2XP6A

Discovery of cell-active phenyl-imidazole pin1 inhibitors by structure-guided fragment evolution
Total Genus 45
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
45
sequence length
157
structure length
145
Chain Sequence
LPPGWEKAMSRSSGRVYYFNHITNASQWERPSEPARVRCSHLLVKHSQSRRPSSWRQEKITRTKEEALELINGYIQKIKSGEEDFESLASQFSDCSSAKARGDLGAFSRGQMAKPFEDASFALRTGEMSGPVFTDSGIHIILRTE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PEPTIDYL-PROLYL CIS-TRANS ISOMERASE NIMA-INTERACTING 1
publication title Discovery of Cell-Active Phenyl-Imidazole Pin1 Inhibitors by Structure-Guided Fragment Evolution.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Isomerase
total genus 45
structure length 145
sequence length 157
ec nomenclature ec 5.2.1.8: Peptidylprolyl isomerase.
pdb deposition date 2010-08-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00397 WW WW domain
A PF00639 Rotamase PPIC-type PPIASE domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.20.70.10 Mainly Beta Single Sheet Ubiquitin Ligase Nedd4; Chain: W; Ubiquitin Ligase Nedd4; Chain: W; 2xp6A01
3.10.50.40 Alpha Beta Roll Chitinase A; domain 3 Chitinase A; domain 3 2xp6A02
4R0XA 2N87A 2M3OW 3RFWA 3O5LA 3JXVA 1YATA 2JXWA 2RUCA 1JMQA 1FAPA 3O5QA 1T11A 3VAWA 2RE3A 5J6EA 1FKLA 2YSIA 2OFNA 1JNSA 2JX8A 1EG4A 3UI6A 5DIVA 1HXVA 3CNGA 2ZR6A 1JNTA 4DRMA 4LAWA 2LKNA 5HT1A 4TNSA 1QPFA 3O5EA 1BL4A 4U85A 1L1PA 2ZQSA 4JFIA 4TW6A 2XPAA 5I98A 4NNRA 2FAPA 3KAGA 4MGVA 4JFMA 1M5YA 1FKIA 2KR7A 3UF8A 3O5RA 4IQCA 4BF8A 1PBKA 3JYJA 1FKGA 4QT2A 2Y78A 2JMFA 2DMVA 1Q6UA 4DRKA 5DIUA 2LPVA 4DT4A 3WH0A 1F40A 3O5IA 3KACA 1FD9A 1WMVA 4TYOA 5DITA 1FKDA 1K9RA 2YSHA 4ODQA 4DH0A 1D7IA 1N1AA 2DJYA 4JFLA 4J4NA 5HW7A 2PV2A 3PRDA 2VN1A 3PRBA 1J4RA 4MSPA 1PINA 3M7NA 2XP7A 2DG4A 1FKRA 1NMWA 4U84A 1FKFA 2ZR5A 3M85A 2ZAJA 4DRIA 4DRHA 2VCDA 2M8JA 3UI4A 2ZQTA 2KXQA 2LJ4A 4GGQA 2MLYA 1ROUA 2DK7A 1W26A 4REXA 3JYMA 5B8IC 4E5RA 2DG3A 1Q1CA 3PA7A 2L4JA 3TDBA 3OOBA 1WR7A 4DZ3A 4ODPA 2PPNA 3KCEA 5HWCA 2M1IA 4ODNA 1K9QA 1I5HW 3I6CA 2XP3A 1D6OA 4J4OA 4GIVA 1EG3A 4DZ2A 2XP4A 3KAFA 5HW6A 2BA1A 3O5MA 2ITKA 3O5KA 3NTPA 4FAPA 1J6YA 2XP5A 4JFKA 2DG9A 2F4EA 3KABA 2MLXA 2PV1A 2XPBA 5CQ2A 3ODKA 1FKSA 2M08A 1TK7A 2PV3A 5HTGA 3NRKA 4DIPA 4TX0A 4C02B 1QZ2A 4U86A 3LE4A 2KO7A 2F21A 2F2DA 2AWGA 2K8IA 4N19A 3TC5A 2Q5AA 1JVWA 3RGCA 1D7HA 3O5DA 4G50A 5GPGA 2MNTA 3LUOA 1FJDA 3UQAA 2YSFA 3UQBA 1YW5A 4DRJA 3MDYB 2YSBA 5HWBA 3FAPA 3IKDA 1TCOC 3UQIA 3IHZA 2KGJA 2RSEA 3O5FA 4ODKA 5HKGA 2ZQVA 1FKKA 1R9HA 3UI5A 3B7XA 3O5JA 1F8AB 2M8IA 2UZ5A 1NSGA 4ODLA 4DROA 2PBCA 4FN2A 2MF9A 2PPOA 1B6CA 1ZCNA 4QIBA 1BKFA 1NMVA 4LAXA 4DRQA 2MLZA 2MDIA 3KADA 2XP6A 2JV4A 5BXJA 3O5PA 4ODRA 1A7XA 1D7JA 4DRNA 3KAIA 2E45A 2JZVA 2FKEA 2XP9A 1Y0OA 3KAHA 4JFJA 2PPPA 5D75A 3IK8A 4W9QA 1KT1A 1Q6IA 1QPLA 3H9RB 2MPHA 3KZ7A 1ZK6A 5AHTA 2ZR4A 2EZ5W 2YSGA 1FKTA 1J4IA 4ODOA 1J4HA 2RUQA 4DRPA 4JYSA 2DWVA 3O5OA 5HW8A 2L2SA 3NI6A 2KI3A 3IKGA 4O2TA 4W9PA 5HUAA 3CGNA 1FKJA 3EY6A 4IPXA 2LGOA 1KT0A 1EQ3A 1EYMA 1FKHA 4TW8A 4QT3A 1ROTA 4ITZA 2RUDA 3GPKA 2IF4A 4TW7A 1C9HA 2LAJA 4LAVA 4W9OA 1U79A 3TCZA 1FKBA 4IQ2A 2M2AA 1O6WA 1Q6HA 3L4HA 2D9FA 2RQSA 1P5QA 2KFWA 2ZQUA 2KE0A 4ODMA 3CGMA 3O5GA 2DK1A 2XP8A 2RURA 4LAYA 4G2PA
chains in the Genus database with same CATH superfamily
4R0XA 2N87A 1LJYA 2M3OW 3RFWA 3O5LA 3JXVA 1YATA 2JXWA 2RUCA 1JMQA 2WLYA 4HBEA 4Q7NA 1FAPA 3WD2A 2PN0A 3O5QA 1T11A 3VAWA 2RE3A 5J6EA 1X6NA 1FKLA 2YSIA 3ARVA 1H0GA 3B8SA 1JNEA 2OFNA 1JNSA 2JX8A 1EG4A 1KFWA 3UI6A 5DIVA 1HXVA 3CNGA 2ZR6A 2WLZA 1JNTA 4DRMA 4ZPTR 2Y8NB 2OWOA 3CH9A 4LAWA 2LKNA 3BMBA 3WD3A 3QOKA 5HT1A 4TNSA 3PRAA 1QPFA 3O5EA 1ZB5A 1BL4A 4U85A 5E64A 1L1PA 2ZQSA 4JFIA 1E9LA 3WD0A 4PTMA 3ARZA 4TW6A 2XPAA 2AOSA 3ARPA 5I98A 4NNRA 2FAPA 2DSUA 3KAGA 4MGVA 4JFMA 4NZCA 1TR8A 3W4RA 1M5YA 1FKIA 3WQWA 2KR7A 1ZBWA 3UF8A 3O5RA 4IQCA 4BF8A 1PBKA 1W9VA 3JYJA 3BXWA 1FKGA 5HBFA 4QT2A 2Y78A 2JMFA 2DMVA 1Q6UA 4S3KA 3WD4A 2DT0A 1W1YA 1ZU8A 4DRKA 2DPEA 5DIUA 2LPVA 4DT4A 3WH0A 1HKMA 4P8WA 1H0IA 4WKHA 1F40A 3O5IA 3KACA 1FD9A 1LG1A 1WMVA 3GU0A 3ARSA 4TYOA 5DITA 1FKDA 1K9RA 2YSHA 4ODQA 4WKAA 4R5EA 2OLHA 4DH0A 1RD6A 1VF8A 1LL4A 1D7IA 3MCBB 1N1AA 2DJYA 4JFLA 4MNMA 4IT4A 3RM4A 4J4NA 5HW7A 1W1TA 2WM0A 2PV2A 3ALFA 1HKJA 1WB0A 1XHGA 3PRDA 4A0TA 1GRJA 2B5UB 2VN1A 3PRBA 1J4RA 1ZBCA 4GLXA 4Z2KA 4MSPA 1PINA 3M7NA 2XP7A 3AROA 2DG4A 4S3JA 2YBTA 1FKRA 1LG2A 1NMWA 4Z2LA 4U84A 4UDMA 1FKFA 2ZR5A 3M85A 4WK9A 2ZAJA 4DRIA 4DRHA 2VCDA 2M8JA 3UI4A 2ZQTA 1JNDA 2KXQA 2LJ4A 4GGQA 2MLYA 1ROUA 3ALGA 3B9EA 2DK7A 1EIBA 1W26A 4AY1A 4REXA 3JYMA 5B8IC 3PQHA 1ITXA 3ARUA 4E5RA 2DG3A 1Q1CA 3PA7A 2L4JA 5E62A 3TDBA 3OOBA 3LKXB 1EDQA 3G6MA 4ZPWR 1WR7A 4DZ3A 4ODPA 1W1VA 2PPNA 3KCEA 5HWCA 2WADA 4MNJA 1ZL1A 2A3BA 3AS3A 1FLCA 2M1IA 4ODNA 1K9QA 1I5HW 1D2KA 3I6CA 2XP3A 1D6OA 2YAJB 1XRVA 4J4OA 4GIVA 1EG3A 1E6ZA 2DT1A 4DZ2A 2DT3A 1OGBA 2XP4A 3WD1A 3KAFA 3OA5A 1WNOA 1W9PA 5HW6A 1W1PA 2BA1A 3O5MA 2ITKA 3O5KA 3NTPA 4FAPA 1J6YA 3CHFA 3ARQA 2XP5A 1E44A 4JFKA 2DG9A 2A3CA 4MNKA 5DEZA 2F4EA 3KABA 2MLXA 4WJXA 2PV1A 3CZ8A 2XPBA 5CQ2A 3ODKA 1FKSA 3FXYA 2M08A 1TK7A 2PV3A 5HTGA 3PR9A 3NRKA 4DIPA 4TX0A 4C02B 1CTNA 5U47A 2IUZA 4KQZA 1QZ2A 1GPFA 4U86A 3LE4A 2KO7A 2DT2A 2F21A 3WIJA 2F2DA 2AWGA 3AQUA 3MQGA 2K8IA 4N19A 3TC5A 2Q5AA 1JVWA 3WQVA 1ZBKA 3EIPA 3RGCA 1D7HA 3O5DA 4G50A 4DWSA 5GPGA 2O9OA 2MNTA 1NWRA 3LUOA 1FJDA 1O6IA 1UR8A 3UQAA 2YSFA 3UQBA 1YW5A 4DRJA 1RP5A 3MDYB 2YSBA 5HWBA 3FAPA 3IKDA 1TCOC 1LL7A 3IHZA 3UQIA 2KGJA 1W9UA 2RSEA 3O5FA 4ODKA 4MTVA 3WKZA 5HKGA 2ZQVA 3FY1A 1FKKA 5JH8A 1FFQA 4P8UA 1R9HA 1E6RA 1IX5A 3FS8A 3UI5A 3B7XA 1UR9A 3O5JA 1F8AB 2M8IA 2UZ5A 1NWTA 1NSGA 4ODLA 4DROA 2PBCA 1SR0A 4FN2A 2MF9A 2PPOA 1B6CA 4KR0B 4MNLA 4NSBA 1ZCNA 2A3AA 1HJWA 4QIBA 1BKFA 5DO2A 2WAEA 1NMVA 4LAXA 5DF0A 3RMEA 4A0UA 4DRQA 2WK2A 5GPRA 2MLZA 2DSZA 2MDIA 3KADA 4ML4A 2XP6A 2B31A 2JV4A 1EHNA 4IT6A 5BXJA 3O5PA 1NWUA 4ODRA 1A7XA 1D7JA 2G41A 4WIWA 4DRNA 3KAIA 1GUVA 2E45A 2JZVA 2FKEA 2XP9A 1Y0OA 1NH6A 3KAHA 4JFJA 4DWSC 2F23A 3GTYX 2DSVA 3AS1A 2PPPA 5D75A 3IK8A 4LGXA 4W9QA 1KT1A 1HJVA 1Q6IA 3ARWA 1QPLA 2P4VA 5GQBA 3H9RB 4MAVA 2ESCA 2MPHA 3KZ7A 3WL1A 4W5UA 1ZK6A 5AHTA 4URIA 2ZR4A 2EZ5W 1HKIA 4ZPVR 3RM8A 2YSGA 1FKTA 4L72B 1J4IA 1J4HA 2RUQA 1HKKA 4ODOA 4DRPA 4JYSA 2DWVA 3O5OA 5HW8A 2L2SA 3NI6A 2KI3A 3IKGA 4QZVB 4O2TA 4W9PA 5E65A 5HUAA 3MCBA 4Z2HA 2ETNA 2G8ZA 1ZBVA 3CHCA 3RM9A 3ARXA 3CGNA 1HJXA 4HARA 2EULA 1FKJA 2YBUA 3ARTA 1LQ0A 2LGOA 1WAWA 1KT0A 3EY6A 4IPXA 1GOIA 4P8VA 3MQHA 1E6NA 3B9AA 2O92A 1EQ3A 1EYMA 1FKHA 1X6LA 4TW8A 4QT3A 1ROTA 5E5WA 1OWQA 4ITZA 2RUDA 3GPKA 2FDMA 2IF4A 1FFRA 3FSCA 2A3EA 4P8XA 3ARRA 1LL6A 4TW7A 3WL0A 1JCHB 1C9HA 3AS2A 3FSBA 1SYTA 4HBOA 4ZS6A 3ARYA 2LAJA 2DSWA 4LAVA 4Z2IA 4DWSD 5E66A 4W9OA 1U79A 1K9TA 1TFVA 3TCZA 1FKBA 4IQ2A 2M2AA 1E15A 1O6WA 4MPKA 1Q6HA 3L4HA 2QRVA 3B9DA 3AS0A 2D9FA 4Z2JA 2RQSA 4XAKA 4WKFA 1NWSA 1P5QA 2KFWA 3CHEA 4Z2GA 3LKXA 3G6LA 2ZQUA 2KE0A 2PI6A 4ODMA 3CGMA 3O5GA 2DK1A 2XP8A 4L3NA 2RURA 4LAYA 4Q22A 2QF8A 3CHDA 4DWSB 1OGGA 4G2PA 1E6PA
chains in the Genus database with same CATH topology
4R0XA 2N87A 1LJYA 2M3OW 3RFWA 3O5LA 3JXVA 1YATA 2JXWA 2RUCA 1JMQA 2WLYA 4HBEA 4Q7NA 1FAPA 3WD2A 3O5QA 1T11A 3VAWA 2RE3A 5J6EA 1X6NA 1FKLA 2YSIA 3ARVA 1H0GA 3B8SA 1JNEA 2OFNA 1JNSA 2JX8A 1EG4A 1KFWA 3UI6A 5DIVA 1HXVA 3CNGA 2ZR6A 2WLZA 1JNTA 4DRMA 4ZPTR 2Y8NB 2OWOA 3CH9A 4LAWA 2LKNA 3WD3A 3QOKA 5HT1A 4TNSA 3PRAA 1QPFA 3O5EA 1ZB5A 1BL4A 4U85A 5E64A 1L1PA 2ZQSA 4JFIA 1E9LA 3WD0A 4PTMA 3ARZA 4TW6A 2XPAA 2AOSA 3ARPA 5I98A 4NNRA 2FAPA 2DSUA 3KAGA 4MGVA 4JFMA 4NZCA 1TR8A 3W4RA 1M5YA 1FKIA 3WQWA 2KR7A 1ZBWA 3UF8A 3O5RA 4IQCA 4BF8A 1PBKA 1W9VA 3JYJA 3BXWA 1FKGA 5HBFA 4QT2A 2Y78A 2JMFA 2DMVA 1Q6UA 4S3KA 3WD4A 2DT0A 1W1YA 1ZU8A 4DRKA 2DPEA 5DIUA 2LPVA 4DT4A 3WH0A 1HKMA 4P8WA 1H0IA 4WKHA 1F40A 3O5IA 3KACA 1FD9A 1LG1A 1WMVA 3ARSA 4TYOA 5DITA 1FKDA 1K9RA 2YSHA 4ODQA 4WKAA 4R5EA 2OLHA 4DH0A 1RD6A 1VF8A 1LL4A 1D7IA 3MCBB 1N1AA 2DJYA 4JFLA 4MNMA 4IT4A 3RM4A 4J4NA 5HW7A 1W1TA 2WM0A 2PV2A 3ALFA 1HKJA 1WB0A 1XHGA 3PRDA 4A0TA 2VN1A 3PRBA 1J4RA 1ZBCA 4GLXA 4Z2KA 4MSPA 1PINA 3M7NA 2XP7A 3AROA 2DG4A 4S3JA 2YBTA 1FKRA 1LG2A 1NMWA 4Z2LA 4U84A 1FKFA 2ZR5A 3M85A 4WK9A 2ZAJA 4DRIA 4DRHA 2VCDA 2M8JA 3UI4A 2ZQTA 1JNDA 2KXQA 2LJ4A 4GGQA 2MLYA 1ROUA 3ALGA 3B9EA 2DK7A 1EIBA 1W26A 4AY1A 4REXA 3JYMA 5B8IC 3PQHA 1ITXA 3ARUA 4E5RA 2DG3A 1Q1CA 3PA7A 2L4JA 5E62A 3TDBA 3OOBA 3LKXB 1EDQA 3G6MA 4ZPWR 1WR7A 4DZ3A 4ODPA 1W1VA 2PPNA 3KCEA 5HWCA 2WADA 4MNJA 1ZL1A 2A3BA 3AS3A 1FLCA 2M1IA 4ODNA 1K9QA 1I5HW 1D2KA 3I6CA 2XP3A 1D6OA 2YAJB 1XRVA 4J4OA 4GIVA 1EG3A 1E6ZA 2DT1A 4DZ2A 2DT3A 1OGBA 2XP4A 3WD1A 3KAFA 3OA5A 1WNOA 1W9PA 5HW6A 1W1PA 2BA1A 3O5MA 2ITKA 3O5KA 3NTPA 4FAPA 1J6YA 3CHFA 3ARQA 2XP5A 4JFKA 2DG9A 2A3CA 4MNKA 5DEZA 2F4EA 3KABA 2MLXA 4WJXA 2PV1A 3CZ8A 2XPBA 5CQ2A 3ODKA 1FKSA 3FXYA 2M08A 1TK7A 2PV3A 5HTGA 3PR9A 3NRKA 4DIPA 4TX0A 4C02B 1CTNA 5U47A 2IUZA 4KQZA 1QZ2A 1GPFA 4U86A 3LE4A 2KO7A 2DT2A 2F21A 3WIJA 2F2DA 2AWGA 3AQUA 3MQGA 2K8IA 4N19A 3TC5A 2Q5AA 1JVWA 3WQVA 1ZBKA 3RGCA 1D7HA 3O5DA 4G50A 4DWSA 5GPGA 2O9OA 2MNTA 1NWRA 3LUOA 1FJDA 1O6IA 1UR8A 3UQAA 2YSFA 3UQBA 1YW5A 4DRJA 1RP5A 3MDYB 2YSBA 5HWBA 3FAPA 3IKDA 1TCOC 1LL7A 3IHZA 3UQIA 2KGJA 1W9UA 2RSEA 3O5FA 4ODKA 4MTVA 3WKZA 5HKGA 2ZQVA 3FY1A 1FKKA 5JH8A 1FFQA 4P8UA 1R9HA 1E6RA 1IX5A 3FS8A 3UI5A 3B7XA 1UR9A 3O5JA 1F8AB 2M8IA 2UZ5A 1NWTA 1NSGA 4ODLA 4DROA 2PBCA 1SR0A 4FN2A 2MF9A 2PPOA 1B6CA 4KR0B 4MNLA 4NSBA 1ZCNA 2A3AA 1HJWA 4QIBA 1BKFA 5DO2A 2WAEA 1NMVA 4LAXA 5DF0A 3RMEA 4A0UA 4DRQA 2WK2A 5GPRA 2MLZA 2DSZA 2MDIA 3KADA 4ML4A 2XP6A 2B31A 2JV4A 1EHNA 4IT6A 5BXJA 3O5PA 1NWUA 4ODRA 1A7XA 1D7JA 2G41A 4WIWA 4DRNA 3KAIA 1GUVA 2E45A 2JZVA 2FKEA 2XP9A 1Y0OA 1NH6A 3KAHA 4JFJA 4DWSC 2DSVA 3AS1A 2PPPA 5D75A 3IK8A 4LGXA 4W9QA 1KT1A 1HJVA 1Q6IA 3ARWA 1QPLA 5GQBA 3H9RB 4MAVA 2ESCA 2MPHA 3KZ7A 3WL1A 4W5UA 1ZK6A 5AHTA 4URIA 2ZR4A 2EZ5W 1HKIA 4ZPVR 3RM8A 2YSGA 1FKTA 4L72B 1J4IA 1J4HA 2RUQA 1HKKA 4ODOA 4DRPA 4JYSA 2DWVA 3O5OA 5HW8A 2L2SA 3NI6A 2KI3A 3IKGA 4QZVB 4O2TA 4W9PA 5E65A 5HUAA 3MCBA 4Z2HA 2G8ZA 1ZBVA 3CHCA 3RM9A 3ARXA 3CGNA 1HJXA 4HARA 1FKJA 2YBUA 3ARTA 1LQ0A 2LGOA 1WAWA 1KT0A 3EY6A 4IPXA 1GOIA 4P8VA 3MQHA 1E6NA 3B9AA 2O92A 1EQ3A 1EYMA 1FKHA 1X6LA 4TW8A 4QT3A 1ROTA 5E5WA 1OWQA 4ITZA 2RUDA 3GPKA 2FDMA 2IF4A 1FFRA 3FSCA 2A3EA 4P8XA 3ARRA 1LL6A 4TW7A 3WL0A 3AS2A 1C9HA 3FSBA 1SYTA 4HBOA 4ZS6A 3ARYA 2LAJA 2DSWA 4LAVA 4Z2IA 4DWSD 5E66A 4W9OA 1U79A 1K9TA 1TFVA 3TCZA 1FKBA 4IQ2A 2M2AA 1E15A 1O6WA 4MPKA 1Q6HA 3L4HA 2QRVA 3B9DA 3AS0A 2D9FA 4Z2JA 2RQSA 4XAKA 4WKFA 1NWSA 1P5QA 2KFWA 3CHEA 4Z2GA 3LKXA 3G6LA 2ZQUA 2KE0A 2PI6A 4ODMA 3CGMA 3O5GA 2DK1A 2XP8A 4L3NA 2RURA 4LAYA 4Q22A 2QF8A 3CHDA 4DWSB 1OGGA 4G2PA 1E6PA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4R0X A;  2N87 A;  2M3O W;  3RFW A;  3O5L A;  3JXV A;  1YAT A;  2JXW A;  2RUC A;  1JMQ A;  1FAP A;  3O5Q A;  1T11 A;  3VAW A;  2RE3 A;  5J6E A;  1FKL A;  2YSI A;  2OFN A;  1JNS A;  2JX8 A;  1EG4 A;  3UI6 A;  5DIV A;  1HXV A;  3CNG A;  2ZR6 A;  1JNT A;  4DRM A;  4LAW A;  2LKN A;  5HT1 A;  4TNS A;  1QPF A;  3O5E A;  1BL4 A;  4U85 A;  1L1P A;  2ZQS A;  4JFI A;  4TW6 A;  2XPA A;  5I98 A;  4NNR A;  2FAP A;  3KAG A;  4MGV A;  4JFM A;  1M5Y A;  1FKI A;  2KR7 A;  3UF8 A;  3O5R A;  4IQC A;  4BF8 A;  1PBK A;  3JYJ A;  1FKG A;  4QT2 A;  2Y78 A;  2JMF A;  2DMV A;  1Q6U A;  4DRK A;  5DIU A;  2LPV A;  4DT4 A;  3WH0 A;  1F40 A;  3O5I A;  3KAC A;  1FD9 A;  1WMV A;  4TYO A;  5DIT A;  1FKD A;  1K9R A;  2YSH A;  4ODQ A;  4DH0 A;  1D7I A;  1N1A A;  2DJY A;  4JFL A;  4J4N A;  5HW7 A;  2PV2 A;  3PRD A;  2VN1 A;  3PRB A;  1J4R A;  4MSP A;  1PIN A;  3M7N A;  2XP7 A;  2DG4 A;  1FKR A;  1NMW A;  4U84 A;  1FKF A;  2ZR5 A;  3M85 A;  2ZAJ A;  4DRI A;  4DRH A;  2VCD A;  2M8J A;  3UI4 A;  2ZQT A;  2KXQ A;  2LJ4 A;  4GGQ A;  2MLY A;  1ROU A;  2DK7 A;  1W26 A;  4REX A;  3JYM A;  5B8I C;  4E5R A;  2DG3 A;  1Q1C A;  3PA7 A;  2L4J A;  3TDB A;  3OOB A;  1WR7 A;  4DZ3 A;  4ODP A;  2PPN A;  3KCE A;  5HWC A;  2M1I A;  4ODN A;  1K9Q A;  1I5H W;  3I6C A;  2XP3 A;  1D6O A;  4J4O A;  4GIV A;  1EG3 A;  4DZ2 A;  2XP4 A;  3KAF A;  5HW6 A;  2BA1 A;  3O5M A;  2ITK A;  3O5K A;  3NTP A;  4FAP A;  1J6Y A;  2XP5 A;  4JFK A;  2DG9 A;  2F4E A;  3KAB A;  2MLX A;  2PV1 A;  2XPB A;  5CQ2 A;  3ODK A;  1FKS A;  2M08 A;  1TK7 A;  2PV3 A;  5HTG A;  3NRK A;  4DIP A;  4TX0 A;  4C02 B;  1QZ2 A;  4U86 A;  3LE4 A;  2KO7 A;  2F21 A;  2F2D A;  2AWG A;  2K8I A;  4N19 A;  3TC5 A;  2Q5A A;  1JVW A;  3RGC A;  1D7H A;  3O5D A;  4G50 A;  5GPG A;  2MNT A;  3LUO A;  1FJD A;  3UQA A;  2YSF A;  3UQB A;  1YW5 A;  4DRJ A;  3MDY B;  2YSB A;  5HWB A;  3FAP A;  3IKD A;  1TCO C;  3UQI A;  3IHZ A;  2KGJ A;  2RSE A;  3O5F A;  4ODK A;  5HKG A;  2ZQV A;  1FKK A;  1R9H A;  3UI5 A;  3B7X A;  3O5J A;  1F8A B;  2M8I A;  2UZ5 A;  1NSG A;  4ODL A;  4DRO A;  2PBC A;  4FN2 A;  2MF9 A;  2PPO A;  1B6C A;  1ZCN A;  4QIB A;  1BKF A;  1NMV A;  4LAX A;  4DRQ A;  2MLZ A;  2MDI A;  3KAD A;  2XP6 A;  2JV4 A;  5BXJ A;  3O5P A;  4ODR A;  1A7X A;  1D7J A;  4DRN A;  3KAI A;  2E45 A;  2JZV A;  2FKE A;  2XP9 A;  1Y0O A;  3KAH A;  4JFJ A;  2PPP A;  5D75 A;  3IK8 A;  4W9Q A;  1KT1 A;  1Q6I A;  1QPL A;  3H9R B;  2MPH A;  3KZ7 A;  1ZK6 A;  5AHT A;  2ZR4 A;  2EZ5 W;  2YSG A;  1FKT A;  1J4I A;  4ODO A;  1J4H A;  2RUQ A;  4DRP A;  4JYS A;  2DWV A;  3O5O A;  5HW8 A;  2L2S A;  3NI6 A;  2KI3 A;  3IKG A;  4O2T A;  4W9P A;  5HUA A;  3CGN A;  1FKJ A;  3EY6 A;  4IPX A;  2LGO A;  1KT0 A;  1EQ3 A;  1EYM A;  1FKH A;  4TW8 A;  4QT3 A;  1ROT A;  4ITZ A;  2RUD A;  3GPK A;  2IF4 A;  4TW7 A;  1C9H A;  2LAJ A;  4LAV A;  4W9O A;  1U79 A;  3TCZ A;  1FKB A;  4IQ2 A;  2M2A A;  1O6W A;  1Q6H A;  3L4H A;  2D9F A;  2RQS A;  1P5Q A;  2KFW A;  2ZQU A;  2KE0 A;  4ODM A;  3CGM A;  3O5G A;  2DK1 A;  2XP8 A;  2RUR A;  4LAY A;  4G2P A; 
#chains in the Genus database with same CATH topology
 4R0X A;  2N87 A;  1LJY A;  2M3O W;  3RFW A;  3O5L A;  3JXV A;  1YAT A;  2JXW A;  2RUC A;  1JMQ A;  2WLY A;  4HBE A;  4Q7N A;  1FAP A;  3WD2 A;  2PN0 A;  3O5Q A;  1T11 A;  3VAW A;  2RE3 A;  5J6E A;  1X6N A;  1FKL A;  2YSI A;  3ARV A;  1H0G A;  3B8S A;  1JNE A;  2OFN A;  1JNS A;  2JX8 A;  1EG4 A;  1KFW A;  3UI6 A;  5DIV A;  1HXV A;  3CNG A;  2ZR6 A;  2WLZ A;  1JNT A;  4DRM A;  4ZPT R;  2Y8N B;  2OWO A;  3CH9 A;  4LAW A;  2LKN A;  3BMB A;  3WD3 A;  3QOK A;  5HT1 A;  4TNS A;  3PRA A;  1QPF A;  3O5E A;  1ZB5 A;  1BL4 A;  4U85 A;  5E64 A;  1L1P A;  2ZQS A;  4JFI A;  1E9L A;  3WD0 A;  4PTM A;  3ARZ A;  4TW6 A;  2XPA A;  2AOS A;  3ARP A;  5I98 A;  4NNR A;  2FAP A;  2DSU A;  3KAG A;  4MGV A;  4JFM A;  4NZC A;  1TR8 A;  3W4R A;  1M5Y A;  1FKI A;  3WQW A;  2KR7 A;  1ZBW A;  3UF8 A;  3O5R A;  4IQC A;  4BF8 A;  1PBK A;  1W9V A;  3JYJ A;  3BXW A;  1FKG A;  5HBF A;  4QT2 A;  2Y78 A;  2JMF A;  2DMV A;  1Q6U A;  4S3K A;  3WD4 A;  2DT0 A;  1W1Y A;  1ZU8 A;  4DRK A;  2DPE A;  5DIU A;  2LPV A;  4DT4 A;  3WH0 A;  1HKM A;  4P8W A;  1H0I A;  4WKH A;  1F40 A;  3O5I A;  3KAC A;  1FD9 A;  1LG1 A;  1WMV A;  3GU0 A;  3ARS A;  4TYO A;  5DIT A;  1FKD A;  1K9R A;  2YSH A;  4ODQ A;  4WKA A;  4R5E A;  2OLH A;  4DH0 A;  1RD6 A;  1VF8 A;  1LL4 A;  1D7I A;  3MCB B;  1N1A A;  2DJY A;  4JFL A;  4MNM A;  4IT4 A;  3RM4 A;  4J4N A;  5HW7 A;  1W1T A;  2WM0 A;  2PV2 A;  3ALF A;  1HKJ A;  1WB0 A;  1XHG A;  3PRD A;  4A0T A;  1GRJ A;  2B5U B;  2VN1 A;  3PRB A;  1J4R A;  1ZBC A;  4GLX A;  4Z2K A;  4MSP A;  1PIN A;  3M7N A;  2XP7 A;  3ARO A;  2DG4 A;  4S3J A;  2YBT A;  1FKR A;  1LG2 A;  1NMW A;  4Z2L A;  4U84 A;  4UDM A;  1FKF A;  2ZR5 A;  3M85 A;  4WK9 A;  2ZAJ A;  4DRI A;  4DRH A;  2VCD A;  2M8J A;  3UI4 A;  2ZQT A;  1JND A;  2KXQ A;  2LJ4 A;  4GGQ A;  2MLY A;  1ROU A;  3ALG A;  3B9E A;  2DK7 A;  1EIB A;  1W26 A;  4AY1 A;  4REX A;  3JYM A;  5B8I C;  3PQH A;  1ITX A;  3ARU A;  4E5R A;  2DG3 A;  1Q1C A;  3PA7 A;  2L4J A;  5E62 A;  3TDB A;  3OOB A;  3LKX B;  1EDQ A;  3G6M A;  4ZPW R;  1WR7 A;  4DZ3 A;  4ODP A;  1W1V A;  2PPN A;  3KCE A;  5HWC A;  2WAD A;  4MNJ A;  1ZL1 A;  2A3B A;  3AS3 A;  1FLC A;  2M1I A;  4ODN A;  1K9Q A;  1I5H W;  1D2K A;  3I6C A;  2XP3 A;  1D6O A;  2YAJ B;  1XRV A;  4J4O A;  4GIV A;  1EG3 A;  1E6Z A;  2DT1 A;  4DZ2 A;  2DT3 A;  1OGB A;  2XP4 A;  3WD1 A;  3KAF A;  3OA5 A;  1WNO A;  1W9P A;  5HW6 A;  1W1P A;  2BA1 A;  3O5M A;  2ITK A;  3O5K A;  3NTP A;  4FAP A;  1J6Y A;  3CHF A;  3ARQ A;  2XP5 A;  1E44 A;  4JFK A;  2DG9 A;  2A3C A;  4MNK A;  5DEZ A;  2F4E A;  3KAB A;  2MLX A;  4WJX A;  2PV1 A;  3CZ8 A;  2XPB A;  5CQ2 A;  3ODK A;  1FKS A;  3FXY A;  2M08 A;  1TK7 A;  2PV3 A;  5HTG A;  3PR9 A;  3NRK A;  4DIP A;  4TX0 A;  4C02 B;  1CTN A;  5U47 A;  2IUZ A;  4KQZ A;  1QZ2 A;  1GPF A;  4U86 A;  3LE4 A;  2KO7 A;  2DT2 A;  2F21 A;  3WIJ A;  2F2D A;  2AWG A;  3AQU A;  3MQG A;  2K8I A;  4N19 A;  3TC5 A;  2Q5A A;  1JVW A;  3WQV A;  1ZBK A;  3EIP A;  3RGC A;  1D7H A;  3O5D A;  4G50 A;  4DWS A;  5GPG A;  2O9O A;  2MNT A;  1NWR A;  3LUO A;  1FJD A;  1O6I A;  1UR8 A;  3UQA A;  2YSF A;  3UQB A;  1YW5 A;  4DRJ A;  1RP5 A;  3MDY B;  2YSB A;  5HWB A;  3FAP A;  3IKD A;  1TCO C;  1LL7 A;  3IHZ A;  3UQI A;  2KGJ A;  1W9U A;  2RSE A;  3O5F A;  4ODK A;  4MTV A;  3WKZ A;  5HKG A;  2ZQV A;  3FY1 A;  1FKK A;  5JH8 A;  1FFQ A;  4P8U A;  1R9H A;  1E6R A;  1IX5 A;  3FS8 A;  3UI5 A;  3B7X A;  1UR9 A;  3O5J A;  1F8A B;  2M8I A;  2UZ5 A;  1NWT A;  1NSG A;  4ODL A;  4DRO A;  2PBC A;  1SR0 A;  4FN2 A;  2MF9 A;  2PPO A;  1B6C A;  4KR0 B;  4MNL A;  4NSB A;  1ZCN A;  2A3A A;  1HJW A;  4QIB A;  1BKF A;  5DO2 A;  2WAE A;  1NMV A;  4LAX A;  5DF0 A;  3RME A;  4A0U A;  4DRQ A;  2WK2 A;  5GPR A;  2MLZ A;  2DSZ A;  2MDI A;  3KAD A;  4ML4 A;  2XP6 A;  2B31 A;  2JV4 A;  1EHN A;  4IT6 A;  5BXJ A;  3O5P A;  1NWU A;  4ODR A;  1A7X A;  1D7J A;  2G41 A;  4WIW A;  4DRN A;  3KAI A;  1GUV A;  2E45 A;  2JZV A;  2FKE A;  2XP9 A;  1Y0O A;  1NH6 A;  3KAH A;  4JFJ A;  4DWS C;  2F23 A;  3GTY X;  2DSV A;  3AS1 A;  2PPP A;  5D75 A;  3IK8 A;  4LGX A;  4W9Q A;  1KT1 A;  1HJV A;  1Q6I A;  3ARW A;  1QPL A;  2P4V A;  5GQB A;  3H9R B;  4MAV A;  2ESC A;  2MPH A;  3KZ7 A;  3WL1 A;  4W5U A;  1ZK6 A;  5AHT A;  4URI A;  2ZR4 A;  2EZ5 W;  1HKI A;  4ZPV R;  3RM8 A;  2YSG A;  1FKT A;  4L72 B;  1J4I A;  1J4H A;  2RUQ A;  1HKK A;  4ODO A;  4DRP A;  4JYS A;  2DWV A;  3O5O A;  5HW8 A;  2L2S A;  3NI6 A;  2KI3 A;  3IKG A;  4QZV B;  4O2T A;  4W9P A;  5E65 A;  5HUA A;  3MCB A;  4Z2H A;  2ETN A;  2G8Z A;  1ZBV A;  3CHC A;  3RM9 A;  3ARX A;  3CGN A;  1HJX A;  4HAR A;  2EUL A;  1FKJ A;  2YBU A;  3ART A;  1LQ0 A;  2LGO A;  1WAW A;  1KT0 A;  3EY6 A;  4IPX A;  1GOI A;  4P8V A;  3MQH A;  1E6N A;  3B9A A;  2O92 A;  1EQ3 A;  1EYM A;  1FKH A;  1X6L A;  4TW8 A;  4QT3 A;  1ROT A;  5E5W A;  1OWQ A;  4ITZ A;  2RUD A;  3GPK A;  2FDM A;  2IF4 A;  1FFR A;  3FSC A;  2A3E A;  4P8X A;  3ARR A;  1LL6 A;  4TW7 A;  3WL0 A;  1JCH B;  1C9H A;  3AS2 A;  3FSB A;  1SYT A;  4HBO A;  4ZS6 A;  3ARY A;  2LAJ A;  2DSW A;  4LAV A;  4Z2I A;  4DWS D;  5E66 A;  4W9O A;  1U79 A;  1K9T A;  1TFV A;  3TCZ A;  1FKB A;  4IQ2 A;  2M2A A;  1E15 A;  1O6W A;  4MPK A;  1Q6H A;  3L4H A;  2QRV A;  3B9D A;  3AS0 A;  2D9F A;  4Z2J A;  2RQS A;  4XAK A;  4WKF A;  1NWS A;  1P5Q A;  2KFW A;  3CHE A;  4Z2G A;  3LKX A;  3G6L A;  2ZQU A;  2KE0 A;  2PI6 A;  4ODM A;  3CGM A;  3O5G A;  2DK1 A;  2XP8 A;  4L3N A;  2RUR A;  4LAY A;  4Q22 A;  2QF8 A;  3CHD A;  4DWS B;  1OGG A;  4G2P A;  1E6P A; 
#chains in the Genus database with same CATH homology
 4R0X A;  2N87 A;  1LJY A;  2M3O W;  3RFW A;  3O5L A;  3JXV A;  1YAT A;  2JXW A;  2RUC A;  1JMQ A;  2WLY A;  4HBE A;  4Q7N A;  1FAP A;  3WD2 A;  3O5Q A;  1T11 A;  3VAW A;  2RE3 A;  5J6E A;  1X6N A;  1FKL A;  2YSI A;  3ARV A;  1H0G A;  3B8S A;  1JNE A;  2OFN A;  1JNS A;  2JX8 A;  1EG4 A;  1KFW A;  3UI6 A;  5DIV A;  1HXV A;  3CNG A;  2ZR6 A;  2WLZ A;  1JNT A;  4DRM A;  4ZPT R;  2Y8N B;  2OWO A;  3CH9 A;  4LAW A;  2LKN A;  3WD3 A;  3QOK A;  5HT1 A;  4TNS A;  3PRA A;  1QPF A;  3O5E A;  1ZB5 A;  1BL4 A;  4U85 A;  5E64 A;  1L1P A;  2ZQS A;  4JFI A;  1E9L A;  3WD0 A;  4PTM A;  3ARZ A;  4TW6 A;  2XPA A;  2AOS A;  3ARP A;  5I98 A;  4NNR A;  2FAP A;  2DSU A;  3KAG A;  4MGV A;  4JFM A;  4NZC A;  1TR8 A;  3W4R A;  1M5Y A;  1FKI A;  3WQW A;  2KR7 A;  1ZBW A;  3UF8 A;  3O5R A;  4IQC A;  4BF8 A;  1PBK A;  1W9V A;  3JYJ A;  3BXW A;  1FKG A;  5HBF A;  4QT2 A;  2Y78 A;  2JMF A;  2DMV A;  1Q6U A;  4S3K A;  3WD4 A;  2DT0 A;  1W1Y A;  1ZU8 A;  4DRK A;  2DPE A;  5DIU A;  2LPV A;  4DT4 A;  3WH0 A;  1HKM A;  4P8W A;  1H0I A;  4WKH A;  1F40 A;  3O5I A;  3KAC A;  1FD9 A;  1LG1 A;  1WMV A;  3ARS A;  4TYO A;  5DIT A;  1FKD A;  1K9R A;  2YSH A;  4ODQ A;  4WKA A;  4R5E A;  2OLH A;  4DH0 A;  1RD6 A;  1VF8 A;  1LL4 A;  1D7I A;  3MCB B;  1N1A A;  2DJY A;  4JFL A;  4MNM A;  4IT4 A;  3RM4 A;  4J4N A;  5HW7 A;  1W1T A;  2WM0 A;  2PV2 A;  3ALF A;  1HKJ A;  1WB0 A;  1XHG A;  3PRD A;  4A0T A;  2VN1 A;  3PRB A;  1J4R A;  1ZBC A;  4GLX A;  4Z2K A;  4MSP A;  1PIN A;  3M7N A;  2XP7 A;  3ARO A;  2DG4 A;  4S3J A;  2YBT A;  1FKR A;  1LG2 A;  1NMW A;  4Z2L A;  4U84 A;  1FKF A;  2ZR5 A;  3M85 A;  4WK9 A;  2ZAJ A;  4DRI A;  4DRH A;  2VCD A;  2M8J A;  3UI4 A;  2ZQT A;  1JND A;  2KXQ A;  2LJ4 A;  4GGQ A;  2MLY A;  1ROU A;  3ALG A;  3B9E A;  2DK7 A;  1EIB A;  1W26 A;  4AY1 A;  4REX A;  3JYM A;  5B8I C;  3PQH A;  1ITX A;  3ARU A;  4E5R A;  2DG3 A;  1Q1C A;  3PA7 A;  2L4J A;  5E62 A;  3TDB A;  3OOB A;  3LKX B;  1EDQ A;  3G6M A;  4ZPW R;  1WR7 A;  4DZ3 A;  4ODP A;  1W1V A;  2PPN A;  3KCE A;  5HWC A;  2WAD A;  4MNJ A;  1ZL1 A;  2A3B A;  3AS3 A;  1FLC A;  2M1I A;  4ODN A;  1K9Q A;  1I5H W;  1D2K A;  3I6C A;  2XP3 A;  1D6O A;  2YAJ B;  1XRV A;  4J4O A;  4GIV A;  1EG3 A;  1E6Z A;  2DT1 A;  4DZ2 A;  2DT3 A;  1OGB A;  2XP4 A;  3WD1 A;  3KAF A;  3OA5 A;  1WNO A;  1W9P A;  5HW6 A;  1W1P A;  2BA1 A;  3O5M A;  2ITK A;  3O5K A;  3NTP A;  4FAP A;  1J6Y A;  3CHF A;  3ARQ A;  2XP5 A;  4JFK A;  2DG9 A;  2A3C A;  4MNK A;  5DEZ A;  2F4E A;  3KAB A;  2MLX A;  4WJX A;  2PV1 A;  3CZ8 A;  2XPB A;  5CQ2 A;  3ODK A;  1FKS A;  3FXY A;  2M08 A;  1TK7 A;  2PV3 A;  5HTG A;  3PR9 A;  3NRK A;  4DIP A;  4TX0 A;  4C02 B;  1CTN A;  5U47 A;  2IUZ A;  4KQZ A;  1QZ2 A;  1GPF A;  4U86 A;  3LE4 A;  2KO7 A;  2DT2 A;  2F21 A;  3WIJ A;  2F2D A;  2AWG A;  3AQU A;  3MQG A;  2K8I A;  4N19 A;  3TC5 A;  2Q5A A;  1JVW A;  3WQV A;  1ZBK A;  3RGC A;  1D7H A;  3O5D A;  4G50 A;  4DWS A;  5GPG A;  2O9O A;  2MNT A;  1NWR A;  3LUO A;  1FJD A;  1O6I A;  1UR8 A;  3UQA A;  2YSF A;  3UQB A;  1YW5 A;  4DRJ A;  1RP5 A;  3MDY B;  2YSB A;  5HWB A;  3FAP A;  3IKD A;  1TCO C;  1LL7 A;  3IHZ A;  3UQI A;  2KGJ A;  1W9U A;  2RSE A;  3O5F A;  4ODK A;  4MTV A;  3WKZ A;  5HKG A;  2ZQV A;  3FY1 A;  1FKK A;  5JH8 A;  1FFQ A;  4P8U A;  1R9H A;  1E6R A;  1IX5 A;  3FS8 A;  3UI5 A;  3B7X A;  1UR9 A;  3O5J A;  1F8A B;  2M8I A;  2UZ5 A;  1NWT A;  1NSG A;  4ODL A;  4DRO A;  2PBC A;  1SR0 A;  4FN2 A;  2MF9 A;  2PPO A;  1B6C A;  4KR0 B;  4MNL A;  4NSB A;  1ZCN A;  2A3A A;  1HJW A;  4QIB A;  1BKF A;  5DO2 A;  2WAE A;  1NMV A;  4LAX A;  5DF0 A;  3RME A;  4A0U A;  4DRQ A;  2WK2 A;  5GPR A;  2MLZ A;  2DSZ A;  2MDI A;  3KAD A;  4ML4 A;  2XP6 A;  2B31 A;  2JV4 A;  1EHN A;  4IT6 A;  5BXJ A;  3O5P A;  1NWU A;  4ODR A;  1A7X A;  1D7J A;  2G41 A;  4WIW A;  4DRN A;  3KAI A;  1GUV A;  2E45 A;  2JZV A;  2FKE A;  2XP9 A;  1Y0O A;  1NH6 A;  3KAH A;  4JFJ A;  4DWS C;  2DSV A;  3AS1 A;  2PPP A;  5D75 A;  3IK8 A;  4LGX A;  4W9Q A;  1KT1 A;  1HJV A;  1Q6I A;  3ARW A;  1QPL A;  5GQB A;  3H9R B;  4MAV A;  2ESC A;  2MPH A;  3KZ7 A;  3WL1 A;  4W5U A;  1ZK6 A;  5AHT A;  4URI A;  2ZR4 A;  2EZ5 W;  1HKI A;  4ZPV R;  3RM8 A;  2YSG A;  1FKT A;  4L72 B;  1J4I A;  1J4H A;  2RUQ A;  1HKK A;  4ODO A;  4DRP A;  4JYS A;  2DWV A;  3O5O A;  5HW8 A;  2L2S A;  3NI6 A;  2KI3 A;  3IKG A;  4QZV B;  4O2T A;  4W9P A;  5E65 A;  5HUA A;  3MCB A;  4Z2H A;  2G8Z A;  1ZBV A;  3CHC A;  3RM9 A;  3ARX A;  3CGN A;  1HJX A;  4HAR A;  1FKJ A;  2YBU A;  3ART A;  1LQ0 A;  2LGO A;  1WAW A;  1KT0 A;  3EY6 A;  4IPX A;  1GOI A;  4P8V A;  3MQH A;  1E6N A;  3B9A A;  2O92 A;  1EQ3 A;  1EYM A;  1FKH A;  1X6L A;  4TW8 A;  4QT3 A;  1ROT A;  5E5W A;  1OWQ A;  4ITZ A;  2RUD A;  3GPK A;  2FDM A;  2IF4 A;  1FFR A;  3FSC A;  2A3E A;  4P8X A;  3ARR A;  1LL6 A;  4TW7 A;  3WL0 A;  3AS2 A;  1C9H A;  3FSB A;  1SYT A;  4HBO A;  4ZS6 A;  3ARY A;  2LAJ A;  2DSW A;  4LAV A;  4Z2I A;  4DWS D;  5E66 A;  4W9O A;  1U79 A;  1K9T A;  1TFV A;  3TCZ A;  1FKB A;  4IQ2 A;  2M2A A;  1E15 A;  1O6W A;  4MPK A;  1Q6H A;  3L4H A;  2QRV A;  3B9D A;  3AS0 A;  2D9F A;  4Z2J A;  2RQS A;  4XAK A;  4WKF A;  1NWS A;  1P5Q A;  2KFW A;  3CHE A;  4Z2G A;  3LKX A;  3G6L A;  2ZQU A;  2KE0 A;  2PI6 A;  4ODM A;  3CGM A;  3O5G A;  2DK1 A;  2XP8 A;  4L3N A;  2RUR A;  4LAY A;  4Q22 A;  2QF8 A;  3CHD A;  4DWS B;  1OGG A;  4G2P A;  1E6P A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...