DK7 A;  2XP6 A;  2MDI A;  2XPA A;  3ODK A;  3WIT A;  5E62 A;  1NMV A;  5E66 A;  2M8J A;  1K9R A;  1EG3 A;  3KAH A;  3MCB A;  1K9Q A;  1WMV A;  2DMV A;  2ZQV A;  3KCE A;  3LE4 A;  4A0T A;  5AHT A;  1WR7 A;  2YAJ B;  1O6W A;  3CNG A;  2BA1 A;  1TK7 A;  3TDB A;  2XP8 A;  2XP4 A;  3FSB A;  3M7N A;  4U86 A;  1TR8 A;  3KAF A;  4REX A;  3OOB A;  2RE3 A;  1RP5 A;  5CQ2 A;  2XP9 A;  2WAE A;  3FSC A;  2M8I A;  2YSH A;  1PIN A;  1JMQ A;  3PQH A;  2WAD A;  2DK1 A;  2DWV A;  3LKX B;  2Q5A A;  2ZQS A;  2JMF A;  2ZQU A;  3M85 A;  2XP5 A;  2M3O W;  1F8A B;  2QRV A;  2DJY A;  2LAJ A;  4U84 A;  5E64 A;  2ZR4 A;  3KAB A;  3FS8 A;  2XP7 A;  2ITK A;  3LKX A;  1YW5 A;  3KAG A;  2OWO A;  3MQH A;  3KAD A;  3MQG A;  3NTP A;  2XPB A;  3WH0 A;  2Y8N B;  1ZCN A;  2JV4 A;  2KXQ A;  2ZAJ A;  2ZR5 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...