2XP6A

Discovery of cell-active phenyl-imidazole pin1 inhibitors by structure-guided fragment evolution
Total Genus 45
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
45
sequence length
157
structure length
145
Chain Sequence
LPPGWEKAMSRSSGRVYYFNHITNASQWERPSEPARVRCSHLLVKHSQSRRPSSWRQEKITRTKEEALELINGYIQKIKSGEEDFESLASQFSDCSSAKARGDLGAFSRGQMAKPFEDASFALRTGEMSGPVFTDSGIHIILRTE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Isomerase
molecule keywords PEPTIDYL-PROLYL CIS-TRANS ISOMERASE NIMA-INTERACTING 1
publication title Discovery of Cell-Active Phenyl-Imidazole Pin1 Inhibitors by Structure-Guided Fragment Evolution.
pubmed doi rcsb
source organism Homo sapiens
total genus 45
structure length 145
sequence length 157
ec nomenclature ec 5.2.1.8: Peptidylprolyl isomerase.
pdb deposition date 2010-08-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00397 WW WW domain
A PF00639 Rotamase PPIC-type PPIASE domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.20.70.10 Mainly Beta Single Sheet Ubiquitin Ligase Nedd4; Chain: W; Ubiquitin Ligase Nedd4; Chain: W; 2xp6A01
3.10.50.40 Alpha Beta Roll Chitinase A; domain 3 Chitinase A; domain 3 2xp6A02
4TNSA 1FD9A 1F40A 4TX0A 4FAPA 3O5QA 1F8AB 1PINA 1EQ3A 4LAVA 4DRQA 1Q1CA 1FKSA 4JYSA 2MNTA 2N87A 2M8IA 2MPHA 4U85A 1J4IA 3B7XA 3O5PA 4J4OA 3O5LA 2AWGA 2RUQA 4MGVA 4W9QA 4LAYA 5DIVA 3O5DA 2M08A 1FKIA 3IKDA 2LGOA 1KT1A 4ODOA 2ZR5A 5AHTA 3O5FA 4DRJA 1JNTA 1YW5A 3O5JA 4DH0A 4REXA 2PPNA 3O5IA 3PRBA 1QZ2A 2ZAJA 4GIVA 2LAJA 4TYOA 1A7XA 3UI4A 2ZQVA 1L1PA 1QPFA 3CGMA 2D9FA 1N1AA 1K9QA 4J4NA 4TW7A 4DRKA 4JFIA 3VAWA 2K8IA 5DITA 5J6EA 2Y78A 3KAIA 4DIPA 5HUAA 3GPKA 4ODRA 2PV3A 2DMVA 2MLXA 4DRHA 1FJDA 3JYMA 1BL4A 5HKGA 4JFKA 1I5HW 1W26A 1EG4A 1TK7A 5HW7A 3TCZA 4MSPA 2DK7A 3UQBA 3PRDA 3LE4A 2MLZA 1O6WA 1Q6UA 2KR7A 1FKFA 1EYMA 2RURA 2ZQTA 3WH0A 2EZ5W 2YSFA 4QT3A 3O5MA 2YSGA 4JFMA 3KAGA 1ZK6A 3UI6A 1FAPA 4DRMA 4GGQA 1FKGA 4ODQA 2XP6A 2LPVA 2PV1A 2YSHA 4QT2A 2FAPA 2KGJA 2F21A 2F2DA 2XP3A 2LKNA 4W9OA 1BKFA 2LJ4A 1HXVA 3ODKA 2PBCA 2PPOA 1J6YA 4C02B 2DG3A 2XP8A 3KZ7A 4QIBA 1FKHA 2DJYA 4G2PA 4JFLA 2VN1A 2ZR6A 1Q6IA 1FKTA 4U84A 2ITKA 1NMVA 1D6OA 2JX8A 2ZQSA 5D75A 3MDYB 3RFWA 2PV2A 5HT1A 5HWBA 3LUOA 3UQIA 4DZ2A 2MF9A 4U86A 2MLYA 1J4RA 2DG4A 3L4HA 1ZCNA 5HTGA 3M7NA 3IKGA 4DZ3A 2E45A 3JXVA 1FKLA 1FKRA 3KCEA 2PPPA 2M3OW 3OOBA 1T11A 2JZVA 2F4EA 4ODKA 2L4JA 3CGNA 5HW6A 2DK1A 2IF4A 1D7HA 3TC5A 4IQCA 2JMFA 1NSGA 1ROUA 4DRPA 3O5GA 1C9HA 4TW8A 4DT4A 2ZR4A 4R0XA 3RGCA 3NRKA 3NTPA 4LAWA 1TCOC 1FKJA 2FKEA 3PA7A 2JXWA 1WR7A 4ODPA 5HW8A 2BA1A 2L2SA 5B8IC 2DG9A 3O5OA 2M1IA 1WMVA 2Q5AA 2YSIA 3CNGA 2M2AA 1FKDA 5CQ2A 5HWCA 1K9RA 2RSEA 1D7IA 4W9PA 2RE3A 1J4HA 3O5EA 4DRIA 3KADA 1B6CA 4ITZA 2VCDA 1Q6HA 3KACA 3KAFA 1ROTA 3EY6A 4ODMA 2YSBA 4IQ2A 4DRNA 1FKKA 2XP5A 2KFWA 3I6CA 4NNRA 1QPLA 3IHZA 4LAXA 3O5RA 2KE0A 4IPXA 4E5RA 4N19A 3UQAA 3NI6A 1YATA 4TW6A 4ODLA 4BF8A 2DWVA 2MDIA 3KAHA 3M85A 2KXQA 4JFJA 1JMQA 5BXJA 2XP9A 2ZQUA 1JNSA 2M8JA 2KO7A 3FAPA 1Y0OA 4O2TA 3O5KA 1NMWA 2RQSA 3UI5A 2XP7A 2OFNA 2XP4A 2XPBA 2UZ5A 1KT0A 3IK8A 4DROA 1JVWA 4ODNA 3KABA 1EG3A 1P5QA 5GPGA 3H9RB 2RUCA 1M5YA 2KI3A 2XPAA 3JYJA 4FN2A 1FKBA 3TDBA 1U79A 5I98A 3UF8A 5DIUA 1PBKA 1D7JA 2RUDA 4G50A 1R9HA 2JV4A
chains in the Genus database with same CATH superfamily
4TNSA 1ZB5A 1FD9A 1F40A 4TX0A 2ESCA 2A3CA 4P8VA 4Z2HA 4UDMA 4FAPA 1WNOA 2WLYA 3O5QA 1F8AB 1PINA 3G6MA 3QOKA 1EQ3A 2QF8A 2EULA 1TFVA 4LAVA 4DRQA 1H0IA 1Q1CA 1LL4A 3ARVA 3RM9A 4L3NA 1FKSA 4MPKA 4JYSA 3LKXA 2MNTA 2N87A 2M8IA 2MPHA 1HKJA 1ZBKA 3ARWA 4U85A 2PI6A 1J4IA 4Z2KA 3B7XA 3O5PA 4J4OA 3O5LA 2AWGA 4ZPTR 2RUQA 4MGVA 4W9QA 4LAYA 1W1VA 3CHEA 5E62A 5DIVA 4A0TA 2AOSA 3O5DA 4P8XA 2M08A 2FDMA 1FKIA 3IKDA 4WJXA 2LGOA 4MNKA 4R5EA 2OLHA 1KT1A 4ODOA 2ZR5A 5AHTA 4HARA 2F23A 3O5FA 3BXWA 4DRJA 1JNTA 1YW5A 3O5JA 1FFQA 2YBUA 5GQBA 4DH0A 4REXA 1LQ0A 2PPNA 3O5IA 3PRBA 1QZ2A 2ZAJA 3W4RA 5DO2A 4GIVA 3RM8A 1E44A 3GTYX 2LAJA 4TYOA 3WD2A 4WKFA 2WAEA 1A7XA 3MCBB 3UI4A 1LL6A 2ZQVA 1L1PA 1QPFA 3CGMA 4A0UA 2QRVA 2D9FA 1N1AA 1K9QA 2G41A 4J4NA 4ZS6A 3RMEA 4TW7A 4DRKA 1X6NA 4JFIA 3VAWA 5HBFA 2K8IA 5DITA 1EDQA 5J6EA 2Y78A 1HJWA 3KAIA 3G6LA 3ARXA 4DIPA 1H0GA 5HUAA 3GPKA 3B9EA 4ODRA 2PV3A 3MQGA 3B9AA 2DMVA 2WLZA 2MLXA 3CHCA 5DF0A 1IX5A 4DRHA 1FJDA 3JYMA 3AS1A 1BL4A 5HKGA 4JFKA 1TR8A 1I5HW 1W26A 2DSVA 1EG4A 2DSUA 1W1TA 3MQHA 1XRVA 3WQWA 4DWSB 1TK7A 1HKMA 5HW7A 3TCZA 4MSPA 2DK7A 3UQBA 2O92A 3PRDA 3LE4A 4LGXA 4DWSC 2MLZA 4ML4A 3FXYA 1O6WA 1Q6UA 2KR7A 3GU0A 1FKFA 1EYMA 2RURA 2ZQTA 3WH0A 2PN0A 4KR0B 4NSBA 4KQZA 2EZ5W 5E5WA 2DT3A 2YSFA 4WK9A 4QT3A 3O5MA 2YSGA 2DT0A 4JFMA 3WKZA 3KAGA 1ZK6A 3UI6A 1FAPA 3FSBA 4Z2LA 1ZL1A 1WB0A 4MTVA 4Q22A 4WIWA 2P4VA 3WD0A 4DRMA 1OWQA 4GGQA 1FKGA 4ODQA 4MNLA 3ARUA 4HBEA 2XP6A 1E6PA 2LPVA 2PV1A 2YSHA 4QT2A 2FAPA 1ITXA 2KGJA 2F21A 2F2DA 1NH6A 2XP3A 2WK2A 1GOIA 2LKNA 3MCBA 4W9OA 3ALGA 1BKFA 2LJ4A 1HXVA 1WAWA 1ZBVA 3ODKA 1GUVA 2PBCA 2PPOA 2A3AA 1J6YA 4C02B 1JCHB 3AROA 2DG3A 2XP8A 3WD1A 3KZ7A 4QIBA 3WL0A 1FKHA 2WADA 1EIBA 5DEZA 2DJYA 4G2PA 4JFLA 1HJXA 1RP5A 5E65A 2VN1A 2ZR6A 1Q6IA 4URIA 1FKTA 4U84A 2ITKA 1NMVA 1D6OA 3B9DA 2JX8A 2ZQSA 3ARZA 5D75A 3AS3A 3MDYB 3RFWA 2PV2A 5HT1A 4Q7NA 1LG1A 1ZBWA 5HWBA 1E6NA 3LUOA 4DWSA 3UQIA 3B8SA 4DZ2A 2MF9A 1HJVA 4U86A 2MLYA 1FFRA 1FLCA 3PQHA 1J4RA 2DG4A 3L4HA 1E6ZA 2A3EA 3ALFA 4MAVA 1ZCNA 1O6IA 3WQVA 5HTGA 3M7NA 3IKGA 2B5UB 3WD4A 1UR8A 4IT4A 2E45A 4DZ3A 1NWRA 3JXVA 1FKLA 2B31A 1W9VA 4QZVB 1FKRA 3KCEA 1W1PA 3CZ8A 2PPPA 2M3OW 3OOBA 1T11A 2JZVA 1NWSA 2OWOA 2F4EA 4ODKA 2L4JA 3CGNA 5HW6A 2DK1A 2IF4A 5E66A 1D7HA 3TC5A 1GRJA 4IQCA 2JMFA 1NSGA 1ROUA 4DRPA 4XAKA 3O5GA 1C9HA 4Z2JA 1K9TA 1W1YA 4W5UA 4TW8A 4DT4A 2ZR4A 4R0XA 1E15A 1E9LA 1JNDA 3RGCA 3NRKA 3NTPA 4LAWA 1TCOC 1FKJA 2WM0A 3WL1A 3AS2A 4DWSD 2FKEA 3PA7A 2JXWA 4L72B 4AY1A 1WR7A 4ODPA 5HW8A 2BA1A 4S3JA 2L2SA 1LJYA 3CHFA 5B8IC 1NWUA 2YBTA 2O9OA 1HKIA 2DG9A 3O5OA 4MNMA 2M1IA 3BMBA 1WMVA 3ARRA 2Q5AA 2YSIA 3CNGA 2M2AA 4P8UA 1FKDA 1XHGA 5CQ2A 5HWCA 1K9RA 2RSEA 3FSCA 4HBOA 1D7IA 4W9PA 2RE3A 3PRAA 1J4HA 1OGGA 3O5EA 4DRIA 3KADA 1B6CA 3ARQA 4ITZA 3WIJA 2VCDA 1Q6HA 3KACA 3KAFA 1D2KA 1ROTA 2Y8NB 3EY6A 4ODMA 5JH8A 1NWTA 3PR9A 4S3KA 4ZPWR 2YSBA 2ETNA 4IQ2A 4P8WA 1KFWA 4DRNA 1FKKA 2XP5A 2KFWA 3I6CA 4NNRA 1QPLA 3IHZA 4LAXA 3AS0A 1RD6A 2G8ZA 3ARYA 3O5RA 2KE0A 4IPXA 4Z2IA 4NZCA 4E5RA 4N19A 1UR9A 3UQAA 3ARPA 1VF8A 3NI6A 3LKXB 1YATA 2DT1A 4TW6A 4ODLA 5U47A 4BF8A 2DWVA 2MDIA 3KAHA 3M85A 2KXQA 4JFJA 1JMQA 5BXJA 2XP9A 2ZQUA 1JNSA 2M8JA 2KO7A 3FAPA 1Y0OA 1HKKA 3O5KA 4O2TA 3WD3A 1NMWA 2RQSA 3UI5A 2XP7A 2DSWA 2OFNA 2XP4A 2XPBA 2UZ5A 1KT0A 3IK8A 4DROA 1X6LA 1JVWA 3ARSA 3ARTA 4ODNA 3KABA 3AQUA 3CH9A 1ZU8A 3FY1A 1EG3A 1P5QA 5GPGA 1JNEA 3H9RB 2DT2A 2RUCA 4GLXA 1ZBCA 1W9PA 4WKHA 1M5YA 1W9UA 2A3BA 2XPAA 2KI3A 4MNJA 4PTMA 1SR0A 4ZPVR 3JYJA 4WKAA 1LG2A 3CHDA 4FN2A 1FKBA 1CTNA 1LL7A 2IUZA 1EHNA 3OA5A 3TDBA 1OGBA 1E6RA 1U79A 5I98A 2DSZA 3UF8A 1GPFA 5E64A 5DIUA 1PBKA 3FS8A 5GPRA 1D7JA 2RUDA 4IT6A 4Z2GA 4G50A 3RM4A 2DPEA 1SYTA 1R9HA 3EIPA 2JV4A 2YAJB
chains in the Genus database with same CATH topology
4TNSA 1ZB5A 1FD9A 1F40A 4TX0A 2ESCA 2A3CA 4P8VA 4Z2HA 4FAPA 1WNOA 2WLYA 3O5QA 1F8AB 1PINA 3G6MA 3QOKA 1EQ3A 2QF8A 1TFVA 4LAVA 4DRQA 1H0IA 1Q1CA 1LL4A 3ARVA 3RM9A 4L3NA 1FKSA 4MPKA 4JYSA 3LKXA 2MNTA 2N87A 2M8IA 2MPHA 1HKJA 1ZBKA 3ARWA 4U85A 2PI6A 1J4IA 4Z2KA 3B7XA 3O5PA 4J4OA 3O5LA 2AWGA 4ZPTR 2RUQA 4MGVA 4W9QA 4LAYA 1W1VA 3CHEA 5E62A 5DIVA 4A0TA 2AOSA 3O5DA 4P8XA 2M08A 2FDMA 1FKIA 3IKDA 4WJXA 2LGOA 4MNKA 4R5EA 2OLHA 1KT1A 4ODOA 2ZR5A 5AHTA 4HARA 3O5FA 3BXWA 4DRJA 1JNTA 1YW5A 3O5JA 1FFQA 2YBUA 5GQBA 4DH0A 4REXA 1LQ0A 2PPNA 3O5IA 3PRBA 1QZ2A 2ZAJA 3W4RA 5DO2A 4GIVA 3RM8A 2LAJA 4TYOA 3WD2A 4WKFA 2WAEA 1A7XA 3MCBB 3UI4A 1LL6A 2ZQVA 1L1PA 1QPFA 3CGMA 4A0UA 2QRVA 2D9FA 1N1AA 1K9QA 2G41A 4J4NA 4ZS6A 3RMEA 4TW7A 4DRKA 1X6NA 4JFIA 3VAWA 5HBFA 2K8IA 5DITA 1EDQA 5J6EA 2Y78A 1HJWA 3KAIA 3G6LA 3ARXA 4DIPA 1H0GA 5HUAA 3GPKA 3B9EA 4ODRA 2PV3A 3MQGA 3B9AA 2DMVA 2WLZA 2MLXA 3CHCA 5DF0A 1IX5A 4DRHA 1FJDA 3JYMA 3AS1A 1BL4A 5HKGA 4JFKA 1TR8A 1I5HW 1W26A 2DSVA 1EG4A 2DSUA 1W1TA 3MQHA 1XRVA 3WQWA 4DWSB 1TK7A 1HKMA 5HW7A 3TCZA 4MSPA 2DK7A 3UQBA 2O92A 3PRDA 3LE4A 4LGXA 4DWSC 2MLZA 4ML4A 3FXYA 1O6WA 1Q6UA 2KR7A 1FKFA 1EYMA 2RURA 2ZQTA 3WH0A 4KR0B 4NSBA 4KQZA 2EZ5W 5E5WA 2DT3A 2YSFA 4WK9A 4QT3A 3O5MA 2YSGA 2DT0A 4JFMA 3WKZA 3KAGA 1ZK6A 3UI6A 1FAPA 3FSBA 4Z2LA 1ZL1A 1WB0A 4MTVA 4Q22A 4WIWA 4DRMA 3WD0A 1OWQA 4GGQA 1FKGA 4ODQA 4MNLA 3ARUA 4HBEA 2XP6A 1E6PA 2LPVA 2PV1A 2YSHA 4QT2A 2FAPA 1ITXA 2KGJA 2F21A 2F2DA 1NH6A 2XP3A 2WK2A 1GOIA 2LKNA 3MCBA 4W9OA 3ALGA 1BKFA 2LJ4A 1HXVA 1WAWA 1ZBVA 3ODKA 1GUVA 2PBCA 2PPOA 2A3AA 1J6YA 4C02B 3AROA 2DG3A 2XP8A 3WD1A 3KZ7A 4QIBA 3WL0A 1FKHA 2WADA 1EIBA 5DEZA 2DJYA 4G2PA 4JFLA 1HJXA 1RP5A 5E65A 2VN1A 2ZR6A 1Q6IA 4URIA 1FKTA 4U84A 2ITKA 1NMVA 1D6OA 3B9DA 2JX8A 2ZQSA 3ARZA 5D75A 3AS3A 3MDYB 3RFWA 2PV2A 5HT1A 4Q7NA 1LG1A 1ZBWA 5HWBA 1E6NA 3LUOA 4DWSA 3UQIA 3B8SA 4DZ2A 2MF9A 1HJVA 4U86A 2MLYA 1FFRA 1FLCA 3PQHA 1J4RA 2DG4A 3L4HA 1E6ZA 2A3EA 3ALFA 4MAVA 1ZCNA 1O6IA 3WQVA 5HTGA 3M7NA 3IKGA 3WD4A 1UR8A 4IT4A 2E45A 4DZ3A 1NWRA 3JXVA 1FKLA 2B31A 1W9VA 4QZVB 1FKRA 3KCEA 1W1PA 3CZ8A 2PPPA 2M3OW 3OOBA 1T11A 2JZVA 1NWSA 2OWOA 2F4EA 4ODKA 2L4JA 3CGNA 5HW6A 2DK1A 2IF4A 5E66A 1D7HA 3TC5A 4IQCA 2JMFA 1NSGA 1ROUA 4DRPA 4XAKA 3O5GA 1C9HA 4Z2JA 1K9TA 1W1YA 4W5UA 4TW8A 4DT4A 2ZR4A 4R0XA 1E15A 1E9LA 1JNDA 3RGCA 3NRKA 3NTPA 4LAWA 1TCOC 1FKJA 2WM0A 3WL1A 3AS2A 4DWSD 2FKEA 3PA7A 2JXWA 4L72B 4AY1A 1WR7A 4ODPA 5HW8A 2BA1A 4S3JA 2L2SA 1LJYA 3CHFA 5B8IC 1NWUA 2YBTA 2O9OA 1HKIA 2DG9A 3O5OA 4MNMA 2M1IA 1WMVA 3ARRA 2Q5AA 2YSIA 3CNGA 2M2AA 4P8UA 1FKDA 1XHGA 5CQ2A 5HWCA 1K9RA 2RSEA 3FSCA 4HBOA 1D7IA 4W9PA 2RE3A 3PRAA 1J4HA 1OGGA 3O5EA 4DRIA 3KADA 1B6CA 3ARQA 4ITZA 3WIJA 2VCDA 1Q6HA 3KACA 3KAFA 1D2KA 1ROTA 2Y8NB 3EY6A 4ODMA 5JH8A 1NWTA 3PR9A 4S3KA 4ZPWR 2YSBA 4IQ2A 4P8WA 1KFWA 4DRNA 1FKKA 2XP5A 2KFWA 3I6CA 4NNRA 1QPLA 3IHZA 4LAXA 3AS0A 1RD6A 2G8ZA 3ARYA 3O5RA 2KE0A 4IPXA 4Z2IA 4NZCA 4E5RA 4N19A 1UR9A 3UQAA 3ARPA 1VF8A 3NI6A 3LKXB 1YATA 2DT1A 4TW6A 4ODLA 5U47A 4BF8A 2DWVA 2MDIA 3KAHA 3M85A 2KXQA 4JFJA 1JMQA 5BXJA 2XP9A 2ZQUA 1JNSA 2M8JA 2KO7A 3FAPA 1Y0OA 1HKKA 3O5KA 4O2TA 3WD3A 1NMWA 2RQSA 3UI5A 2XP7A 2DSWA 2OFNA 2XP4A 2XPBA 2UZ5A 1KT0A 3IK8A 4DROA 1X6LA 1JVWA 3ARSA 3ARTA 4ODNA 3KABA 3AQUA 3CH9A 1ZU8A 3FY1A 1EG3A 1P5QA 5GPGA 1JNEA 3H9RB 2DT2A 2RUCA 4GLXA 1ZBCA 1W9PA 4WKHA 1M5YA 1W9UA 2A3BA 2XPAA 2KI3A 4MNJA 4PTMA 1SR0A 4ZPVR 3JYJA 4WKAA 1LG2A 3CHDA 4FN2A 1FKBA 1CTNA 1LL7A 2IUZA 1EHNA 3OA5A 3TDBA 1OGBA 1E6RA 1U79A 5I98A 2DSZA 3UF8A 1GPFA 5E64A 5DIUA 1PBKA 3FS8A 5GPRA 1D7JA 2RUDA 4IT6A 4Z2GA 4G50A 3RM4A 2DPEA 1SYTA 1R9HA 2JV4A 2YAJB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4TNS A;  1FD9 A;  1F40 A;  4TX0 A;  4FAP A;  3O5Q A;  1F8A B;  1PIN A;  1EQ3 A;  4LAV A;  4DRQ A;  1Q1C A;  1FKS A;  4JYS A;  2MNT A;  2N87 A;  2M8I A;  2MPH A;  4U85 A;  1J4I A;  3B7X A;  3O5P A;  4J4O A;  3O5L A;  2AWG A;  2RUQ A;  4MGV A;  4W9Q A;  4LAY A;  5DIV A;  3O5D A;  2M08 A;  1FKI A;  3IKD A;  2LGO A;  1KT1 A;  4ODO A;  2ZR5 A;  5AHT A;  3O5F A;  4DRJ A;  1JNT A;  1YW5 A;  3O5J A;  4DH0 A;  4REX A;  2PPN A;  3O5I A;  3PRB A;  1QZ2 A;  2ZAJ A;  4GIV A;  2LAJ A;  4TYO A;  1A7X A;  3UI4 A;  2ZQV A;  1L1P A;  1QPF A;  3CGM A;  2D9F A;  1N1A A;  1K9Q A;  4J4N A;  4TW7 A;  4DRK A;  4JFI A;  3VAW A;  2K8I A;  5DIT A;  5J6E A;  2Y78 A;  3KAI A;  4DIP A;  5HUA A;  3GPK A;  4ODR A;  2PV3 A;  2DMV A;  2MLX A;  4DRH A;  1FJD A;  3JYM A;  1BL4 A;  5HKG A;  4JFK A;  1I5H W;  1W26 A;  1EG4 A;  1TK7 A;  5HW7 A;  3TCZ A;  4MSP A;  2DK7 A;  3UQB A;  3PRD A;  3LE4 A;  2MLZ A;  1O6W A;  1Q6U A;  2KR7 A;  1FKF A;  1EYM A;  2RUR A;  2ZQT A;  3WH0 A;  2EZ5 W;  2YSF A;  4QT3 A;  3O5M A;  2YSG A;  4JFM A;  3KAG A;  1ZK6 A;  3UI6 A;  1FAP A;  4DRM A;  4GGQ A;  1FKG A;  4ODQ A;  2XP6 A;  2LPV A;  2PV1 A;  2YSH A;  4QT2 A;  2FAP A;  2KGJ A;  2F21 A;  2F2D A;  2XP3 A;  2LKN A;  4W9O A;  1BKF A;  2LJ4 A;  1HXV A;  3ODK A;  2PBC A;  2PPO A;  1J6Y A;  4C02 B;  2DG3 A;  2XP8 A;  3KZ7 A;  4QIB A;  1FKH A;  2DJY A;  4G2P A;  4JFL A;  2VN1 A;  2ZR6 A;  1Q6I A;  1FKT A;  4U84 A;  2ITK A;  1NMV A;  1D6O A;  2JX8 A;  2ZQS A;  5D75 A;  3MDY B;  3RFW A;  2PV2 A;  5HT1 A;  5HWB A;  3LUO A;  3UQI A;  4DZ2 A;  2MF9 A;  4U86 A;  2MLY A;  1J4R A;  2DG4 A;  3L4H A;  1ZCN A;  5HTG A;  3M7N A;  3IKG A;  4DZ3 A;  2E45 A;  3JXV A;  1FKL A;  1FKR A;  3KCE A;  2PPP A;  2M3O W;  3OOB A;  1T11 A;  2JZV A;  2F4E A;  4ODK A;  2L4J A;  3CGN A;  5HW6 A;  2DK1 A;  2IF4 A;  1D7H A;  3TC5 A;  4IQC A;  2JMF A;  1NSG A;  1ROU A;  4DRP A;  3O5G A;  1C9H A;  4TW8 A;  4DT4 A;  2ZR4 A;  4R0X A;  3RGC A;  3NRK A;  3NTP A;  4LAW A;  1TCO C;  1FKJ A;  2FKE A;  3PA7 A;  2JXW A;  1WR7 A;  4ODP A;  5HW8 A;  2BA1 A;  2L2S A;  5B8I C;  2DG9 A;  3O5O A;  2M1I A;  1WMV A;  2Q5A A;  2YSI A;  3CNG A;  2M2A A;  1FKD A;  5CQ2 A;  5HWC A;  1K9R A;  2RSE A;  1D7I A;  4W9P A;  2RE3 A;  1J4H A;  3O5E A;  4DRI A;  3KAD A;  1B6C A;  4ITZ A;  2VCD A;  1Q6H A;  3KAC A;  3KAF A;  1ROT A;  3EY6 A;  4ODM A;  2YSB A;  4IQ2 A;  4DRN A;  1FKK A;  2XP5 A;  2KFW A;  3I6C A;  4NNR A;  1QPL A;  3IHZ A;  4LAX A;  3O5R A;  2KE0 A;  4IPX A;  4E5R A;  4N19 A;  3UQA A;  3NI6 A;  1YAT A;  4TW6 A;  4ODL A;  4BF8 A;  2DWV A;  2MDI A;  3KAH A;  3M85 A;  2KXQ A;  4JFJ A;  1JMQ A;  5BXJ A;  2XP9 A;  2ZQU A;  1JNS A;  2M8J A;  2KO7 A;  3FAP A;  1Y0O A;  4O2T A;  3O5K A;  1NMW A;  2RQS A;  3UI5 A;  2XP7 A;  2OFN A;  2XP4 A;  2XPB A;  2UZ5 A;  1KT0 A;  3IK8 A;  4DRO A;  1JVW A;  4ODN A;  3KAB A;  1EG3 A;  1P5Q A;  5GPG A;  3H9R B;  2RUC A;  1M5Y A;  2KI3 A;  2XPA A;  3JYJ A;  4FN2 A;  1FKB A;  3TDB A;  1U79 A;  5I98 A;  3UF8 A;  5DIU A;  1PBK A;  1D7J A;  2RUD A;  4G50 A;  1R9H A;  2JV4 A; 
#chains in the Genus database with same CATH topology
 4TNS A;  1ZB5 A;  1FD9 A;  1F40 A;  4TX0 A;  2ESC A;  2A3C A;  4P8V A;  4Z2H A;  4UDM A;  4FAP A;  1WNO A;  2WLY A;  3O5Q A;  1F8A B;  1PIN A;  3G6M A;  3QOK A;  1EQ3 A;  2QF8 A;  2EUL A;  1TFV A;  4LAV A;  4DRQ A;  1H0I A;  1Q1C A;  1LL4 A;  3ARV A;  3RM9 A;  4L3N A;  1FKS A;  4MPK A;  4JYS A;  3LKX A;  2MNT A;  2N87 A;  2M8I A;  2MPH A;  1HKJ A;  1ZBK A;  3ARW A;  4U85 A;  2PI6 A;  1J4I A;  4Z2K A;  3B7X A;  3O5P A;  4J4O A;  3O5L A;  2AWG A;  4ZPT R;  2RUQ A;  4MGV A;  4W9Q A;  4LAY A;  1W1V A;  3CHE A;  5E62 A;  5DIV A;  4A0T A;  2AOS A;  3O5D A;  4P8X A;  2M08 A;  2FDM A;  1FKI A;  3IKD A;  4WJX A;  2LGO A;  4MNK A;  4R5E A;  2OLH A;  1KT1 A;  4ODO A;  2ZR5 A;  5AHT A;  4HAR A;  2F23 A;  3O5F A;  3BXW A;  4DRJ A;  1JNT A;  1YW5 A;  3O5J A;  1FFQ A;  2YBU A;  5GQB A;  4DH0 A;  4REX A;  1LQ0 A;  2PPN A;  3O5I A;  3PRB A;  1QZ2 A;  2ZAJ A;  3W4R A;  5DO2 A;  4GIV A;  3RM8 A;  1E44 A;  3GTY X;  2LAJ A;  4TYO A;  3WD2 A;  4WKF A;  2WAE A;  1A7X A;  3MCB B;  3UI4 A;  1LL6 A;  2ZQV A;  1L1P A;  1QPF A;  3CGM A;  4A0U A;  2QRV A;  2D9F A;  1N1A A;  1K9Q A;  2G41 A;  4J4N A;  4ZS6 A;  3RME A;  4TW7 A;  4DRK A;  1X6N A;  4JFI A;  3VAW A;  5HBF A;  2K8I A;  5DIT A;  1EDQ A;  5J6E A;  2Y78 A;  1HJW A;  3KAI A;  3G6L A;  3ARX A;  4DIP A;  1H0G A;  5HUA A;  3GPK A;  3B9E A;  4ODR A;  2PV3 A;  3MQG A;  3B9A A;  2DMV A;  2WLZ A;  2MLX A;  3CHC A;  5DF0 A;  1IX5 A;  4DRH A;  1FJD A;  3JYM A;  3AS1 A;  1BL4 A;  5HKG A;  4JFK A;  1TR8 A;  1I5H W;  1W26 A;  2DSV A;  1EG4 A;  2DSU A;  1W1T A;  3MQH A;  1XRV A;  3WQW A;  4DWS B;  1TK7 A;  1HKM A;  5HW7 A;  3TCZ A;  4MSP A;  2DK7 A;  3UQB A;  2O92 A;  3PRD A;  3LE4 A;  4LGX A;  4DWS C;  2MLZ A;  4ML4 A;  3FXY A;  1O6W A;  1Q6U A;  2KR7 A;  3GU0 A;  1FKF A;  1EYM A;  2RUR A;  2ZQT A;  3WH0 A;  2PN0 A;  4KR0 B;  4NSB A;  4KQZ A;  2EZ5 W;  5E5W A;  2DT3 A;  2YSF A;  4WK9 A;  4QT3 A;  3O5M A;  2YSG A;  2DT0 A;  4JFM A;  3WKZ A;  3KAG A;  1ZK6 A;  3UI6 A;  1FAP A;  3FSB A;  4Z2L A;  1ZL1 A;  1WB0 A;  4MTV A;  4Q22 A;  4WIW A;  2P4V A;  3WD0 A;  4DRM A;  1OWQ A;  4GGQ A;  1FKG A;  4ODQ A;  4MNL A;  3ARU A;  4HBE A;  2XP6 A;  1E6P A;  2LPV A;  2PV1 A;  2YSH A;  4QT2 A;  2FAP A;  1ITX A;  2KGJ A;  2F21 A;  2F2D A;  1NH6 A;  2XP3 A;  2WK2 A;  1GOI A;  2LKN A;  3MCB A;  4W9O A;  3ALG A;  1BKF A;  2LJ4 A;  1HXV A;  1WAW A;  1ZBV A;  3ODK A;  1GUV A;  2PBC A;  2PPO A;  2A3A A;  1J6Y A;  4C02 B;  1JCH B;  3ARO A;  2DG3 A;  2XP8 A;  3WD1 A;  3KZ7 A;  4QIB A;  3WL0 A;  1FKH A;  2WAD A;  1EIB A;  5DEZ A;  2DJY A;  4G2P A;  4JFL A;  1HJX A;  1RP5 A;  5E65 A;  2VN1 A;  2ZR6 A;  1Q6I A;  4URI A;  1FKT A;  4U84 A;  2ITK A;  1NMV A;  1D6O A;  3B9D A;  2JX8 A;  2ZQS A;  3ARZ A;  5D75 A;  3AS3 A;  3MDY B;  3RFW A;  2PV2 A;  5HT1 A;  4Q7N A;  1LG1 A;  1ZBW A;  5HWB A;  1E6N A;  3LUO A;  4DWS A;  3UQI A;  3B8S A;  4DZ2 A;  2MF9 A;  1HJV A;  4U86 A;  2MLY A;  1FFR A;  1FLC A;  3PQH A;  1J4R A;  2DG4 A;  3L4H A;  1E6Z A;  2A3E A;  3ALF A;  4MAV A;  1ZCN A;  1O6I A;  3WQV A;  5HTG A;  3M7N A;  3IKG A;  2B5U B;  3WD4 A;  1UR8 A;  4IT4 A;  2E45 A;  4DZ3 A;  1NWR A;  3JXV A;  1FKL A;  2B31 A;  1W9V A;  4QZV B;  1FKR A;  3KCE A;  1W1P A;  3CZ8 A;  2PPP A;  2M3O W;  3OOB A;  1T11 A;  2JZV A;  1NWS A;  2OWO A;  2F4E A;  4ODK A;  2L4J A;  3CGN A;  5HW6 A;  2DK1 A;  2IF4 A;  5E66 A;  1D7H A;  3TC5 A;  1GRJ A;  4IQC A;  2JMF A;  1NSG A;  1ROU A;  4DRP A;  4XAK A;  3O5G A;  1C9H A;  4Z2J A;  1K9T A;  1W1Y A;  4W5U A;  4TW8 A;  4DT4 A;  2ZR4 A;  4R0X A;  1E15 A;  1E9L A;  1JND A;  3RGC A;  3NRK A;  3NTP A;  4LAW A;  1TCO C;  1FKJ A;  2WM0 A;  3WL1 A;  3AS2 A;  4DWS D;  2FKE A;  3PA7 A;  2JXW A;  4L72 B;  4AY1 A;  1WR7 A;  4ODP A;  5HW8 A;  2BA1 A;  4S3J A;  2L2S A;  1LJY A;  3CHF A;  5B8I C;  1NWU A;  2YBT A;  2O9O A;  1HKI A;  2DG9 A;  3O5O A;  4MNM A;  2M1I A;  3BMB A;  1WMV A;  3ARR A;  2Q5A A;  2YSI A;  3CNG A;  2M2A A;  4P8U A;  1FKD A;  1XHG A;  5CQ2 A;  5HWC A;  1K9R A;  2RSE A;  3FSC A;  4HBO A;  1D7I A;  4W9P A;  2RE3 A;  3PRA A;  1J4H A;  1OGG A;  3O5E A;  4DRI A;  3KAD A;  1B6C A;  3ARQ A;  4ITZ A;  3WIJ A;  2VCD A;  1Q6H A;  3KAC A;  3KAF A;  1D2K A;  1ROT A;  2Y8N B;  3EY6 A;  4ODM A;  5JH8 A;  1NWT A;  3PR9 A;  4S3K A;  4ZPW R;  2YSB A;  2ETN A;  4IQ2 A;  4P8W A;  1KFW A;  4DRN A;  1FKK A;  2XP5 A;  2KFW A;  3I6C A;  4NNR A;  1QPL A;  3IHZ A;  4LAX A;  3AS0 A;  1RD6 A;  2G8Z A;  3ARY A;  3O5R A;  2KE0 A;  4IPX A;  4Z2I A;  4NZC A;  4E5R A;  4N19 A;  1UR9 A;  3UQA A;  3ARP A;  1VF8 A;  3NI6 A;  3LKX B;  1YAT A;  2DT1 A;  4TW6 A;  4ODL A;  5U47 A;  4BF8 A;  2DWV A;  2MDI A;  3KAH A;  3M85 A;  2KXQ A;  4JFJ A;  1JMQ A;  5BXJ A;  2XP9 A;  2ZQU A;  1JNS A;  2M8J A;  2KO7 A;  3FAP A;  1Y0O A;  1HKK A;  3O5K A;  4O2T A;  3WD3 A;  1NMW A;  2RQS A;  3UI5 A;  2XP7 A;  2DSW A;  2OFN A;  2XP4 A;  2XPB A;  2UZ5 A;  1KT0 A;  3IK8 A;  4DRO A;  1X6L A;  1JVW A;  3ARS A;  3ART A;  4ODN A;  3KAB A;  3AQU A;  3CH9 A;  1ZU8 A;  3FY1 A;  1EG3 A;  1P5Q A;  5GPG A;  1JNE A;  3H9R B;  2DT2 A;  2RUC A;  4GLX A;  1ZBC A;  1W9P A;  4WKH A;  1M5Y A;  1W9U A;  2A3B A;  2XPA A;  2KI3 A;  4MNJ A;  4PTM A;  1SR0 A;  4ZPV R;  3JYJ A;  4WKA A;  1LG2 A;  3CHD A;  4FN2 A;  1FKB A;  1CTN A;  1LL7 A;  2IUZ A;  1EHN A;  3OA5 A;  3TDB A;  1OGB A;  1E6R A;  1U79 A;  5I98 A;  2DSZ A;  3UF8 A;  1GPF A;  5E64 A;  5DIU A;  1PBK A;  3FS8 A;  5GPR A;  1D7J A;  2RUD A;  4IT6 A;  4Z2G A;  4G50 A;  3RM4 A;  2DPE A;  1SYT A;  1R9H A;  3EIP A;  2JV4 A;  2YAJ B; 
#chains in the Genus database with same CATH homology
 4TNS A;  1ZB5 A;  1FD9 A;  1F40 A;  4TX0 A;  2ESC A;  2A3C A;  4P8V A;  4Z2H A;  4FAP A;  1WNO A;  2WLY A;  3O5Q A;  1F8A B;  1PIN A;  3G6M A;  3QOK A;  1EQ3 A;  2QF8 A;  1TFV A;  4LAV A;  4DRQ A;  1H0I A;  1Q1C A;  1LL4 A;  3ARV A;  3RM9 A;  4L3N A;  1FKS A;  4MPK A;  4JYS A;  3LKX A;  2MNT A;  2N87 A;  2M8I A;  2MPH A;  1HKJ A;  1ZBK A;  3ARW A;  4U85 A;  2PI6 A;  1J4I A;  4Z2K A;  3B7X A;  3O5P A;  4J4O A;  3O5L A;  2AWG A;  4ZPT R;  2RUQ A;  4MGV A;  4W9Q A;  4LAY A;  1W1V A;  3CHE A;  5E62 A;  5DIV A;  4A0T A;  2AOS A;  3O5D A;  4P8X A;  2M08 A;  2FDM A;  1FKI A;  3IKD A;  4WJX A;  2LGO A;  4MNK A;  4R5E A;  2OLH A;  1KT1 A;  4ODO A;  2ZR5 A;  5AHT A;  4HAR A;  3O5F A;  3BXW A;  4DRJ A;  1JNT A;  1YW5 A;  3O5J A;  1FFQ A;  2YBU A;  5GQB A;  4DH0 A;  4REX A;  1LQ0 A;  2PPN A;  3O5I A;  3PRB A;  1QZ2 A;  2ZAJ A;  3W4R A;  5DO2 A;  4GIV A;  3RM8 A;  2LAJ A;  4TYO A;  3WD2 A;  4WKF A;  2WAE A;  1A7X A;  3MCB B;  3UI4 A;  1LL6 A;  2ZQV A;  1L1P A;  1QPF A;  3CGM A;  4A0U A;  2QRV A;  2D9F A;  1N1A A;  1K9Q A;  2G41 A;  4J4N A;  4ZS6 A;  3RME A;  4TW7 A;  4DRK A;  1X6N A;  4JFI A;  3VAW A;  5HBF A;  2K8I A;  5DIT A;  1EDQ A;  5J6E A;  2Y78 A;  1HJW A;  3KAI A;  3G6L A;  3ARX A;  4DIP A;  1H0G A;  5HUA A;  3GPK A;  3B9E A;  4ODR A;  2PV3 A;  3MQG A;  3B9A A;  2DMV A;  2WLZ A;  2MLX A;  3CHC A;  5DF0 A;  1IX5 A;  4DRH A;  1FJD A;  3JYM A;  3AS1 A;  1BL4 A;  5HKG A;  4JFK A;  1TR8 A;  1I5H W;  1W26 A;  2DSV A;  1EG4 A;  2DSU A;  1W1T A;  3MQH A;  1XRV A;  3WQW A;  4DWS B;  1TK7 A;  1HKM A;  5HW7 A;  3TCZ A;  4MSP A;  2DK7 A;  3UQB A;  2O92 A;  3PRD A;  3LE4 A;  4LGX A;  4DWS C;  2MLZ A;  4ML4 A;  3FXY A;  1O6W A;  1Q6U A;  2KR7 A;  1FKF A;  1EYM A;  2RUR A;  2ZQT A;  3WH0 A;  4KR0 B;  4NSB A;  4KQZ A;  2EZ5 W;  5E5W A;  2DT3 A;  2YSF A;  4WK9 A;  4QT3 A;  3O5M A;  2YSG A;  2DT0 A;  4JFM A;  3WKZ A;  3KAG A;  1ZK6 A;  3UI6 A;  1FAP A;  3FSB A;  4Z2L A;  1ZL1 A;  1WB0 A;  4MTV A;  4Q22 A;  4WIW A;  4DRM A;  3WD0 A;  1OWQ A;  4GGQ A;  1FKG A;  4ODQ A;  4MNL A;  3ARU A;  4HBE A;  2XP6 A;  1E6P A;  2LPV A;  2PV1 A;  2YSH A;  4QT2 A;  2FAP A;  1ITX A;  2KGJ A;  2F21 A;  2F2D A;  1NH6 A;  2XP3 A;  2WK2 A;  1GOI A;  2LKN A;  3MCB A;  4W9O A;  3ALG A;  1BKF A;  2LJ4 A;  1HXV A;  1WAW A;  1ZBV A;  3ODK A;  1GUV A;  2PBC A;  2PPO A;  2A3A A;  1J6Y A;  4C02 B;  3ARO A;  2DG3 A;  2XP8 A;  3WD1 A;  3KZ7 A;  4QIB A;  3WL0 A;  1FKH A;  2WAD A;  1EIB A;  5DEZ A;  2DJY A;  4G2P A;  4JFL A;  1HJX A;  1RP5 A;  5E65 A;  2VN1 A;  2ZR6 A;  1Q6I A;  4URI A;  1FKT A;  4U84 A;  2ITK A;  1NMV A;  1D6O A;  3B9D A;  2JX8 A;  2ZQS A;  3ARZ A;  5D75 A;  3AS3 A;  3MDY B;  3RFW A;  2PV2 A;  5HT1 A;  4Q7N A;  1LG1 A;  1ZBW A;  5HWB A;  1E6N A;  3LUO A;  4DWS A;  3UQI A;  3B8S A;  4DZ2 A;  2MF9 A;  1HJV A;  4U86 A;  2MLY A;  1FFR A;  1FLC A;  3PQH A;  1J4R A;  2DG4 A;  3L4H A;  1E6Z A;  2A3E A;  3ALF A;  4MAV A;  1ZCN A;  1O6I A;  3WQV A;  5HTG A;  3M7N A;  3IKG A;  3WD4 A;  1UR8 A;  4IT4 A;  2E45 A;  4DZ3 A;  1NWR A;  3JXV A;  1FKL A;  2B31 A;  1W9V A;  4QZV B;  1FKR A;  3KCE A;  1W1P A;  3CZ8 A;  2PPP A;  2M3O W;  3OOB A;  1T11 A;  2JZV A;  1NWS A;  2OWO A;  2F4E A;  4ODK A;  2L4J A;  3CGN A;  5HW6 A;  2DK1 A;  2IF4 A;  5E66 A;  1D7H A;  3TC5 A;  4IQC A;  2JMF A;  1NSG A;  1ROU A;  4DRP A;  4XAK A;  3O5G A;  1C9H A;  4Z2J A;  1K9T A;  1W1Y A;  4W5U A;  4TW8 A;  4DT4 A;  2ZR4 A;  4R0X A;  1E15 A;  1E9L A;  1JND A;  3RGC A;  3NRK A;  3NTP A;  4LAW A;  1TCO C;  1FKJ A;  2WM0 A;  3WL1 A;  3AS2 A;  4DWS D;  2FKE A;  3PA7 A;  2JXW A;  4L72 B;  4AY1 A;  1WR7 A;  4ODP A;  5HW8 A;  2BA1 A;  4S3J A;  2L2S A;  1LJY A;  3CHF A;  5B8I C;  1NWU A;  2YBT A;  2O9O A;  1HKI A;  2DG9 A;  3O5O A;  4MNM A;  2M1I A;  1WMV A;  3ARR A;  2Q5A A;  2YSI A;  3CNG A;  2M2A A;  4P8U A;  1FKD A;  1XHG A;  5CQ2 A;  5HWC A;  1K9R A;  2RSE A;  3FSC A;  4HBO A;  1D7I A;  4W9P A;  2RE3 A;  3PRA A;  1J4H A;  1OGG A;  3O5E A;  4DRI A;  3KAD A;  1B6C A;  3ARQ A;  4ITZ A;  3WIJ A;  2VCD A;  1Q6H A;  3KAC A;  3KAF A;  1D2K A;  1ROT A;  2Y8N B;  3EY6 A;  4ODM A;  5JH8 A;  1NWT A;  3PR9 A;  4S3K A;  4ZPW R;  2YSB A;  4IQ2 A;  4P8W A;  1KFW A;  4DRN A;  1FKK A;  2XP5 A;  2KFW A;  3I6C A;  4NNR A;  1QPL A;  3IHZ A;  4LAX A;  3AS0 A;  1RD6 A;  2G8Z A;  3ARY A;  3O5R A;  2KE0 A;  4IPX A;  4Z2I A;  4NZC A;  4E5R A;  4N19 A;  1UR9 A;  3UQA A;  3ARP A;  1VF8 A;  3NI6 A;  3LKX B;  1YAT A;  2DT1 A;  4TW6 A;  4ODL A;  5U47 A;  4BF8 A;  2DWV A;  2MDI A;  3KAH A;  3M85 A;  2KXQ A;  4JFJ A;  1JMQ A;  5BXJ A;  2XP9 A;  2ZQU A;  1JNS A;  2M8J A;  2KO7 A;  3FAP A;  1Y0O A;  1HKK A;  3O5K A;  4O2T A;  3WD3 A;  1NMW A;  2RQS A;  3UI5 A;  2XP7 A;  2DSW A;  2OFN A;  2XP4 A;  2XPB A;  2UZ5 A;  1KT0 A;  3IK8 A;  4DRO A;  1X6L A;  1JVW A;  3ARS A;  3ART A;  4ODN A;  3KAB A;  3AQU A;  3CH9 A;  1ZU8 A;  3FY1 A;  1EG3 A;  1P5Q A;  5GPG A;  1JNE A;  3H9R B;  2DT2 A;  2RUC A;  4GLX A;  1ZBC A;  1W9P A;  4WKH A;  1M5Y A;  1W9U A;  2A3B A;  2XPA A;  2KI3 A;  4MNJ A;  4PTM A;  1SR0 A;  4ZPV R;  3JYJ A;  4WKA A;  1LG2 A;  3CHD A;  4FN2 A;  1FKB A;  1CTN A;  1LL7 A;  2IUZ A;  1EHN A;  3OA5 A;  3TDB A;  1OGB A;  1E6R A;  1U79 A;  5I98 A;  2DSZ A;  3UF8 A;  1GPF A;  5E64 A;  5DIU A;  1PBK A;  3FS8 A;  5GPR A;  1D7J A;  2RUD A;  4IT6 A;  4Z2G A;  4G50 A;  3RM4 A;  2DPE A;  1SYT A;  1R9H A;  2JV4 A;  2YAJ B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...