2XP6A

Discovery of cell-active phenyl-imidazole pin1 inhibitors by structure-guided fragment evolution
Total Genus 45
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
45
sequence length
157
structure length
145
Chain Sequence
b'LPPGWEKAMSRSSGRVYYFNHITNASQWERPSEPARVRCSHLLVKHSQSRRPSSWRQEKITRTKEEALELINGYIQKIKSGEEDFESLASQFSDCSSAKARGDLGAFSRGQMAKPFEDASFALRTGEMSGPVFTDSGIHIILRTE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PEPTIDYL-PROLYL CIS-TRANS ISOMERASE NIMA-INTERACTING 1
publication title Discovery of Cell-Active Phenyl-Imidazole Pin1 Inhibitors by Structure-Guided Fragment Evolution.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Isomerase
total genus 45
structure length 145
sequence length 157
ec nomenclature ec 5.2.1.8: Peptidylprolyl isomerase.
pdb deposition date 2010-08-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00397 WW WW domain
A PF00639 Rotamase PPIC-type PPIASE domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.20.70.10 Mainly Beta Single Sheet Ubiquitin Ligase Nedd4; Chain: W; Ubiquitin Ligase Nedd4; Chain: W; 2xp6A01
3.10.50.40 Alpha Beta Roll Chitinase A; domain 3 Chitinase A; domain 3 2xp6A02
4U86A 2KE0A 3UI4A 4FAPA 4O2TA 1KT0A 1PBKA 1F40A 1FKGA 3B7XA 3TCZA 3CNGA 5J6EA 1M5YA 1A7XA 1P5QA 2JV4A 2PBCA 3L4HA 4U85A 4E5RA 4DH0A 4JFKA 3VAWA 2YSGA 4ODQA 5HT1A 1FKDA 4LAXA 1FKKA 4G50A 5HW7A 1K9RA 4DRNA 1FAPA 4ODRA 3KAIA 2MF9A 1J6YA 5B8IC 2JMFA 1EG4A 2Y78A 3O5RA 4MGVA 4JFMA 4ITZA 2ZQSA 3PA7A 3PRBA 4W9QA 2PPOA 3KADA 2F21A 2M3OW 1FKBA 1QZ2A 3UI5A 2YSBA 2PPPA 2ZR6A 2Q5AA 5I98A 1O6WA 3O5PA 2LJ4A 1ZCNA 4U84A 1Q6HA 2MLZA 2PV1A 2DMVA 1FKRA 2DG3A 2LKNA 2PV3A 1FKLA 3O5JA 1ROUA 2AWGA 3O5KA 3O5EA 2MLXA 3KAHA 1L1PA 2XP8A 4N19A 5HWCA 2YSIA 1TCOC 5DIUA 2RUCA 5CQ2A 1U79A 2DK1A 1J4RA 3LUOA 4GIVA 5HTGA 3NTPA 1TK7A 4DIPA 3KCEA 5HUAA 3IK8A 1YATA 1W26A 3O5OA 4TW6A 2XPAA 4NNRA 5HWBA 1QPFA 3O5MA 3O5FA 3RFWA 4W9OA 5HW6A 1D7HA 3UF8A 5DIVA 2K8IA 4JFJA 2KXQA 3KZ7A 1NMWA 3CGMA 4IPXA 1JNTA 2F2DA 2D9FA 2YSFA 2XP7A 1KT1A 4ODMA 4JYSA 3JYJA 3UQAA 4QT3A 4TNSA 3IKGA 2XP5A 3I6CA 4MSPA 3ODKA 1Q6IA 3M85A 2RSEA 2KFWA 2RUQA 4ODOA 1EG3A 2ZR5A 4DRKA 2XPBA 2YSHA 3PRDA 4J4OA 5HW8A 5D75A 1FKJA 4TW8A 4TYOA 2RURA 4W9PA 2FKEA 3UQBA 2ZAJA 1JNSA 1EYMA 1D7JA 4REXA 2M8IA 2F4EA 3KACA 1K9QA 2LPVA 1C9HA 2JZVA 5AHTA 5GPGA 3GPKA 1FKFA 2ZQTA 1ROTA 2MPHA 4QIBA 2M08A 4TX0A 4JFIA 1Y0OA 1J4IA 1EQ3A 4DRQA 3O5GA 4DRJA 3NI6A 4LAVA 2DJYA 5BXJA 5HKGA 3KAGA 3EY6A 3KABA 2FAPA 2ZQVA 2DG4A 4BF8A 2DWVA 2XP9A 1FKTA 3LE4A 2MLYA 2M8JA 1FKHA 2M1IA 4IQCA 2BA1A 3H9RB 4DROA 2PV2A 3MDYB 2VN1A 4JFLA 4C02B 2M2AA 2L2SA 1ZK6A 4IQ2A 3KAFA 4GGQA 2PPNA 4ODKA 1QPLA 4R0XA 1HXVA 2UZ5A 1FKSA 4DRPA 4DZ3A 4FN2A 2RE3A 1R9HA 1JVWA 2RUDA 2L4JA 1NMVA 1Q1CA 2EZ5W 2MDIA 4DRMA 2E45A 2ZR4A 3WH0A 2ZQUA 3UI6A 4ODPA 3O5IA 1FD9A 3CGNA 2KO7A 3O5LA 1WMVA 1T11A 1JMQA 3JYMA 3O5DA 1BKFA 4ODNA 1D7IA 3TC5A 3TDBA 3NRKA 2KI3A 1I5HW 1WR7A 3IKDA 2KGJA 2JXWA 1D6OA 5DITA 4QT2A 3JXVA 2DK7A 2LGOA 1F8AB 4TW7A 4LAYA 2XP4A 2JX8A 3M7NA 4ODLA 4LAWA 1YW5A 4G2PA 2ITKA 2OFNA 3RGCA 1FJDA 1N1AA 2N87A 1PINA 2DG9A 4DZ2A 3IHZA 2KR7A 1B6CA 3O5QA 2RQSA 3FAPA 1BL4A 3UQIA 2XP6A 2LAJA 1FKIA 2MNTA 1J4HA 4DRHA 4DT4A 1Q6UA 2XP3A 4J4NA 2IF4A 3OOBA 2VCDA 1NSGA 4DRIA
chains in the Genus database with same CATH superfamily
1WAWA 4U86A 2KE0A 3UI4A 1LG1A 4FAPA 2YBTA 2YAJB 1KT0A 4O2TA 1PBKA 3BMBA 1F40A 3ARYA 4IT6A 3WD0A 1FKGA 4HBEA 3B7XA 3TCZA 3CNGA 5J6EA 1M5YA 1A7XA 1P5QA 3PQHA 2JV4A 1SR0A 4MPKA 2PBCA 5E5WA 4MNJA 3L4HA 4U85A 1LG2A 2Y8NB 4E5RA 4DH0A 4JFKA 3VAWA 2YSGA 3MCBA 4ODQA 5HT1A 2IUZA 3B8SA 1FKDA 4LAXA 1FKKA 4G50A 5HW7A 1K9RA 1FLCA 5DO2A 1FAPA 4DRNA 2OLHA 3B9EA 4ODRA 1NWTA 3KAIA 2DPEA 2MF9A 5E65A 1J6YA 1W9UA 5B8IC 1RD6A 2JMFA 1EG4A 2Y78A 4HBOA 3O5RA 4MGVA 4DWSC 2FDMA 3GU0A 4Z2JA 3B9AA 4JFMA 4ITZA 2ZQSA 3PA7A 4P8WA 3PRBA 4W9QA 2PPOA 3KADA 2F21A 2M3OW 1FKBA 1HJWA 1QZ2A 3UI5A 2YSBA 2PPPA 2ZR6A 1ZB5A 2Q5AA 5I98A 1O6WA 3O5PA 2LJ4A 3AROA 4ZS6A 1E6RA 1GRJA 1ZCNA 4U84A 1Q6HA 2MLZA 2PV1A 5GQBA 1E6PA 5DF0A 2DMVA 1FKRA 2DG3A 2LKNA 2PV3A 3ARVA 1FKLA 2QF8A 3G6LA 3O5JA 1ROUA 2AWGA 4Q7NA 3O5KA 3O5EA 2MLXA 2QRVA 4MNLA 3KAHA 4ZPTR 2DSVA 1L1PA 1OGBA 4Z2GA 2XP8A 4N19A 5HWCA 1ITXA 2YSIA 1TCOC 3ARTA 1IX5A 5DIUA 1W1VA 1LL7A 1KFWA 2RUCA 2YBUA 3RM8A 5CQ2A 1U79A 1VF8A 3WD3A 2DT3A 2WADA 4MTVA 3WIJA 2DK1A 1J4RA 3LUOA 4GIVA 1X6NA 1W9VA 4ZPWR 1SYTA 2WLZA 5HTGA 3NTPA 2EULA 1FFRA 4KQZA 1TK7A 4UDMA 4DIPA 3KCEA 5HUAA 1WNOA 3IK8A 5DEZA 1HKKA 1YATA 1W26A 2F23A 3O5OA 4TW6A 1JCHB 3WL1A 5E64A 2XPAA 4NNRA 1X6LA 2DT1A 5HWBA 1QPFA 3O5MA 3O5FA 4QZVB 4R5EA 4S3JA 4Z2KA 3RFWA 4W9OA 4LGXA 5HW6A 1D7HA 2A3AA 4P8VA 1RP5A 3UF8A 5DIVA 2WLYA 4GLXA 2K8IA 4JFJA 2KXQA 4A0UA 3KZ7A 1NMWA 3CGMA 4IPXA 3WD4A 1JNTA 2F2DA 4NSBA 2D9FA 2YSFA 2XP7A 3W4RA 3MQGA 3LKXB 1KT1A 3ARRA 4ODMA 4JYSA 3JYJA 1H0IA 3PRAA 3BXWA 3CZ8A 3UQAA 1ZBVA 4QT3A 4TNSA 3IKGA 4S3KA 3ARPA 2XP5A 3I6CA 1W1TA 4MSPA 4Z2IA 3WD1A 3WD2A 3CHEA 3WKZA 3QOKA 3ODKA 1Q6IA 1E6ZA 3M85A 1LJYA 1CTNA 2RSEA 1HJXA 2KFWA 2RUQA 4DWSA 1NWRA 3FY1A 4ODOA 1EG3A 3AS3A 1ZU8A 4Z2LA 2ZR5A 2AOSA 2G8ZA 4KR0B 4DRKA 2DSUA 3CHFA 1HJVA 2XPBA 2YSHA 4WKAA 3PRDA 4J4OA 3MQHA 1ZL1A 1OGGA 5HW8A 1LL4A 5D75A 2A3CA 1FKJA 4TW8A 3LKXA 2RURA 3AS0A 4TYOA 4XAKA 5JH8A 4W9PA 2FKEA 3UQBA 1ZBKA 2ZAJA 1JNSA 1EYMA 3GTYX 2PI6A 1D7JA 1XRVA 4REXA 2M8IA 2F4EA 3KACA 1K9QA 2LPVA 4AY1A 1HKIA 1C9HA 2A3BA 3FS8A 2JZVA 5AHTA 1HKMA 5GPGA 3GPKA 1FKFA 1JNDA 2ZQTA 1ROTA 2DSZA 1K9TA 2MPHA 2G41A 4QIBA 2M08A 4TX0A 4JFIA 1Y0OA 1J4IA 1EQ3A 4IT4A 4DRQA 3O5GA 4DRJA 3NI6A 1EDQA 2DJYA 4LAVA 5BXJA 5HKGA 3CHCA 1UR8A 3ARQA 3KAGA 3FXYA 3EY6A 3KABA 2WK2A 2FAPA 2ZQVA 3RM9A 1W9PA 2DG4A 4BF8A 2DWVA 1EHNA 5U47A 3ARZA 4DWSB 2XP9A 2DT0A 4W5UA 2B5UB 1FKTA 4WK9A 4MAVA 3LE4A 3ARWA 2MLYA 2M8JA 2O9OA 4PTMA 1FKHA 1ZBCA 2M1IA 3ALGA 4IQCA 2BA1A 1D2KA 3CH9A 3H9RB 2OWOA 1HKJA 4DROA 2PV2A 4NZCA 1O6IA 3MDYB 2VN1A 2A3EA 4JFLA 4C02B 2M2AA 5E66A 3G6MA 4ML4A 2B31A 2L2SA 1ZK6A 4IQ2A 3FSBA 1WB0A 3PR9A 3KAFA 4Z2HA 4GGQA 3AS2A 2PPNA 4ODKA 1QPLA 1FFQA 3RM4A 4MNKA 4R0XA 4MNMA 1HXVA 3AQUA 1LQ0A 2UZ5A 1FKSA 4P8UA 4DRPA 4DZ3A 2RE3A 1R9HA 1JVWA 1W1PA 4FN2A 2RUDA 1NWSA 3OA5A 5GPRA 2L4JA 1E9LA 1ZBWA 4A0TA 1NMVA 1Q1CA 2EZ5W 4ZPVR 2MDIA 3ARSA 4DRMA 2E45A 1GOIA 2ZR4A 3WH0A 4WIWA 3WL0A 1XHGA 2ZQUA 1TR8A 3CHDA 3UI6A 4URIA 4ODPA 3O5IA 3RMEA 1FD9A 3CGNA 1TFVA 2KO7A 3ARUA 3O5LA 1UR9A 1WMVA 1LL6A 4WKFA 4L72B 3ALFA 1T11A 1JMQA 4P8XA 3JYMA 3O5DA 1BKFA 2P4VA 4ODNA 1D7IA 3TC5A 4WKHA 3TDBA 4WJXA 4DWSD 3NRKA 2KI3A 1I5HW 1WR7A 3IKDA 2KGJA 2JXWA 1NH6A 1D6OA 5DITA 2PN0A 3B9DA 4QT2A 3EIPA 1E44A 3JXVA 2DK7A 3AS1A 3WQVA 4L3NA 5E62A 2LGOA 1F8AB 1EIBA 4HARA 4TW7A 2DT2A 4LAYA 2XP4A 1JNEA 1W1YA 2WAEA 2JX8A 3M7NA 4ODLA 1E6NA 2WM0A 4LAWA 1YW5A 4G2PA 3MCBB 2ESCA 2ITKA 2OFNA 3RGCA 1FJDA 1N1AA 2N87A 3WQWA 1PINA 2DG9A 2O92A 4DZ2A 3ARXA 2ETNA 3IHZA 2KR7A 1B6CA 3O5QA 4Q22A 2RQSA 3FAPA 1BL4A 3UQIA 2XP6A 1GPFA 2DSWA 1NWUA 2LAJA 1FKIA 2MNTA 1H0GA 1J4HA 4DRHA 4DT4A 1E15A 1GUVA 1Q6UA 2XP3A 4J4NA 2IF4A 3FSCA 3OOBA 1OWQA 2VCDA 1NSGA 5HBFA 4DRIA
chains in the Genus database with same CATH topology
1WAWA 4U86A 2KE0A 3UI4A 1LG1A 4FAPA 2YBTA 2YAJB 1KT0A 4O2TA 1PBKA 1F40A 3ARYA 4IT6A 3WD0A 1FKGA 4HBEA 3B7XA 3TCZA 3CNGA 5J6EA 1M5YA 1A7XA 1P5QA 3PQHA 2JV4A 1SR0A 4MPKA 2PBCA 5E5WA 4MNJA 3L4HA 4U85A 1LG2A 2Y8NB 4E5RA 4DH0A 4JFKA 3VAWA 2YSGA 3MCBA 4ODQA 5HT1A 2IUZA 3B8SA 1FKDA 4LAXA 1FKKA 4G50A 5HW7A 1K9RA 1FLCA 5DO2A 1FAPA 4DRNA 2OLHA 3B9EA 4ODRA 1NWTA 3KAIA 2DPEA 2MF9A 5E65A 1J6YA 1W9UA 5B8IC 1RD6A 2JMFA 1EG4A 2Y78A 4HBOA 3O5RA 4MGVA 4DWSC 2FDMA 4Z2JA 3B9AA 4JFMA 4ITZA 2ZQSA 3PA7A 4P8WA 3PRBA 4W9QA 2PPOA 3KADA 2F21A 2M3OW 1FKBA 1HJWA 1QZ2A 3UI5A 2PPPA 2YSBA 2ZR6A 1ZB5A 2Q5AA 5I98A 1O6WA 3O5PA 2LJ4A 3AROA 4ZS6A 1E6RA 1ZCNA 4U84A 1Q6HA 2MLZA 2PV1A 5GQBA 1E6PA 5DF0A 2DMVA 1FKRA 2DG3A 2LKNA 2PV3A 3ARVA 1FKLA 2QF8A 3G6LA 3O5JA 1ROUA 2AWGA 4Q7NA 3O5KA 3O5EA 2MLXA 2QRVA 4MNLA 3KAHA 4ZPTR 2DSVA 1L1PA 1OGBA 4Z2GA 2XP8A 4N19A 5HWCA 1ITXA 2YSIA 1TCOC 3ARTA 1IX5A 5DIUA 1W1VA 1LL7A 1KFWA 2RUCA 2YBUA 3RM8A 5CQ2A 1U79A 1VF8A 3WD3A 2DT3A 2WADA 4MTVA 3WIJA 2DK1A 1J4RA 3LUOA 4GIVA 1X6NA 1W9VA 4ZPWR 1SYTA 2WLZA 5HTGA 3NTPA 1FFRA 4KQZA 1TK7A 4DIPA 3KCEA 5HUAA 1WNOA 3IK8A 5DEZA 1HKKA 1YATA 1W26A 3O5OA 4TW6A 3WL1A 5E64A 2XPAA 4NNRA 1X6LA 2DT1A 5HWBA 1QPFA 3O5MA 3O5FA 4QZVB 4R5EA 4S3JA 4Z2KA 3RFWA 4W9OA 4LGXA 5HW6A 1D7HA 2A3AA 4P8VA 1RP5A 3UF8A 5DIVA 2WLYA 4GLXA 2K8IA 4JFJA 2KXQA 4A0UA 3KZ7A 1NMWA 3CGMA 4IPXA 3WD4A 1JNTA 2F2DA 4NSBA 2D9FA 2YSFA 2XP7A 3W4RA 3MQGA 3LKXB 1KT1A 3ARRA 4ODMA 4JYSA 3JYJA 1H0IA 3PRAA 3BXWA 3CZ8A 3UQAA 1ZBVA 4QT3A 4TNSA 3IKGA 4S3KA 3ARPA 2XP5A 3I6CA 1W1TA 4MSPA 4Z2IA 3WD1A 3WD2A 3CHEA 3WKZA 3QOKA 3ODKA 1Q6IA 1E6ZA 3M85A 1LJYA 1CTNA 2RSEA 1HJXA 2KFWA 2RUQA 4DWSA 1NWRA 3FY1A 4ODOA 1EG3A 3AS3A 1ZU8A 4Z2LA 2ZR5A 2AOSA 2G8ZA 4KR0B 4DRKA 2DSUA 3CHFA 1HJVA 2XPBA 2YSHA 4WKAA 3PRDA 4J4OA 3MQHA 1ZL1A 1OGGA 5HW8A 1LL4A 5D75A 2A3CA 1FKJA 4TW8A 3LKXA 2RURA 3AS0A 4TYOA 4XAKA 5JH8A 4W9PA 2FKEA 3UQBA 1ZBKA 2ZAJA 1JNSA 1EYMA 2PI6A 1D7JA 1XRVA 4REXA 2M8IA 2F4EA 3KACA 1K9QA 2LPVA 4AY1A 1HKIA 1C9HA 2A3BA 3FS8A 2JZVA 5AHTA 1HKMA 5GPGA 3GPKA 1FKFA 1JNDA 2ZQTA 1ROTA 2DSZA 1K9TA 2MPHA 2G41A 4QIBA 2M08A 4TX0A 4JFIA 1Y0OA 1J4IA 1EQ3A 4IT4A 4DRQA 3O5GA 4DRJA 3NI6A 1EDQA 2DJYA 4LAVA 5BXJA 5HKGA 3CHCA 1UR8A 3ARQA 3KAGA 3FXYA 3EY6A 3KABA 2WK2A 2FAPA 2ZQVA 3RM9A 1W9PA 2DG4A 4BF8A 2DWVA 1EHNA 5U47A 3ARZA 4DWSB 2XP9A 2DT0A 4W5UA 1FKTA 4WK9A 4MAVA 3LE4A 3ARWA 2MLYA 2M8JA 2O9OA 4PTMA 1FKHA 1ZBCA 2M1IA 3ALGA 4IQCA 2BA1A 1D2KA 3CH9A 3H9RB 2OWOA 1HKJA 4DROA 2PV2A 4NZCA 1O6IA 3MDYB 2VN1A 2A3EA 4JFLA 4C02B 2M2AA 5E66A 3G6MA 4ML4A 2B31A 2L2SA 1ZK6A 4IQ2A 3FSBA 1WB0A 3PR9A 3KAFA 4Z2HA 4GGQA 3AS2A 2PPNA 4ODKA 1QPLA 1FFQA 3RM4A 4MNKA 4R0XA 4MNMA 1HXVA 3AQUA 1LQ0A 2UZ5A 1FKSA 4P8UA 4DRPA 4DZ3A 2RE3A 1R9HA 1JVWA 1W1PA 4FN2A 2RUDA 1NWSA 3OA5A 5GPRA 2L4JA 1E9LA 1ZBWA 4A0TA 1NMVA 1Q1CA 2EZ5W 4ZPVR 2MDIA 3ARSA 4DRMA 2E45A 1GOIA 2ZR4A 3WH0A 4WIWA 3WL0A 1XHGA 2ZQUA 1TR8A 3CHDA 3UI6A 4URIA 4ODPA 3O5IA 3RMEA 1FD9A 3CGNA 1TFVA 2KO7A 3ARUA 3O5LA 1UR9A 1WMVA 1LL6A 4WKFA 4L72B 3ALFA 1T11A 1JMQA 4P8XA 3JYMA 3O5DA 1BKFA 4ODNA 1D7IA 3TC5A 4WKHA 3TDBA 4WJXA 4DWSD 3NRKA 2KI3A 1I5HW 1WR7A 3IKDA 2KGJA 2JXWA 1NH6A 1D6OA 5DITA 4QT2A 3B9DA 3JXVA 2DK7A 3AS1A 3WQVA 4L3NA 5E62A 2LGOA 1F8AB 1EIBA 4HARA 4TW7A 2DT2A 4LAYA 2XP4A 1JNEA 1W1YA 2WAEA 2JX8A 3M7NA 4ODLA 1E6NA 2WM0A 4LAWA 1YW5A 4G2PA 3MCBB 2ESCA 2ITKA 2OFNA 3RGCA 1FJDA 1N1AA 2N87A 3WQWA 1PINA 2DG9A 2O92A 4DZ2A 3ARXA 3IHZA 2KR7A 1B6CA 3O5QA 4Q22A 2RQSA 3FAPA 1BL4A 3UQIA 2XP6A 1GPFA 2DSWA 1NWUA 2LAJA 1FKIA 2MNTA 1H0GA 1J4HA 4DRHA 4DT4A 1E15A 1GUVA 1Q6UA 2XP3A 4J4NA 2IF4A 3FSCA 3OOBA 1OWQA 2VCDA 1NSGA 5HBFA 4DRIA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4U86 A;  2KE0 A;  3UI4 A;  4FAP A;  4O2T A;  1KT0 A;  1PBK A;  1F40 A;  1FKG A;  3B7X A;  3TCZ A;  3CNG A;  5J6E A;  1M5Y A;  1A7X A;  1P5Q A;  2JV4 A;  2PBC A;  3L4H A;  4U85 A;  4E5R A;  4DH0 A;  4JFK A;  3VAW A;  2YSG A;  4ODQ A;  5HT1 A;  1FKD A;  4LAX A;  1FKK A;  4G50 A;  5HW7 A;  1K9R A;  4DRN A;  1FAP A;  4ODR A;  3KAI A;  2MF9 A;  1J6Y A;  5B8I C;  2JMF A;  1EG4 A;  2Y78 A;  3O5R A;  4MGV A;  4JFM A;  4ITZ A;  2ZQS A;  3PA7 A;  3PRB A;  4W9Q A;  2PPO A;  3KAD A;  2F21 A;  2M3O W;  1FKB A;  1QZ2 A;  3UI5 A;  2YSB A;  2PPP A;  2ZR6 A;  2Q5A A;  5I98 A;  1O6W A;  3O5P A;  2LJ4 A;  1ZCN A;  4U84 A;  1Q6H A;  2MLZ A;  2PV1 A;  2DMV A;  1FKR A;  2DG3 A;  2LKN A;  2PV3 A;  1FKL A;  3O5J A;  1ROU A;  2AWG A;  3O5K A;  3O5E A;  2MLX A;  3KAH A;  1L1P A;  2XP8 A;  4N19 A;  5HWC A;  2YSI A;  1TCO C;  5DIU A;  2RUC A;  5CQ2 A;  1U79 A;  2DK1 A;  1J4R A;  3LUO A;  4GIV A;  5HTG A;  3NTP A;  1TK7 A;  4DIP A;  3KCE A;  5HUA A;  3IK8 A;  1YAT A;  1W26 A;  3O5O A;  4TW6 A;  2XPA A;  4NNR A;  5HWB A;  1QPF A;  3O5M A;  3O5F A;  3RFW A;  4W9O A;  5HW6 A;  1D7H A;  3UF8 A;  5DIV A;  2K8I A;  4JFJ A;  2KXQ A;  3KZ7 A;  1NMW A;  3CGM A;  4IPX A;  1JNT A;  2F2D A;  2D9F A;  2YSF A;  2XP7 A;  1KT1 A;  4ODM A;  4JYS A;  3JYJ A;  3UQA A;  4QT3 A;  4TNS A;  3IKG A;  2XP5 A;  3I6C A;  4MSP A;  3ODK A;  1Q6I A;  3M85 A;  2RSE A;  2KFW A;  2RUQ A;  4ODO A;  1EG3 A;  2ZR5 A;  4DRK A;  2XPB A;  2YSH A;  3PRD A;  4J4O A;  5HW8 A;  5D75 A;  1FKJ A;  4TW8 A;  4TYO A;  2RUR A;  4W9P A;  2FKE A;  3UQB A;  2ZAJ A;  1JNS A;  1EYM A;  1D7J A;  4REX A;  2M8I A;  2F4E A;  3KAC A;  1K9Q A;  2LPV A;  1C9H A;  2JZV A;  5AHT A;  5GPG A;  3GPK A;  1FKF A;  2ZQT A;  1ROT A;  2MPH A;  4QIB A;  2M08 A;  4TX0 A;  4JFI A;  1Y0O A;  1J4I A;  1EQ3 A;  4DRQ A;  3O5G A;  4DRJ A;  3NI6 A;  4LAV A;  2DJY A;  5BXJ A;  5HKG A;  3KAG A;  3EY6 A;  3KAB A;  2FAP A;  2ZQV A;  2DG4 A;  4BF8 A;  2DWV A;  2XP9 A;  1FKT A;  3LE4 A;  2MLY A;  2M8J A;  1FKH A;  2M1I A;  4IQC A;  2BA1 A;  3H9R B;  4DRO A;  2PV2 A;  3MDY B;  2VN1 A;  4JFL A;  4C02 B;  2M2A A;  2L2S A;  1ZK6 A;  4IQ2 A;  3KAF A;  4GGQ A;  2PPN A;  4ODK A;  1QPL A;  4R0X A;  1HXV A;  2UZ5 A;  1FKS A;  4DRP A;  4DZ3 A;  4FN2 A;  2RE3 A;  1R9H A;  1JVW A;  2RUD A;  2L4J A;  1NMV A;  1Q1C A;  2EZ5 W;  2MDI A;  4DRM A;  2E45 A;  2ZR4 A;  3WH0 A;  2ZQU A;  3UI6 A;  4ODP A;  3O5I A;  1FD9 A;  3CGN A;  2KO7 A;  3O5L A;  1WMV A;  1T11 A;  1JMQ A;  3JYM A;  3O5D A;  1BKF A;  4ODN A;  1D7I A;  3TC5 A;  3TDB A;  3NRK A;  2KI3 A;  1I5H W;  1WR7 A;  3IKD A;  2KGJ A;  2JXW A;  1D6O A;  5DIT A;  4QT2 A;  3JXV A;  2DK7 A;  2LGO A;  1F8A B;  4TW7 A;  4LAY A;  2XP4 A;  2JX8 A;  3M7N A;  4ODL A;  4LAW A;  1YW5 A;  4G2P A;  2ITK A;  2OFN A;  3RGC A;  1FJD A;  1N1A A;  2N87 A;  1PIN A;  2DG9 A;  4DZ2 A;  3IHZ A;  2KR7 A;  1B6C A;  3O5Q A;  2RQS A;  3FAP A;  1BL4 A;  3UQI A;  2XP6 A;  2LAJ A;  1FKI A;  2MNT A;  1J4H A;  4DRH A;  4DT4 A;  1Q6U A;  2XP3 A;  4J4N A;  2IF4 A;  3OOB A;  2VCD A;  1NSG A;  4DRI A; 
#chains in the Genus database with same CATH topology
 1WAW A;  4U86 A;  2KE0 A;  3UI4 A;  1LG1 A;  4FAP A;  2YBT A;  2YAJ B;  1KT0 A;  4O2T A;  1PBK A;  3BMB A;  1F40 A;  3ARY A;  4IT6 A;  3WD0 A;  1FKG A;  4HBE A;  3B7X A;  3TCZ A;  3CNG A;  5J6E A;  1M5Y A;  1A7X A;  1P5Q A;  3PQH A;  2JV4 A;  1SR0 A;  4MPK A;  2PBC A;  5E5W A;  4MNJ A;  3L4H A;  4U85 A;  1LG2 A;  2Y8N B;  4E5R A;  4DH0 A;  4JFK A;  3VAW A;  2YSG A;  3MCB A;  4ODQ A;  5HT1 A;  2IUZ A;  3B8S A;  1FKD A;  4LAX A;  1FKK A;  4G50 A;  5HW7 A;  1K9R A;  1FLC A;  5DO2 A;  1FAP A;  4DRN A;  2OLH A;  3B9E A;  4ODR A;  1NWT A;  3KAI A;  2DPE A;  2MF9 A;  5E65 A;  1J6Y A;  1W9U A;  5B8I C;  1RD6 A;  2JMF A;  1EG4 A;  2Y78 A;  4HBO A;  3O5R A;  4MGV A;  4DWS C;  2FDM A;  3GU0 A;  4Z2J A;  3B9A A;  4JFM A;  4ITZ A;  2ZQS A;  3PA7 A;  4P8W A;  3PRB A;  4W9Q A;  2PPO A;  3KAD A;  2F21 A;  2M3O W;  1FKB A;  1HJW A;  1QZ2 A;  3UI5 A;  2YSB A;  2PPP A;  2ZR6 A;  1ZB5 A;  2Q5A A;  5I98 A;  1O6W A;  3O5P A;  2LJ4 A;  3ARO A;  4ZS6 A;  1E6R A;  1GRJ A;  1ZCN A;  4U84 A;  1Q6H A;  2MLZ A;  2PV1 A;  5GQB A;  1E6P A;  5DF0 A;  2DMV A;  1FKR A;  2DG3 A;  2LKN A;  2PV3 A;  3ARV A;  1FKL A;  2QF8 A;  3G6L A;  3O5J A;  1ROU A;  2AWG A;  4Q7N A;  3O5K A;  3O5E A;  2MLX A;  2QRV A;  4MNL A;  3KAH A;  4ZPT R;  2DSV A;  1L1P A;  1OGB A;  4Z2G A;  2XP8 A;  4N19 A;  5HWC A;  1ITX A;  2YSI A;  1TCO C;  3ART A;  1IX5 A;  5DIU A;  1W1V A;  1LL7 A;  1KFW A;  2RUC A;  2YBU A;  3RM8 A;  5CQ2 A;  1U79 A;  1VF8 A;  3WD3 A;  2DT3 A;  2WAD A;  4MTV A;  3WIJ A;  2DK1 A;  1J4R A;  3LUO A;  4GIV A;  1X6N A;  1W9V A;  4ZPW R;  1SYT A;  2WLZ A;  5HTG A;  3NTP A;  2EUL A;  1FFR A;  4KQZ A;  1TK7 A;  4UDM A;  4DIP A;  3KCE A;  5HUA A;  1WNO A;  3IK8 A;  5DEZ A;  1HKK A;  1YAT A;  1W26 A;  2F23 A;  3O5O A;  4TW6 A;  1JCH B;  3WL1 A;  5E64 A;  2XPA A;  4NNR A;  1X6L A;  2DT1 A;  5HWB A;  1QPF A;  3O5M A;  3O5F A;  4QZV B;  4R5E A;  4S3J A;  4Z2K A;  3RFW A;  4W9O A;  4LGX A;  5HW6 A;  1D7H A;  2A3A A;  4P8V A;  1RP5 A;  3UF8 A;  5DIV A;  2WLY A;  4GLX A;  2K8I A;  4JFJ A;  2KXQ A;  4A0U A;  3KZ7 A;  1NMW A;  3CGM A;  4IPX A;  3WD4 A;  1JNT A;  2F2D A;  4NSB A;  2D9F A;  2YSF A;  2XP7 A;  3W4R A;  3MQG A;  3LKX B;  1KT1 A;  3ARR A;  4ODM A;  4JYS A;  3JYJ A;  1H0I A;  3PRA A;  3BXW A;  3CZ8 A;  3UQA A;  1ZBV A;  4QT3 A;  4TNS A;  3IKG A;  4S3K A;  3ARP A;  2XP5 A;  3I6C A;  1W1T A;  4MSP A;  4Z2I A;  3WD1 A;  3WD2 A;  3CHE A;  3WKZ A;  3QOK A;  3ODK A;  1Q6I A;  1E6Z A;  3M85 A;  1LJY A;  1CTN A;  2RSE A;  1HJX A;  2KFW A;  2RUQ A;  4DWS A;  1NWR A;  3FY1 A;  4ODO A;  1EG3 A;  3AS3 A;  1ZU8 A;  4Z2L A;  2ZR5 A;  2AOS A;  2G8Z A;  4KR0 B;  4DRK A;  2DSU A;  3CHF A;  1HJV A;  2XPB A;  2YSH A;  4WKA A;  3PRD A;  4J4O A;  3MQH A;  1ZL1 A;  1OGG A;  5HW8 A;  1LL4 A;  5D75 A;  2A3C A;  1FKJ A;  4TW8 A;  3LKX A;  2RUR A;  3AS0 A;  4TYO A;  4XAK A;  5JH8 A;  4W9P A;  2FKE A;  3UQB A;  1ZBK A;  2ZAJ A;  1JNS A;  1EYM A;  3GTY X;  2PI6 A;  1D7J A;  1XRV A;  4REX A;  2M8I A;  2F4E A;  3KAC A;  1K9Q A;  2LPV A;  4AY1 A;  1HKI A;  1C9H A;  2A3B A;  3FS8 A;  2JZV A;  5AHT A;  1HKM A;  5GPG A;  3GPK A;  1FKF A;  1JND A;  2ZQT A;  1ROT A;  2DSZ A;  1K9T A;  2MPH A;  2G41 A;  4QIB A;  2M08 A;  4TX0 A;  4JFI A;  1Y0O A;  1J4I A;  1EQ3 A;  4IT4 A;  4DRQ A;  3O5G A;  4DRJ A;  3NI6 A;  1EDQ A;  2DJY A;  4LAV A;  5BXJ A;  5HKG A;  3CHC A;  1UR8 A;  3ARQ A;  3KAG A;  3FXY A;  3EY6 A;  3KAB A;  2WK2 A;  2FAP A;  2ZQV A;  3RM9 A;  1W9P A;  2DG4 A;  4BF8 A;  2DWV A;  1EHN A;  5U47 A;  3ARZ A;  4DWS B;  2XP9 A;  2DT0 A;  4W5U A;  2B5U B;  1FKT A;  4WK9 A;  4MAV A;  3LE4 A;  3ARW A;  2MLY A;  2M8J A;  2O9O A;  4PTM A;  1FKH A;  1ZBC A;  2M1I A;  3ALG A;  4IQC A;  2BA1 A;  1D2K A;  3CH9 A;  3H9R B;  2OWO A;  1HKJ A;  4DRO A;  2PV2 A;  4NZC A;  1O6I A;  3MDY B;  2VN1 A;  2A3E A;  4JFL A;  4C02 B;  2M2A A;  5E66 A;  3G6M A;  4ML4 A;  2B31 A;  2L2S A;  1ZK6 A;  4IQ2 A;  3FSB A;  1WB0 A;  3PR9 A;  3KAF A;  4Z2H A;  4GGQ A;  3AS2 A;  2PPN A;  4ODK A;  1QPL A;  1FFQ A;  3RM4 A;  4MNK A;  4R0X A;  4MNM A;  1HXV A;  3AQU A;  1LQ0 A;  2UZ5 A;  1FKS A;  4P8U A;  4DRP A;  4DZ3 A;  2RE3 A;  1R9H A;  1JVW A;  1W1P A;  4FN2 A;  2RUD A;  1NWS A;  3OA5 A;  5GPR A;  2L4J A;  1E9L A;  1ZBW A;  4A0T A;  1NMV A;  1Q1C A;  2EZ5 W;  4ZPV R;  2MDI A;  3ARS A;  4DRM A;  2E45 A;  1GOI A;  2ZR4 A;  3WH0 A;  4WIW A;  3WL0 A;  1XHG A;  2ZQU A;  1TR8 A;  3CHD A;  3UI6 A;  4URI A;  4ODP A;  3O5I A;  3RME A;  1FD9 A;  3CGN A;  1TFV A;  2KO7 A;  3ARU A;  3O5L A;  1UR9 A;  1WMV A;  1LL6 A;  4WKF A;  4L72 B;  3ALF A;  1T11 A;  1JMQ A;  4P8X A;  3JYM A;  3O5D A;  1BKF A;  2P4V A;  4ODN A;  1D7I A;  3TC5 A;  4WKH A;  3TDB A;  4WJX A;  4DWS D;  3NRK A;  2KI3 A;  1I5H W;  1WR7 A;  3IKD A;  2KGJ A;  2JXW A;  1NH6 A;  1D6O A;  5DIT A;  2PN0 A;  3B9D A;  4QT2 A;  3EIP A;  1E44 A;  3JXV A;  2DK7 A;  3AS1 A;  3WQV A;  4L3N A;  5E62 A;  2LGO A;  1F8A B;  1EIB A;  4HAR A;  4TW7 A;  2DT2 A;  4LAY A;  2XP4 A;  1JNE A;  1W1Y A;  2WAE A;  2JX8 A;  3M7N A;  4ODL A;  1E6N A;  2WM0 A;  4LAW A;  1YW5 A;  4G2P A;  3MCB B;  2ESC A;  2ITK A;  2OFN A;  3RGC A;  1FJD A;  1N1A A;  2N87 A;  3WQW A;  1PIN A;  2DG9 A;  2O92 A;  4DZ2 A;  3ARX A;  2ETN A;  3IHZ A;  2KR7 A;  1B6C A;  3O5Q A;  4Q22 A;  2RQS A;  3FAP A;  1BL4 A;  3UQI A;  2XP6 A;  1GPF A;  2DSW A;  1NWU A;  2LAJ A;  1FKI A;  2MNT A;  1H0G A;  1J4H A;  4DRH A;  4DT4 A;  1E15 A;  1GUV A;  1Q6U A;  2XP3 A;  4J4N A;  2IF4 A;  3FSC A;  3OOB A;  1OWQ A;  2VCD A;  1NSG A;  5HBF A;  4DRI A; 
#chains in the Genus database with same CATH homology
 1WAW A;  4U86 A;  2KE0 A;  3UI4 A;  1LG1 A;  4FAP A;  2YBT A;  2YAJ B;  1KT0 A;  4O2T A;  1PBK A;  1F40 A;  3ARY A;  4IT6 A;  3WD0 A;  1FKG A;  4HBE A;  3B7X A;  3TCZ A;  3CNG A;  5J6E A;  1M5Y A;  1A7X A;  1P5Q A;  3PQH A;  2JV4 A;  1SR0 A;  4MPK A;  2PBC A;  5E5W A;  4MNJ A;  3L4H A;  4U85 A;  1LG2 A;  2Y8N B;  4E5R A;  4DH0 A;  4JFK A;  3VAW A;  2YSG A;  3MCB A;  4ODQ A;  5HT1 A;  2IUZ A;  3B8S A;  1FKD A;  4LAX A;  1FKK A;  4G50 A;  5HW7 A;  1K9R A;  1FLC A;  5DO2 A;  1FAP A;  4DRN A;  2OLH A;  3B9E A;  4ODR A;  1NWT A;  3KAI A;  2DPE A;  2MF9 A;  5E65 A;  1J6Y A;  1W9U A;  5B8I C;  1RD6 A;  2JMF A;  1EG4 A;  2Y78 A;  4HBO A;  3O5R A;  4MGV A;  4DWS C;  2FDM A;  4Z2J A;  3B9A A;  4JFM A;  4ITZ A;  2ZQS A;  3PA7 A;  4P8W A;  3PRB A;  4W9Q A;  2PPO A;  3KAD A;  2F21 A;  2M3O W;  1FKB A;  1HJW A;  1QZ2 A;  3UI5 A;  2PPP A;  2YSB A;  2ZR6 A;  1ZB5 A;  2Q5A A;  5I98 A;  1O6W A;  3O5P A;  2LJ4 A;  3ARO A;  4ZS6 A;  1E6R A;  1ZCN A;  4U84 A;  1Q6H A;  2MLZ A;  2PV1 A;  5GQB A;  1E6P A;  5DF0 A;  2DMV A;  1FKR A;  2DG3 A;  2LKN A;  2PV3 A;  3ARV A;  1FKL A;  2QF8 A;  3G6L A;  3O5J A;  1ROU A;  2AWG A;  4Q7N A;  3O5K A;  3O5E A;  2MLX A;  2QRV A;  4MNL A;  3KAH A;  4ZPT R;  2DSV A;  1L1P A;  1OGB A;  4Z2G A;  2XP8 A;  4N19 A;  5HWC A;  1ITX A;  2YSI A;  1TCO C;  3ART A;  1IX5 A;  5DIU A;  1W1V A;  1LL7 A;  1KFW A;  2RUC A;  2YBU A;  3RM8 A;  5CQ2 A;  1U79 A;  1VF8 A;  3WD3 A;  2DT3 A;  2WAD A;  4MTV A;  3WIJ A;  2DK1 A;  1J4R A;  3LUO A;  4GIV A;  1X6N A;  1W9V A;  4ZPW R;  1SYT A;  2WLZ A;  5HTG A;  3NTP A;  1FFR A;  4KQZ A;  1TK7 A;  4DIP A;  3KCE A;  5HUA A;  1WNO A;  3IK8 A;  5DEZ A;  1HKK A;  1YAT A;  1W26 A;  3O5O A;  4TW6 A;  3WL1 A;  5E64 A;  2XPA A;  4NNR A;  1X6L A;  2DT1 A;  5HWB A;  1QPF A;  3O5M A;  3O5F A;  4QZV B;  4R5E A;  4S3J A;  4Z2K A;  3RFW A;  4W9O A;  4LGX A;  5HW6 A;  1D7H A;  2A3A A;  4P8V A;  1RP5 A;  3UF8 A;  5DIV A;  2WLY A;  4GLX A;  2K8I A;  4JFJ A;  2KXQ A;  4A0U A;  3KZ7 A;  1NMW A;  3CGM A;  4IPX A;  3WD4 A;  1JNT A;  2F2D A;  4NSB A;  2D9F A;  2YSF A;  2XP7 A;  3W4R A;  3MQG A;  3LKX B;  1KT1 A;  3ARR A;  4ODM A;  4JYS A;  3JYJ A;  1H0I A;  3PRA A;  3BXW A;  3CZ8 A;  3UQA A;  1ZBV A;  4QT3 A;  4TNS A;  3IKG A;  4S3K A;  3ARP A;  2XP5 A;  3I6C A;  1W1T A;  4MSP A;  4Z2I A;  3WD1 A;  3WD2 A;  3CHE A;  3WKZ A;  3QOK A;  3ODK A;  1Q6I A;  1E6Z A;  3M85 A;  1LJY A;  1CTN A;  2RSE A;  1HJX A;  2KFW A;  2RUQ A;  4DWS A;  1NWR A;  3FY1 A;  4ODO A;  1EG3 A;  3AS3 A;  1ZU8 A;  4Z2L A;  2ZR5 A;  2AOS A;  2G8Z A;  4KR0 B;  4DRK A;  2DSU A;  3CHF A;  1HJV A;  2XPB A;  2YSH A;  4WKA A;  3PRD A;  4J4O A;  3MQH A;  1ZL1 A;  1OGG A;  5HW8 A;  1LL4 A;  5D75 A;  2A3C A;  1FKJ A;  4TW8 A;  3LKX A;  2RUR A;  3AS0 A;  4TYO A;  4XAK A;  5JH8 A;  4W9P A;  2FKE A;  3UQB A;  1ZBK A;  2ZAJ A;  1JNS A;  1EYM A;  2PI6 A;  1D7J A;  1XRV A;  4REX A;  2M8I A;  2F4E A;  3KAC A;  1K9Q A;  2LPV A;  4AY1 A;  1HKI A;  1C9H A;  2A3B A;  3FS8 A;  2JZV A;  5AHT A;  1HKM A;  5GPG A;  3GPK A;  1FKF A;  1JND A;  2ZQT A;  1ROT A;  2DSZ A;  1K9T A;  2MPH A;  2G41 A;  4QIB A;  2M08 A;  4TX0 A;  4JFI A;  1Y0O A;  1J4I A;  1EQ3 A;  4IT4 A;  4DRQ A;  3O5G A;  4DRJ A;  3NI6 A;  1EDQ A;  2DJY A;  4LAV A;  5BXJ A;  5HKG A;  3CHC A;  1UR8 A;  3ARQ A;  3KAG A;  3FXY A;  3EY6 A;  3KAB A;  2WK2 A;  2FAP A;  2ZQV A;  3RM9 A;  1W9P A;  2DG4 A;  4BF8 A;  2DWV A;  1EHN A;  5U47 A;  3ARZ A;  4DWS B;  2XP9 A;  2DT0 A;  4W5U A;  1FKT A;  4WK9 A;  4MAV A;  3LE4 A;  3ARW A;  2MLY A;  2M8J A;  2O9O A;  4PTM A;  1FKH A;  1ZBC A;  2M1I A;  3ALG A;  4IQC A;  2BA1 A;  1D2K A;  3CH9 A;  3H9R B;  2OWO A;  1HKJ A;  4DRO A;  2PV2 A;  4NZC A;  1O6I A;  3MDY B;  2VN1 A;  2A3E A;  4JFL A;  4C02 B;  2M2A A;  5E66 A;  3G6M A;  4ML4 A;  2B31 A;  2L2S A;  1ZK6 A;  4IQ2 A;  3FSB A;  1WB0 A;  3PR9 A;  3KAF A;  4Z2H A;  4GGQ A;  3AS2 A;  2PPN A;  4ODK A;  1QPL A;  1FFQ A;  3RM4 A;  4MNK A;  4R0X A;  4MNM A;  1HXV A;  3AQU A;  1LQ0 A;  2UZ5 A;  1FKS A;  4P8U A;  4DRP A;  4DZ3 A;  2RE3 A;  1R9H A;  1JVW A;  1W1P A;  4FN2 A;  2RUD A;  1NWS A;  3OA5 A;  5GPR A;  2L4J A;  1E9L A;  1ZBW A;  4A0T A;  1NMV A;  1Q1C A;  2EZ5 W;  4ZPV R;  2MDI A;  3ARS A;  4DRM A;  2E45 A;  1GOI A;  2ZR4 A;  3WH0 A;  4WIW A;  3WL0 A;  1XHG A;  2ZQU A;  1TR8 A;  3CHD A;  3UI6 A;  4URI A;  4ODP A;  3O5I A;  3RME A;  1FD9 A;  3CGN A;  1TFV A;  2KO7 A;  3ARU A;  3O5L A;  1UR9 A;  1WMV A;  1LL6 A;  4WKF A;  4L72 B;  3ALF A;  1T11 A;  1JMQ A;  4P8X A;  3JYM A;  3O5D A;  1BKF A;  4ODN A;  1D7I A;  3TC5 A;  4WKH A;  3TDB A;  4WJX A;  4DWS D;  3NRK A;  2KI3 A;  1I5H W;  1WR7 A;  3IKD A;  2KGJ A;  2JXW A;  1NH6 A;  1D6O A;  5DIT A;  4QT2 A;  3B9D A;  3JXV A;  2DK7 A;  3AS1 A;  3WQV A;  4L3N A;  5E62 A;  2LGO A;  1F8A B;  1EIB A;  4HAR A;  4TW7 A;  2DT2 A;  4LAY A;  2XP4 A;  1JNE A;  1W1Y A;  2WAE A;  2JX8 A;  3M7N A;  4ODL A;  1E6N A;  2WM0 A;  4LAW A;  1YW5 A;  4G2P A;  3MCB B;  2ESC A;  2ITK A;  2OFN A;  3RGC A;  1FJD A;  1N1A A;  2N87 A;  3WQW A;  1PIN A;  2DG9 A;  2O92 A;  4DZ2 A;  3ARX A;  3IHZ A;  2KR7 A;  1B6C A;  3O5Q A;  4Q22 A;  2RQS A;  3FAP A;  1BL4 A;  3UQI A;  2XP6 A;  1GPF A;  2DSW A;  1NWU A;  2LAJ A;  1FKI A;  2MNT A;  1H0G A;  1J4H A;  4DRH A;  4DT4 A;  1E15 A;  1GUV A;  1Q6U A;  2XP3 A;  4J4N A;  2IF4 A;  3FSC A;  3OOB A;  1OWQ A;  2VCD A;  1NSG A;  5HBF A;  4DRI A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...