3M7NA

Archaeoglobus fulgidus exosome with rna bound to the active site
Total Genus 42
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
42
sequence length
179
structure length
179
Chain Sequence
MRFVMPGDRIGSAEEYVKGEGVYEEGGELFAAVAGKLIIKDRVAKVESISPIPEIVKGDVVLGRVVDLRNSIALIEVSSKKGENRGPSNRGIGILHVSNVDEGYVKEISEAVGYLDILKARVIGDNLRLSTKEEEMGVLRALCSNCKTEMVREGDILKCPECGRVEKRKISTDYGKGEW
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Putative uncharacterized protein AF_0206
publication title Quantitative analysis of processive RNA degradation by the archaeal RNA exosome
pubmed doi rcsb
source organism Archaeoglobus fulgidus
molecule tags Hydrolase/rna
total genus 42
structure length 179
sequence length 179
chains with identical sequence B, C
ec nomenclature
pdb deposition date 2010-03-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF10447 EXOSC1 Exosome component EXOSC1/CSL4
A PF14382 ECR1_N Exosome complex exonuclease RRP4 N-terminal region
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.20.70.10 Mainly Beta Single Sheet Ubiquitin Ligase Nedd4; Chain: W; Ubiquitin Ligase Nedd4; Chain: W; 3m7nA03
2.40.50.100 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 3m7nA01
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 3m7nA02
3LWUA 3K81C 3A8JE 1TWCH 5GAGC 3M4PA 4X64Q 1V1QA 1O6WA 1VQJA 1L2FA 1RL2A 4DV0L 4LUZA 2VW9A 4JI0Q 4DR5Q 2OQ0A 2ATWA 1NTGA 2VQEL 2XP7A 2YV5A 2A6ED 4BBRG 5LMUQ 1VQDA 2QEXA 3KDFB 3L2PA 2VQFQ 3NBHB 3N6RA 3A8KE 1VQFA 5K36G 5FJ8G 2AUKA 1PYSB 2UU9Q 4YWKA 4U85A 4GLAC 1D7QA 3E0EA 4DR3Q 1Y1WG 4DNTB 3RN2A 2Q2HA 4LF9L 1IBML 1IW7C 1HZBA 1WOCA 5IP9G 2JA8H 1WJJA 3S15H 3CNGA 4BY1H 1X54A 1Y1VH 4IJLA 1N32Q 2R6GA 1XMQQ 5FLMH 1E2VA 4LJZC 3KJPA 1FL0A 3AYHB 5AJ3Q 3J80c 2KCTA 2Z6KA 3TS0A 2R7FA 3F8TA 1HTPA 3BZCA 4QJFA 2YSFA 2PNRC 4A3LH 4HJ5A 1D8LA 2Z6KC 3BDOA 2PPBC 2F4VL 1VQAA 4DV6Q 2BA0A 2CWPA 1XPRA 1YITA 2ZR5A 4IQZA 2MO1A 4K0KL 3GO5A 4BY7H 4YWMA 2BA1A 4HIDA 2BE5C 5IE8A 3F2CA 1A0IA 2WB1E 3PUXA 1VF7A 4IFDI 5M5XH 2A69C 3A0JA 2DNEA 2Q2UA 4JI8Q 3M4QA 2KCMA 2VNUD 1PH8A 3SDZA 5AHTA 2M3OW 1FJGQ 4L5TA 1Q1EA 2OWOA 3A5UA 1E22A 3CRKC 2VZAA 1Q8KA 2UXCL 5JEAH 4P75A 3CCRA 1B8AA 2JA7G 2ZT9C 3PIOA 4HIKA 3PUZA 4KKUA 3HKSA 4JBKA 4LF7Q 2N8NA 2VL6A 2V4DA 3RLOA 3K7AH 4POGA 4JI7Q 4LUVA 4A3DH 1Y8PB 2KHJA 4QIWE 1LTLA 1WCMH 1XTDA 2NVTH 2K33A 3PGZA 1PV4A 2UXDQ 2GVBA 4R1JA 4PZ6A 4A3FG 4OWWB 2UUAQ 4BBSH 3HOXH 2XPAA 3A7AB 5IYCH 1J5EQ 3M4OH 4DR5L 3A5ZB 1CKOA 4A3EG 2IY5B 4L5RC 1E2ZA 3TZUA 5C0XJ 1YBYA 2WAQE 3S14H 4A93H 3I4OA 2JQOA 1WR7A 5C4XH 2VQFL 2ZQTA 2JX8A 1VQMA 4NB3A 2E2IH 3H0GG 4QGUA 1PFSA 5M3MH 1MIUA 2L15A 1K9RA 2EVBA 1OTCA 4R4OA 1PVOA 2E2HH 5M3FH 1VQPA 4LFCQ 4GN3B 1NY4A 3M85A 1N32L 3F1ZA 2EZ5W 3BU2A 3GTLH 3CXCA 1ONLA 1TU2B 1H95A 1Q12A 1X56A 4U86A 1E7ZA 5J3BA 3HOZG 3IRBA 2AWNA 1ASYA 5JJKA 3HGBA 1K8OA 2MFIA 4IFDJ 2Y0SE 4DV6L 3CW2C 1HQMC 2ZQVA 1EOVA 2CQOA 3PO2G 4X6AH 5C4JH 1K83H 2RF4A 1K73C 4MNOA 4JI5Q 2L4JA 3CF5A 4NXMQ 4KHPQ 1C9OA 2ALYB 1JJ2A 5IWAQ 1F8AB 1OXVA 2H5XA 3CMAA 1I6VC 4DV5Q 3I4LA 2JA5H 4FDBA 4KKSA 1X3EA 3D0FA 4OO1I 4JI8L 1UEBA 4IJHA 2GN5A 2NN6I 1YJNA 4QQBX 3T1HL 4LNQA 2MO0A 1FJGL 2RHQB 4X65Q 2XP5A 4AYBG 3H94A 2KBNA 3CCUA 4OONA 1UE5A 1XNQQ 4KN4C 4B3MQ 1QVFA 1KAWA 4LF7L 4P73A 1L1OA 2F3IA 3I2ZA 1OXTA 1X3GA 1N8RC 1IYUA 1UE7A 1VS0A 4JI7L 4Y7NH 4GN4B 1YZ6A 4MTNA 5FLMG 2B8FA 2K5HA 1L1OC 3T56B 4J15A 1TK7A 4APVA 2UUAL 1AH9A 4QL5A 1X9NA 4DUYQ 1VQHA 3J80i 1Q90A 1J5EL 1BKBA 4IPGA 2B29A 1SLJA 3HKZG 1E1OA 4A3LG 4JBWA 1I3QH 4OWXB 3GTJH 3LE4A 1K9QA 1PH9A 3D31A 1CSQA 1JE5A 2VS1A 3KF6A 3FP9A 2DK7A 1W2BA 1Y14B 3LNNA 1S40A 4KLKA 2YTYA 1QUQA 2D0OA 2ZTEA 4JBMA 2KHIA 4ME3A 3CD6A 1YNJC 4GNXC 1L1OB 3STBC 2MDIA 2BH8A 4LFCL 3BJUA 4TVAB 1VQLA 3HOYH 4AYBE 2O5JC 1E2WA 3H15A 1Q1BA 4A3JG 3UE0A 1YNNC 4P71A 1EQRA 1XJVA 2K75A 2DGYA 3M7NA 3PUYA 4OO1G 3PO3H 3L4HA 4P72A 1B9NA 2NN6G 5IP7H 3KF6B 4JYAQ 3FPPA 5JEAJ 2XP6A 2RHSB 1SR3A 2MNAA 1YJ9A 2I5LX 4AIMA 4PG3A 1QUQB 4GLXA 2A6HD 4DAMA 3F2DA 5IYBG 1JMQA 3HOUG 4JI5L 3MXNB 1C0AA 4C2MH 4NXML 2XP9A 1P8LA 4KHPL 1KXLA 4HIOA 2EXDA 5IWAL 2OQKA 1VQ4A 1SMYC 1HNWQ 4DV5L 2D62A 4A3CH 2JJQA 2UUBQ 1X6OA 4A4IA 1TWAH 4JOIC 3KABA 4POFA 4DUZQ 2ES2A 4U84A 4X65L 3I73A 2C35B 3NTPA 1PH7A 1OXUA 2XP8A 5IYDG 1PH1A 1HR0W 2Q5AA 3E9IA 4A3KH 3ND8A 5BN3A 3KF8B 2V1CC 3UDIA 1K8MA 4H13C 4WJ3M 2EQSA 1SFOH 1OXSC 3OPOA 1YW5A 1K3RA 1EYGA 2LXKA 1SMXA 3AQQA 2ZJQA 1B70B 3F2BA 2E45A 4JI4L 3KADA 2LXJA 3OOBA 3VDYA 5C0XI 2HIXA 4KHZA 1NJIC 1N36Q 2EJMA 4A3GH 1VQKA 3KOJA 3GTMH 2XTIA 2AHOB 1HJPA 4DUYL 3PIPA 4LFBQ 5HGQA 2JA9A 2JXWA 1LYLA 1GM5A 1Z6HA 2JEBI 5A35A 2EJFC 1A6XA 4DV1Q 1E24A 4P74A 5C44H 3CCSA 2K7VA 3KLRA 1TWHH 4I7ZC 2EJGC 5KNDA 1MKHA 1LUZA 4A75A 1HR0L 1PH6A 5M5YH 3I4MH 2NVYH 2ZR4A 3RLNA 5GROA 2L5TA 3EIVA 1HZCA 4AQYQ 2I5MX 3QIAA 1VCIA 1FGUA 1U5KA 2UXBQ 3GDEA 2E5LQ 1NE3A 4JCVE 2AKWB 3FMCA 5BN4A 2B63G 1G51A 4BA1I 2AMCB 2Q8IB 1HNXQ 4LUOA 3TREA 1V43A 1CSPA 3I56A 2ZTDA 5GAHC 4B3RQ 1GD7A 4YCWA 4A3IH 1Q46A 1HNZQ 5JJIA 3G71A 3H3VI 1GUOA 2JEAI 4GKJQ 4OGQC 4YCUA 3OTOQ 1LACA 4JI6Q 3UDFA 5C3EH 3CPFA 2R7ZG 3OW2A 3AFPA 1V9PA 2VUMG 5BN5A 1XNRQ 4JI1L 2K4KA 1Q81C 2XP4A 3P20A 1HNWL 4GKKQ 3GTQH 4IOAA 2MQHA 4QY7A 2RE3A 3U50C 5C0XG 1E3PA 4X64L 2UUBL 1CKNA 2PCFB 3DLLA 3UDXA 3VR4A 3HOVH 3J7A5 4KKTA 2D0PA 1UE6A 3TQYA 4DUZL 3S1NH 4JI0L 2IHEA 1CKMA 1AE2A 2EIFA 3STBD 2JK8A 2R92G 5LMUL 2B8GA 4QIBA 2PMZE 1I6HH 3I4NH 1H9JA 2E76C 2N49A 4KMUC 2A19A 4YHHQ 3I55A 2UU9L 4UP9A 4A3BH 4JI3Q 5IY0A 2JA6G 4DR3L 2YSIA 2QGQA 4HJ7A 3S24A 4JV5Q 4DR2Q 3RZOH 2K52A 3CC2A 3TRZA 3S17H 4BXXG 3PUWA 3G6EA 2HQLA 3GQBA 2LAJA 1N36L 3MEFA 4HIMA 1H9KA 2YYZA 3A74A 1JB7A 4BBRH 4OX9Q 1GUSA 3K80C 1XMQL 1KRSA 2A6EC 5FJ8H 5K36H 1CKNB 5AJ3L 4DK1A 2ZJPA 3FKIG 1VQ6A 4IFDG 4H0LC 2ID0A 5DLQE 1Y1WH 2Q2IA 2PQAA 3CRLC 1XPOA 1IYVA 1M90C 3CCQA 2HHHQ 4EX5A 1QVGA 1YJWA 4MZ9A 2K14A 3KAGA 1BDOA 4LF8Q 5IP9H 4PZ8A 3I7FA 1X65A 4A3MH 3OYYA 1MJCA 2ZJRA 3HOWG 2M8IA 1CFMA 1X55A 4AQYL 4G7HC 1PINA 1H9RA 1HZ9A 4X62Q 3CCLA 2UXBL 3UE1A 4GOPA 2E5LL 1DD2A 1R9TH 2DUDA 3PSIA 1YEZA 4NPSA 4LF4Q 3GTGH 4GOPC 1IL2A 4B3RL 4GN5A 5EAYA 2FXQA 1HNZL 2K5NA 4GKJL 4DK6C 1FR3A 3W1GA 1B7YB 1IW7D 1YI2A 1QZGA 3TDBA 3OTOL 2PQAB 1YHQA 3AB9A 3KAFA 1DGSA 4DNRB 3S2DH 1SRUA 2JA8G 4BY1G 1Y1VG 2CFMA 3L0OA 2A68C 2UUCQ 5ELNA 3PUVA 2DN8A 1KC8C 2UXDL 4DK3C 4GKKL 1IXRA 5LMNQ 1KD1C 1CI3M 2A1AA 2PI2E 3W5OA 4REXA 3CMEA 1Q86C 2JA7H 3NEMA 2DK1A 4O2DA 3ULLA 2JMFA 1BVSA 1G6PA 2YTVA 3TC5A 4KI0A 3GTKH 1YHBA 1SE8A 2OTJA 3PF5A 3KAHA 1Q7YC 4TQUS 4Y52H 1PMRA 1YVCA 1H9MA 2BE5D 4GNXA 4O0AA 4OWTB 5GADC 1IBKQ 4BY7G 3KAIA 4JI3L 3TEHB 2XP3A 4LW1A 1NMFA 2A69D 1H9SA 1KQSA 1W3SA 1GVPA 1VQ9A 4DR2L 4IOCA 4DR4Q 4R4IA 1PHJA 3SE0A 5BR8Q 4A3EH 4X66Q 1QJOA 1KIXA 2HT1A 4L5QA 5CQ2A 2K50A 3S1RH 1VQIA 3EN2A 4OX9L 2F4VQ 4DR7Q 1KRTA 4LFAQ 4B3TQ 1VQOA 1YHAA 2LMCB 3JAMc 4K0KQ 2ZAJA 4JK1C 1VQBA 3H0GH 5JEAG 1PH5A 1Q82C 1CTMA 1LABA 1WFQA 4DV2Q 1TWGH 2JV4A 1YNXA 1DCZA 3KCEA 1A8VA 3LGJA 1K8GA 4UP8A 1IYJB 2R93H 4WJ4A 2F1MA 4A3DG 4TKOB 4HJ8A 1S3OA 4GNXB 1EFWA 1WCMG 3CCVA 1KL9A 3J81c 2IT1A 3KDFA 4X62L 3G48A 1EQQA 1I5FA 3NENA 4H02A 1GUNA 1H9SB 5LMNW 3A8IE 3U9SA 3HKZE 3HOXG 4BBSG 3PCOB 5IYCG 1N9WA 3S16H 2IHFA 4LF4L 4JOIA 3T1YQ 4DR1Q 4EQ5A 3HOZH 4AH6A 1VQCA 2A8VA 2N3SA 4H44C 3CC7A 1HZAA 3I4NG 4A93G 5ELOA 5IT9c 4R4TA 5C4XG 2OTLA 3AFQA 1A63A 3PO2H 4IPDA 3CCMA 1EIFA 3BG3A 1G291 1Y8NB 1K0RA 1VQ8A 4LWCA 5M3MG 1XNQL 4B3SQ 4LF5Q 4B3ML 4A76A 3NE5B 1I94Q 2EDGA 5M3FG 2K32A 2XGTA 4XIGS 3U4ZA 4E5RA 2WB1G 4HR7B 4LK1C 2UUCL 2KCCA 2KXQA 2BH2A 4DV3Q 1VQ7A 5LMNL 3OOCA 3VR6A 1EUJA 4JBJA 1PH2A 1GJXA 4DNIA 1XMOQ 2PNHA 4JC0A 1SROA 2NVQH 5JJLA 3IKJA 2AUJD 4LF6Q 1XPUA 4A3MG 2NVXH 3EBEA 2M8JA 1UWVA 1EWHA 1WMVA 3T53B 5E7NA 1IBKL 3WDNA 1ASZA 1Y69U 4L8JA 3J7ZC 1N34Q 1O78A 2ZQUA 1Z7TA 1EG4A 1U0LA 2PI2A 4DR4L 3KYHC 5BR8L 1OXXK 4GZYC 2JA5G 3WWVA 4X66L 1VQ5A 1A62A 4C3HH 2BDOA 2RCNA 1EG3A 3CC4A 1PA6A 3K8AA 4DR7L 2Q2TA 2CKZB 2E75C 4LFAL 4B3TL 2WAQG 2E2JH 4KN7C 2CCZA 1JJCB 3CAMA 4DV2L 3MXUA 2KA7A 2YU9H 2A68D 3VR3A 4DR6Q 3PF4A 4JYAL 4YWLA 3VR2A 1AE3A 1LM0A 4GLVB 2DMVA 1WYDA 1IBLQ 3T1HQ 3DM3A 2YSGA 2F52A 4A3JH 4DV7Q 5FLXc 2F21A 1IZ6A 3G4SA 3KJOA 4ALPA 1TWFH 2N78A 2ZM6Q 1GHKA 3FHWA 2QF7A 2K5VA 3T1YL 3GD7A 4DR1L 3I72A 3ZJYC 4OO1H 1TKWB 1TXYA 2NN6H 3CP0A 3OW7A 2E8GA 3PV0A 2JXMB 4UPAA 3TCZA 2LSSA 1DXMA 2Y0SG 3U58A 5IYBH 4C3IH 1MJEA 4B3SL 1FYCA 3HOUH 4LF5L 2OCEA 4DAYB 3L7ZC 1V8QA 1YIJA 3SGIA 1I94L 2A6HC 4C3JH 2GVAA 3K0XA 3DXJC 1NMGA 3IFTA 3HOYG 3U4VA 3D4RA 4RCNA 1KHIA 1T9HA 1ZYRC 3JC66 1X3FA 4DV3L 3EQLC 3K7UC 2DJYA 3JAMi 5IYDH 4LFBL 1O7LA 3RN5A 1S72A 1XMOL 1QVCA 4YY3Q 3PO3G 5IP7G 2R93G 4DV1L 4LF6L 3Q8DA 2WFWA 3T51B 2NZHA 2YSHA 1EIYB 3ODKA 1T5EA 1N33Q 1JJGA 1GUTA 3ICEA 3J81i 1Z47A 1QZHA 4IPCA 4OXPA 3A7LA 4JI2Q 1NBWA 3RLFA 4XTCS 1N34L 3TS2A 5GAEC 5H1SE 3RR5A 3M4YA 4DV4Q 1B9MA 4A3CG 1VQEA 2ASBA 5GQOA 1GUGA 3QG1A 4G7ZC 3ULJA 1PH3A 3BZKA 1VF5C 1HNXL 1K8AC 2JE6I 4NXNQ 1WI5A 3S2HH 4DKAC 4R4CA 4A3KG 3CCEA 3WH0A 4PZ7A 4DR6L 1CUKA 2ZTCA 1Y8OB 3ULPA 2NZOA 5M5WH 3ERSX 3CPWA 4JI6L 2B63H 1IBLL 1BBWA 4DV0Q 1M1KC 2R7DA 4DV7L 2I0QA 1L0WA 1GHJA 2VQEQ 1XNRL 4IO9A 4A3GG 1C7YA 2ZM6L 4G7OC 2ZQSA 3M9BA 4RMFA 3ND9A 5KNCA 2E74C 4GOPB 1Z9FA 4UP7A 2D2CC 3GTPH 4R4QA 2QA4A 3KFUA 5HY6A 5C44G 4JI4Q 1EWIA 4LF9Q 2R7ZH 1IBMQ 1JMCA 1O7IA 2IX0A 2VUMH 1FVIA 3CCJA 3I4MG 4HJAA 4PMWA 3HFZB 4JG2A 3KLWA 1UE1A 4YHHL 3QJYA 1ZKOA 3S1MH 2IX1A 4A3FH 5C0XH 1PH4A 1PYBA 4HJ9A 4JV5L 2D5DA 1HR0Q 3E9HA 4PV1C 4A3IG 4GS3A 3W1BA 3S1QH 2R92H 2XPBA 3UDGA 1VQNA 3CQZH 3NELA 4YY3L 1K9MC 1VDZA 4L5SA 4DPGA 3GTOH 2YTXA 3MFYA 2WP8J 2JA6H 2B3GA 1SN8A 1I50H 5C3EG 5KNBA 3VR5A 1N33L 2I5HA 2HHHL 1HCZA 1E1TA 3VA7A 2DNCA 4BXXH 1JT8A 3M3YH 3ER0A 2YSBA 4JI2L 4LF8L 2ITKA 4RG1A 2CWAA 1ZCNA 2CW0C 4DV4L 3J81j 1HPCA 2VY3A 3B6YA 2UXCQ 2Z0SA 1BBUA 1GKHA 3FKIH 3HOVG 1GO3E 4IFDH 4DK0A 1NMVA 4BA2I 3RZDH 2HIVA 2KENA 1HH2P 2AWOA 4IPHA 4NXNL 4YCVA 3RNUA 2DWVA 1I5HW 4UY8C 3W3AA 1P16A 1J6QA 3H3VH 4JI1Q 2O5IC 3AEVA 3HOWH 1RIPA 1VQGA 4A3BG 2ZR6A
chains in the Genus database with same CATH superfamily
1ICFB 3LWUA 3DM1A 3K81C 3A8JE 2B63B 1TWCH 1IL8A 5IGBA 3QOJA 5E4XA 5GAGC 1J9OA 3M4PA 4X64Q 1V1QA 1O6WA 1VQJA 4IUNA 1L2FA 1RL2A 3JAML 4DV0L 1W6KA 4LUZA 2VW9A 4JI0Q 1EZ8A 4DR5Q 3NK9A 2OQ0A 2ATWA 4MN3A 1NTGA 2VQEL 2XP7A 2YV5A 1C48A 2A6ED 2IJ0A 3UI2A 4BBRG 5LMUQ 1VQDA 2EYLA 2QEXA 5IODA 3KDFB 3L2PA 2VQFQ 3NBHB 3N6RA 3GTPB 3A8KE 1VQFA 5FJ8G 5K36G 3KLSA 2AUKA 3X3MA 4Y7NB 1PYSB 1EZ6A 2UU9Q 4YWKA 4U85A 1D1KA 4GLAC 1D7QA 1VQGA 3J81L 3E0EA 2KJXA 1LLRD 4DR3Q 4WORA 2R7ZB 1Y1WG 2NTTA 2IX3A 4DNTB 3RN2A 2Q2HA 3FRPB 2EYHA 1K3BC 4LF9L 5IGCA 1IBML 1IW7C 1HFNA 1HZBA 1WOCA 2K5DA 2SNMA 5IP9G 3SK4A 2JA8H 1WJJA 3S15H 3CNGA 1D6EC 4BY1H 1X54A 1Y1VH 4IJLA 1ZXTA 3S1MB 1N32Q 2R6GA 1XMQQ 3IAYA 1I3QB 5FLMH 3GTJB 2WV6D 1E2VA 4LJZC 3KJPA 1FL0A 3AYHB 4NMZA 1JOOA 5IT9L 5L37A 4F7XA 5AJ3Q 5EPLA 1PYWD 5EGTA 1GUWA 3J80c 1PLFA 2WACA 2KCTA 4ZAIA 1D2BA 2Z6KA 4KJNA 1GOZA 2IW3A 3TS0A 2R7FA 3F8TA 4EGVA 1HTPA 3BZCA 4QJFA 2CVRA 2YSFA 4RWSC 2PNRC 4A3LH 1ENFA 1BCPC 4X3UA 4HJ5A 1D8LA 4MTKA 2Z6KC 5COYA 3BDOA 3P7JA 1CA6A 2XNAC 2PPBC 2F4VL 1VQAA 2K01A 4DV6Q 3TP6A 1NAPA 1CK1A 2BA0A 1I4PA 2CWPA 1XPRA 1YITA 3K57A 2ZR5A 4IQZA 2MO1A 3HOYB 4K0KL 3GO5A 2F0TA 5FOBB 4BY7H 4DGZA 4YWMA 3MAQA 2BA1A 2FHTA 4HIDA 5LL6X 2BE5C 1B53A 2ZXPA 4CHTB 2HQEA 5IE8A 3F2CA 2VB3X 1A0IA 3M3YB 4ZLTF 2WB1E 3PUXA 4I65A 2KEDA 1VF7A 2F0VA 1RHPA 1PZID 2X6GA 2KHSA 4IFDI 5M5XH 2KVMA 1D1IA 2A69C 3EA6A 3A0JA 2DNEA 2Q2UA 5I6WA 4JI8Q 3M4QA 1S5CD 2KCMA 2VNUD 1PH8A 3SDZA 2M3OW 5AHTA 4M8AA 1BBXC 1FJGQ 2J4XA 4L5TA 2ICIA 1F9QA 1Q1EA 2OWOA 4RGTA 3A5UA 4CKBA 1E22A 3CRKC 2VZAA 2XVSA 4UAIA 1Q8KA 2UXCL 4P75A 5JEAH 3CCRA 1B8AA 2JA7G 1WVLA 5D3DA 1QOHA 2ZT9C 4L6TB 3PIOA 1EY9A 3PUZA 4HIKA 5C4ZA 2QRVA 1KNEA 4KKUA 3HKSA 4JBKA 4LF7Q 2N8NA 2VL6A 3RMHA 2DJGC 4M1UB 2V4DA 3RLOA 1JWUD 4C2MB 3K7AH 4FF1A 5CC4A 4POGA 4JI7Q 4R8NA 4OHJA 4LUVA 5DNFA 4A3DH 5EKKA 1Y8PB 2KHJA 4OEMB 4QIWE 5E64A 1LTLA 1WCMH 1XTDA 2F3WA 4B9XA 2NVTH 2K33A 3PGZA 1PV4A 2UXDQ 2GVBA 2F03A 4R1JA 4PZ6A 3I3CA 4MIUA 4A3FG 3MWYW 4OWWB 5E5WA 5CGKA 3NHHA 1STYA 2F0MA 1G2SA 2UUAQ 1MI2A 3NTHA 4HMIA 4BBSH 3HOXH 1TY2A 2XPAA 3A7AB 5IYCH 1J5EQ 3M4OH 4DR5L 3A5ZB 2VXWA 5I2YA 1CKOA 4A3EG 1DONA 2IY5B 4G57A 4L5RC 5CV7A 4XQNA 1E2ZA 1SE4A 1SYFA 4A3KB 3TZUA 5C0XJ 2K03A 1YBYA 2WAQE 3S14H 1II3A 4A93H 2XIWA 3I4OA 2JQOA 1WR7A 1SFOB 5C4XH 2VQFL 2ZQTA 3TZDA 2JX8A 1VQMA 3O13A 4ZUIA 5FO8B 1SYCA 4NB3A 2E2IH 1K0SA 2PW7A 3NPPA 3H0GG 2B2YA 4QGUA 3RD4A 1PFSA 1EIHA 5M3MH 1JWMD 4X3TA 1MIUA 5FLXL 2L15A 1ET6A 1K9RA 2NB0A 1B4OA 2EVBA 1OTCA 4U68A 4R4OA 1PVOA 2BDNA 2E2HH 2B2YC 3S15B 1FLCA 4K2LA 4A3GB 4BY1B 3BVMA 5M3FH 1VQPA 4LFCQ 1RKNA 4GN3B 2QEJC 1CHPD 4FNFA 1NY4A 1SYDA 3M85A 5JOBA 1A2TA 1N32L 4YIJA 4FXDA 3F1ZA 5KYLA 5J22A 2EZ5W 4QUCA 5E66A 3BU2A 2F0JA 1JICA 5A2QL 1QILA 2HUGA 3GTLH 3CXCA 3DWAA 5C44B 3T13A 1ONLA 1F77A 4PMBA 1J8IA 1TU2B 1EIGA 1Q12A 4V190 1H95A 1KDCA 4KD4A 1TWHB 5E62A 3E6ZX 1X56A 4FO2A 4U86A 1E7ZA 1O80A 5J3BA 3HOZG 3URYA 5K5PA 3IRBA 5M5YB 3I4MB 2NVYB 2AWNA 1ASYA 1IHZA 5JJKA 1AEXA 1B44D 3HGBA 2MFIA 1K8OA 1BCPF 4IFDJ 2WAEA 1NSNS 3OHXC 2Y0SE 4DV6L 3CW2C 1HQMC 2ZQVA 1EOVA 2CQOA 3PO2G 4BY7B 3FS8A 4DAPA 4X6AH 5C4JH 2AQ3B 1K83H 2F0SA 2RF4A 4MHEA 5JVG3 1K73C 3D4DA 4MNOA 4JI5Q 2L4JA 3CF5A 4NXMQ 3D3RA 1SNCA 1JC7A 3NTKA 3X3NA 4KHPQ 2L4NA 1C9OA 2ALYB 1JJ2A 5D3IB 5IWAQ 1F8AB 1KDBA 1OXVA 2H5XA 3CMAA 1I6VC 4DV5Q 3TN2A 4A3IB 3CU7A 4XYOA 1IKMA 3I4LA 2JA5H 4FF3A 3SK5A 1MD2D 4FDBA 4KKSA 1X3EA 3D0FA 4OO1I 4JI8L 5I9OA 1UEBA 2NBFA 4IJHA 2GN5A 1A3UA 2NN6I 1YJNA 4QQBX 1QCBD 3T1HL 4LNQA 3BYTB 2MO0A 2RSOA 1FJGL 2RHQB 4X65Q 4XXEA 2XP5A 4AYBG 3H94A 2KBNA 2RDFA 4L63B 5C3EB 3CCUA 4OONA 3MXPA 1LTGD 1TVXA 1UE5A 2K04A 3K6OA 1STEA 1XNQQ 3RUZA 4KN4C 1PRTB 1F2MA 4B3MQ 1IKLA 1QVFA 1KAWA 4WFN3 1TT2A 5EPJA 4LF7L 4P73A 1L1OA 2F3IA 3I2ZA 1STHA 1OXTA 4HCSA 1X3GA 1IYUA 1N8RC 1UE7A 1VS0A 4JI7L 1DOKA 4Q0FA 1EY7A 4Y7NH 1WCMB 1FD7D 1JWSD 4HSVA 5DM73 3MVVA 4GN4B 1YZ6A 4KY7A 4MTNA 1HUNA 4KY6A 5FLMG 2B8FA 2PZWA 2F0GA 2K5HA 1L1OC 3NTIA 3G7LA 4FXGC 3T56B 4J15A 5AFWA 1TK7A 1LV9A 2Q8TA 5EJWA 5I6YA 3HOXB 1PTOF 2ICEC 3HOVB 1D5MC 1KAAA 5C3WA 3L9AX 4APVA 2UUAL 3S1NB 3M4OB 1AH9A 4QL5A 4CDDC 1X9NA 4DUYQ 1VQHA 4G4KA 3J80i 4ZKBB 1Q90A 1J5EL 1BKBA 1RODA 2DY7A 3SK8A 1UAPA 4IPGA 2L9HA 2B29A 1SLJA 3HKZG 1E1OA 4A3LG 3SXHA 4JBWA 1I3QH 1F9RA 3I4NB 4C3HG 4OWXB 1I6HB 3GTJH 3LE4A 1K9QA 1PH9A 2RQXA 3D31A 1CSQA 1JE5A 2VS1A 1F9PA 3KF6A 3FP9A 2DK7A 2L55A 1W2BA 4HAEA 1EU4A 2WKCA 4TRDA 1Y14B 5IGFA 1SDFA 5I9PA 3S9WA 3LNNA 1S40A 5EPKA 4KLKA 2YTYA 4ZK9B 1QUQA 3VYSA 2XN9C 3S17B 2D0OA 1X3QA 2ZTEA 2LKVA 3HEJA 4JBMA 4HEDA 2KHIA 3MXNA 4ME3A 1YNJC 4GNXC 5M3FB 3CD6A 1L1OB 2TMPA 2EYFA 5JPNC 3STBC 2MDIA 5JAVA 3WOEA 2BH8A 5CV8A 2JYOA 4LFCL 3BJUA 4TVAB 2M2LA 1VQLA 3HOYH 4AYBE 3QB3A 3FVQA 4XDXA 4N8FA 2O5JC 1E2WA 3H15A 1Q1BA 2EOTA 4A3JG 3TP5A 3UE0A 1YNNC 2B2UC 5D14A 5C3XA 4P71A 2X69A 3J7AF 1EQRA 1XJVA 2K75A 4K2KA 2DGYA 3M7NA 3M7GA 3PUYA 4ILWA 3NQTA 4OO1G 3PO3H 2LY7A 3L4HA 4P72A 1KLGD 1B9NA 2NN6G 3KF8A 5IP7H 2IPKD 2MGSA 2NWGA 4A3MB 3KF6B 5E4WC 4JYAQ 3FPPA 2AQ1B 5JEAJ 2B2VA 2XP6A 4RGOS 2RHSB 1HTLD 1EY8A 1F2YA 4P2CB 4V0BA 1TS4A 1SR3A 3T16A 1NR2A 4DAVA 2MNAA 1YJ9A 1ENCA 2I5LX 4QIWB 4C56C 4AIMA 2YAJB 2SDFA 4PG3A 2I46A 4GLXA 1QUQB 2A6HD 5CR3A 4K5XA 4DAMA 3F2DA 2B2VC 5IYBG 1JMQA 2J7ZA 1VMCA 3ITPA 4C3IG 3HOUG 3EVQA 3MXNB 4JI5L 1C0AA 4C2MH 4NXML 3GTGB 2XP9A 1CHQD 1P8LA 4KHPL 4H7BA 1KXLA 4C3JG 4B9WA 4HIOA 2JA5B 2EXDA 5IWAL 2OQKA 1VQ4A 1SMYC 1HNWQ 4DV5L 2D62A 4A3CH 1ZYRD 1ESFA 2JJQA 1LTAD 4F88A 3WOFA 4CDFC 1WTHA 3E0JA 2UUBQ 1X6OA 3MHBA 3NBIA 1WD0A 4XT3B 4A4IA 1C4QA 3EFXD 1TWAH 4IALA 4JOIC 2PMZB 3KABA 2WAQB 4POFA 4DUZQ 5DEHA 2ES2A 1ICWA 4U84A 4X65L 3I73A 2R61A 2SEBD 2C35B 3NTPA 1PH7A 2PZUA 1OXUA 2QDBA 5LL6S 2QDLA 2XP8A 3SR1A 5IYDG 1PH1A 1HR0W 2Q5AA 1TR5A 5D65A 3E9IA 2QW7A 2KECA 4A3KH 3ND8A 3S2DB 4K14A 1S5FD 5BN3A 1KDAA 3KF8B 2V1CC 3UDIA 1K8MA 4H13C 4WJ3M 2EQSA 1SFOH 1OXSC 3OPOA 1YW5A 1K3RA 1EYGA 2LXKA 1SMXA 3AQQA 4RCOA 2ZJQA 1LTID 1B70B 3F2BA 2E45A 3J7YW 3Q0AA 4JI4L 2F0QA 3KADA 2F0WA 2LXJA 3OOBA 4EVOA 3VDYA 2H4OA 4IUUA 5C0XI 2HIXA 4KHZA 1WTVA 2CHBD 2JA7B 1I4RA 1NJIC 2OF1A 1N36Q 2EJMA 5IGGA 4A3GH 1JE4A 1VQKA 3KOJA 1EOTA 3GTMH 2XTIA 2AHOB 1HJPA 4DUYL 3PIPA 4LFBQ 1UEAB 5C4HA 4CJ2C 2K05A 1F2LA 2WADA 2Z1CA 4ODGA 5G3LF 3GTKB 5HGQA 2JA9A 2JXWA 1PRTD 1LYLA 1GM5A 1Z6HA 2JEBI 2XRSD 5A35A 3FSCA 2EJFC 1A6XA 4NW2A 4DV1Q 1SYEA 1E24A 4P74A 2HDLA 5E3FA 4J6HA 2KOLA 2EY1A 2EPBA 3OMGA 5C44H 3CCSA 2K7VA 3KLRA 2N88A 1TWHH 2R3ZA 4I7ZC 2EJGC 5KNDA 3JAME 1MKHA 2Y0SB 1EY4A 1LUZA 4A75A 1HR0L 5M9OA 1PH6A 5M5YH 3I4MH 2NVYH 2ZR4A 4J8QA 3RLNA 5GROA 4DXGA 2L5TA 4A3EB 3EIVA 1HZCA 3NP8A 4AQYQ 2I5MX 2Z4HA 2IL8A 3QIAA 1VCIA 1FGUA 2RKSA 3P1HA 1XTCD 1U5KA 3S1RB 2UXBQ 4F8MA 3GDEA 5FKAC 1RDPD 1M4VA 2E5LQ 1NE3A 4JCVE 2AKWB 3FMCA 2F0LA 5BN4A 2B63G 2DJFC 2F0KA 1G51A 4BA1I 2AMCB 2Q8IB 3J81E 4C1NI 3H0GB 3LWEA 4ME5A 1HNXQ 4LUOA 3TREA 4RFBA 1V43A 5C5MA 1CSPA 3Q24A 1DYQA 1WTPA 1HXYD 3I56A 2B2TA 2ZTDA 5GAHC 1TWGB 3MFGA 4B3RQ 3PIO3 1GD7A 4YCWA 5HGTA 4A3IH 2DY8A 1KABA 1Q46A 3PO3B 3NWSA 2FFKB 3L3OC 2R93B 2G9DA 1HNZQ 5JJIA 2L0CA 3G71A 3H3VI 2TSSA 1GUOA 2JEAI 2B2TC 4DAYA 4GKJQ 4OGQC 1BCPB 3FPUB 4OIJA 1G8ZD 3FDTA 2FINB 4YCUA 2RDGA 3QO2A 3OTOQ 1LACA 4JI6Q 5IT9E 3UDFA 1D5ZC 5C3EH 3HZXA 3CPFA 2R7ZG 3OW2A 1TQOA 1I4GA 1BO0A 3R8BA 3AFPA 1V9PA 2JSOA 3J80L 2VUMG 4EQOA 3DMUA 5BN5A 1FNUA 3R93A 2XWBB 1XNRQ 3S16B 2QCPX 1TS3A 2L12A 4JI1L 3H91A 1OO9B 3HOZB 2K4KA 1Q81C 2XP4A 1CQFA 3P20A 1HNWL 4GKKQ 3GTQH 3LX0A 4IOAA 1PTOC 2MQHA 4QY7A 2RE3A 4DA2A 3C2PA 2M9VA 3U50C 1E3PA 5C0XG 1TWAB 3IL8A 4X64L 4CJ1B 2UUBL 1CKNA 2PCFB 4OIKA 3DLLA 3UDXA 3VR4A 3PO2B 5KRUA 3HOVH 3J7A5 2D0PA 4KKTA 1UE6A 3TQYA 2NZ1D 4DUZL 3S1NH 1SEBD 4JI0L 2N55A 1HRJA 2IHEA 1YNJD 1CKMA 1AE2A 2EIFA 3QR8A 3STBD 2JK8A 2R92G 5LMUL 2B8GA 2OEOA 4QIBA 2PMZE 4NP5A 3I4NH 1I6HH 1H9JA 2E76C 2N49A 4KMUC 1SSOA 1JR0D 2A19A 2WKDA 2Z6BA 4YHHQ 3V2TA 3I55A 1CM9A 4RA8A 4CKEA 1L0XB 2UU9L 4UP9A 4A3BH 4JI3Q 5IY0A 5CV4A 2F0DA 2JA6G 5EKLA 1LTSD 1YNND 1ET9A 4DR3L 2F0FA 2YSIA 2QGQA 4HJ7A 3S24A 2P5ZX 1B3QA 4JV5Q 3H6MA 4DR2Q 2K52A 3RZOH 1UUPA 3CC2A 4AYBB 3TRZA 3S17H 4BXXG 2CW0D 4RKLA 4CGYB 3TBIB 3PUWA 3G6EA 2HQLA 3GTMB 3GQBA 3NUCA 1QWYA 2LAJA 1N36L 5ISRA 3I91A 3MEFA 4HIMA 1RF2D 1H9KA 2YYZA 3A74A 1EL0A 2Q8RE 1JB7A 2RCFA 4BBRH 4K6DA 3TDQA 4OX9Q 1GUSA 2NVQB 1XMQL 1KRSA 3R2TA 2SOBA 1I4HA 4ZUJA 2A6EC 5FJ8H 5K36H 1CKNB 3VYUA 5AJ3L 4DK1A 1XXGA 2NVXB 2ZJPA 3BDLA 3FKIG 1VQ6A 4ZQ3A 4IFDG 4H0LC 1EYAA 2ID0A 4JPBW 5DLQE 1Y1WH 2Q2IA 3E3XA 2PQAA 3CRLC 1XPOA 1IYVA 1M90C 3CCQA 2HHHQ 4EX5A 2FMMA 1QVGA 1RTNA 1YJWA 4MZ9A 4IUQA 5CV9A 2K14A 3KAGA 1BDOA 4LF8Q 5IP9H 4HMJA 4PZ8A 3I7FA 1X65A 4A3MH 3I70A 1STNA 1MJCA 3OYYA 2ZJRA 1JOKA 1SXTA 3HOWG 2G9HD 2M8IA 3HKZB 1CFMA 1X55A 4AQYL 1S5BD 4C3HB 4G7HC 1PINA 1H9RA 1HZ9A 2QKIC 2HD3A 4X62Q 3CCLA 2UXBL 3UE1A 4GOPA 2E5LL 1DD2A 5EKIA 1R9TH 2DUDA 3PSIA 3E5SA 1YEZA 4NPSA 5JPMC 4LF4Q 2E2JB 2KCNA 4R9WA 4RHRA 5CV6A 3GTGH 5FLXE 4KTAA 4GOPC 1IL2A 4B3RL 2PW5A 4GN5A 3AMUA 3NSWA 2MUYA 1WD1A 2PYKA 4ZCKA 2YU9B 5KGUA 3C1FA 3AU7A 3Q22A 4KD3A 5EAYA 2FXQA 1HNZL 2Y8NB 2K5NA 5I4DA 4GKJL 3MEHA 4DK6C 1FR3A 1B3AA 3W1GA 1B7YB 4DN4M 1IW7D 5C6AA 3MQHA 3DWPA 1YI2A 3TDBA 5A2QE 1V1OA 3OTOL 1QZGA 2PQAB 1YHQA 3AB9A 4U673 4XT1B 1SJHD 3KAFA 1SJED 1XX8A 3K5MA 3MXGA 3DEPA 1TWFB 1GXDC 1DGSA 4CBVA 4DNRB 3S2DH 5FO7B 5DM63 1SRUA 2JA8G 1B1ZA 4N9PA 3PMFA 1UNSA 4BY1G 1LT3D 1Y1VG 2CFMA 1QG7A 2EYJA 1SNQA 3L0OA 2A68C 2UUCQ 5ELNA 3GTQB 2BOSA 1PFBA 2EYOA 3PUVA 2DN8A 1KC8C 2UXDL 1V1PA 4DK3C 4GKKL 4IUTA 1IXRA 5LMNQ 1KD1C 1CI3M 1PXUA 2A1AA 2PI2E 3W5OA 3A56A 4REXA 1EY6A 3OWEB 3CMEA 1Q86C 3D6WA 2JA7H 2OT2A 4XYQA 3NEMA 4FF2A 2DK1A 1BCPD 4O2DA 3ULLA 3GV6A 3K59A 2JMFA 1BVSA 4K8IA 1G6PA 2Z8LA 2YTVA 2NTSA 3TC5A 4KI0A 4C3IB 3BYYB 3HOUB 3GTKH 1YHBA 1SE8A 4PQXA 2OTJA 3PF5A 1O7ZA 2A74C 2O2LD 3KAHA 1Q7YC 1EQTA 4TQUS 4Y52H 1PMRA 1U4LA 1YVCA 1HUMA 2C5CA 4A3BB 1H9MA 2BE5D 4GNXA 1CT1D 5F2DA 3MTSA 4O0AA 4OWTB 4I7AA 5GADC 2EE1A 1IBKQ 4BY7G 3KAIA 4Z9CB 4JI3L 3TEHB 2XP3A 3RZOB 4LW1A 5FK9C 3OMCA 1M8AA 4FP5D 1NMFA 2A69D 1H9SA 3QWNA 1W3SA 1GVPA 1KQSA 4DR2L 4ID6A 4IOCA 1VQ9A 1TS2A 3K0YA 2K1BA 4DR4Q 4R4IA 5T1GA 1PHJA 3SE0A 5BR8Q 3NXWA 1A3TA 2B2UA 4A3EH 4BBRB 3BDCA 3LKXA 2QILA 2IWHA 4X66Q 1QJOA 1KIXA 1AZQA 2HT1A 4L5QA 5CQ2A 2K50A 1SYGA 1EYCA 2HCCA 3OSOA 3S1RH 4K6LA 1VQIA 2JP1A 3EN2A 4OX9L 2F4VQ 4DR7Q 1V1PB 1KRTA 1LO5D 3BZDB 4LFAQ 4B3TQ 3C46A 1D5XC 1VQOA 1YHAA 2LMCB 2LFNA 1ML0D 3JAMc 4K0KQ 2ZAJA 4LMQD 4JK1C 1VQBA 3H0GH 1Y1WB 5JEAG 5T1IA 1PH5A 1Q82C 1CTMA 1LABA 1WFQA 4DV2Q 2F0OA 1TWGH 4QUFA 2JV4A 1YNXA 1DCZA 3MQGA 3KCEA 1A8VA 4UDUC 3LGJA 1K8GA 1FGBD 2KEEA 4UP8A 3K58A 1IYJB 2R93H 4NKLA 1FNWA 4WJ4A 3OIPA 2F1MA 2H1EA 4A3DG 2CH4W 4DF7A 4TKOB 4HJ8A 1S3OA 4GNXB 4A0UA 4TSSA 1TIID 1WCMG 1EFWA 3CCVA 1KL9A 4CJ0B 3J81c 1O7YA 4QCLA 1SE3A 1U4RA 2IT1A 3KDFA 1R9TB 4X62L 3G48A 1EQQA 1I5FA 4DFAA 3NENA 4H02A 2HDMA 1GUNA 2MJ8A 1H9SB 5LMNW 1DJRD 3A8IE 3U9SA 1DOLA 3HKZE 3HOXG 4BBSG 5TSSA 4C1NK 3PCOB 5IYCG 1N9WA 3S16H 2IHFA 4LF4L 4JOIA 1TR8A 3T1YQ 4DR1Q 2ENBA 3LKXB 4RGNA 4EQ5A 3HOZH 1JQYD 4AH6A 3S2HB 1STAA 2XRQD 1VQCA 2A8VA 2N3SA 4H44C 3CC7A 1HZAA 3I4NG 4A93G 4ZKCB 5ELOA 4XQQA 4R4TA 5IT9c 5C4XG 2EXZA 2CQAA 5CBEE 1EU3A 2OTLA 4QMGA 3TMEA 5IGEA 3AFQA 3K5NA 5M5WB 2F0NA 3OIQA 1A63A 3PO2H 4IPDA 5NUCA 3CCMA 5E1FA 1EIFA 1EEID 3BG3A 1G291 1Y8NB 1K0RA 1WTOA 2Z9HA 1VQ8A 1WTQA 3PQHA 4LWCA 4FF4A 1BXTA 5M3MG 1XNQL 1TS5A 3VYTA 4B3SQ 3PQIA 1F9SA 4LF5Q 2O4XA 4B3ML 1MBYA 4A76A 3P75A 3NE5B 1I94Q 2EDGA 3Q23A 5M3FG 2K32A 2XGTA 1NNXA 2EZVA 4XIGS 5IIFA 1CQVA 2F0IA 3U4ZA 3A55A 3U9OA 3PIP3 4E5RA 2WB1G 4HR7B 4LK1C 1F2ZA 2UUCL 2KCCA 1NUCA 2KXQA 1HFGA 2BH2A 4DV3Q 1VQ7A 5LMNL 3OOCA 3VR6A 1EUJA 3BVZA 1PTOH 4JBJA 1PH2A 1GJXA 4DNIA 1XMOQ 1SBBB 2VUMB 2PNHA 4JC0A 1HHVA 1SROA 4IUPA 4ZRZA 3C3LA 2NVQH 5JJLA 3MZ5A 1BF4A 3IKJA 3VYRA 2AUJD 1S4ZA 4LF6Q 1XPUA 4A3MG 3IFDA 1SNMA 1ESRA 1ENAA 2NVXH 3EBEA 4PNYA 3D8GA 4A3FB 2M8JA 1UWVA 1EWHA 1WMVA 1AW7A 4RKBA 1RCVD 3T53B 5E7NA 1IBKL 3WDNA 2ZXOA 3DUZA 3GP7A 2RDHA 1ASZA 1Y69U 4L8JA 2AQ2B 3J7ZC 1N34Q 4KV6A 1G91A 1S5DD 1O78A 2ZQUA 1Z7TA 1EG4A 4OL7A 2G5DA 1U0LA 2PI2A 4DR4L 3NQIA 2MP1A 1HQRD 3KYHC 5BR8L 1OXXK 3S1QB 4GZYC 2R92B 2JA5G 3WWVA 1LTTD 4X66L 1A62A 4ABNA 3GV3A 2BDOA 4C3HH 1CA5A 3CQZB 3W2DA 2RCNA 1VQ5A 1EG3A 5CV5A 4ZYSA 3R3OA 3CC4A 1A15A 1PA6A 1R4PB 3K8AA 4DR7L 2L1BA 2Q2TA 2CKZB 4OELB 2E75C 2J0TD 3GTOB 4LFAL 4B3TL 1RP5A 2F4IA 4IURA 4QF4A 2K28A 2JA6B 2WAQG 1I50B 2E2JH 4KN7C 2CCZA 3H3VC 1JJCB 5EBDA 2PO4A 3CAMA 4DV2L 3FSBA 2A73B 5LHY1 3KK7A 1LTRD 3MXUA 4IN3A 2KA7A 1SYBA 1T5XD 2YU9H 1R4QB 2A68D 3VR3A 4DR6Q 3PF4A 1S5ED 4JYAL 1VMPA 1AN8A 4YWLA 5J1ZA 4HTHA 3VR2A 1AE3A 3MA2B 1LM0A 1NCVA 4E6IA 4BWGB 4GLVB 2DMVA 1WYDA 4J1MA 5IGDA 1IBLQ 4QB4A 5CORA 1BOSA 3T1HQ 3DM3A 2YSGA 2F52A 5KEEA 1LT6D 3DHQA 1BNZA 4A3JH 4DV7Q 5G3LD 5FLXc 2F21A 5KIXA 1IZ6A 2GA4B 3FKIB 3G4SA 3KJOA 4BS9A 2BCOA 4ALPA 1TWFH 2N78A 2ZM6Q 3RZDB 1GHKA 3FHWA 1SAPA 1LT5D 2QF7A 1JORA 1WTRA 3ONAB 2K5VA 4EQPA 3T1YL 3GD7A 4DR1L 3I72A 3ZJYC 1RJTA 1U4MA 4OO1H 5C5LA 1BQQT 1TKWB 1TXYA 3K5OA 2NN6H 3CP0A 4RHSA 3OW7A 2VB2X 2E8GA 4K5WA 1XYIA 3HOWB 3PV0A 2JXMB 2OXPA 2NUCA 2M00A 5ELEA 4UPAA 3TCZA 2LSSA 1TWCB 1DXMA 3KLSX 4IUVA 1B50A 1EQVA 2RSNA 2Y0SG 3K5LA 1CZWA 2B2WA 4O1NA 4ULLA 3U58A 4HCEA 2JN4A 5IYBH 4C3IH 1MJEA 4CDEC 4B3SL 1FYCA 3HOUH 4KY5A 1KLUD 2OCEA 4R8IA 4UHVA 4LF5L 4DAYB 3L7ZC 1V8QA 1YIJA 1STBA 3SGIA 2A6HC 1I94L 4C3JH 2GVAA 3K0XA 3DXJC 1XWEA 1NMGA 4RH6A 1BR9A 4WJWA 5CBAE 3SVMA 2MHVA 2WIIB 3IFTA 2RVLA 3HOYG 2B2WC 4KK7A 3U4VA 3D4RA 1KNAA 4RCNA 4XQJA 1KHIA 4S3SA 3F2UA 1T9HA 1ZYRC 1ILQA 3JC66 1X3FA 5EBCA 1PTOB 4DV3L 1TY0A 2K5WA 3EQLC 5J39A 2FMCA 2B39A 1K28A 3K7UC 3G6JB 2DJYA 3J7AV 3JAMi 3J80E 1I4QA 5HURA 1AP0A 3BVGA 1SNOA 5IYDH 1ILPA 3MC0B 4LFBL 1O7LA 3RN5A 1S72A 3I8ZA 1XMOL 1QVCA 1Q8IA 4YY3Q 1AFPA 3PO3G 4CDCC 3DWQA 5IP7G 1DOMA 2JA8B 1AZPA 2R93G 5I2XA 1Y1VB 3N52A 5DAUA 4DV1L 1A2UA 4LF6L 3Q8DA 1NR4A 1MSHA 2WFWA 2XWJB 4B08A 3T51B 4EQNA 2NZHA 2YSHA 1EIYB 3ODKA 1T5EA 1N33Q 4KHVA 1JJGA 4CKCA 3MCBA 1GUTA 3ICEA 1W6JA 3J81i 1Z47A 1QZHA 4IPCA 4OXPA 1JOQA 3A7LA 1LTBD 1SMYD 4JI2Q 4DXFA 2F0EA 4NDXA 1NBWA 3RLFA 4XTCS 1RTOA 3BS1A 1N34L 1B2TA 5KYIA 5ELBA 3TS2A 5GAEC 5H1SE 3RR5A 2KQ3A 2FJ2A 2F0UA 3CHBD 1B9MA 3H09A 3M4YA 4DV4Q 4A3CG 3EROA 3HP3A 1VQEA 1A3VA 2ASBA 5GQOA 1MGSA 3DEOA 5ELFA 1GUGA 3QG1A 4G7ZC 3ULJA 1PH3A 2EYMA 3BZKA 1BUVT 3D4WA 1EY0A 1VF5C 4IZ8A 1PRTC 1HNXL 1K8AC 2JE6I 4NXNQ 3Q6SA 2F3VA 1WI5A 1Q3LA 3S2HH 4DKAC 5IOCA 1STGA 4R4CA 1WTXA 4A3KG 3CCEA 3ZYYX 5M5XB 3WH0A 1MSGA 4PZ7A 4DR6L 1CUKA 3VA5A 2ZTCA 1Y8OB 3ULPA 2NZOA 5M5WH 3ERSX 4PMCA 2EY6A 3CPWA 4JI6L 1QB5D 3OWFA 5U47A 3MCBB 2B63H 4A3JB 3SK6A 1X3PA 1BBWA 1IBLL 4DV0Q 1EWCA 1M1KC 2R7DA 3KBGA 4DV7L 2CH4A 1EYDA 1L0WA 1GHJA 2E2DC 2EY5A 2I0QA 2VQEQ 1XNRL 4IO9A 4A3GG 1C7YA 4JW0A 2ZM6L 4FYDA 4G7OC 2ZQSA 3M9BA 1SNPA 4Q5VA 5ELCA 1PFNA 4RMFA 3V96A 3ND9A 5KNCA 3K7AB 4HN7A 3CKIB 2E74C 1HA5A 4GOPB 1Z9FA 4UP7A 4LAAA 2A5HA 1U4PA 4A3DB 3C1EA 2D2CC 3GTPH 4A0TA 1MHWC 4R4QA 2QA4A 4RAUC 3KFUA 4FVMA 5HY6A 2ZXRA 5C44G 2NVTB 2EY2A 4JI4Q 1EWIA 1PZJD 2RA4A 4FXKC 4LF9Q 2R7ZH 1X32A 1IBMQ 1JMCA 1O7IA 2XSCA 2EYPA 1EY5A 2IX0A 2C9OA 2VUMH 1FVIA 3CCJA 3I4MG 4BBSB 4HJAA 4PMWA 3HFZB 4C3JB 1QE6A 4JG2A 3KLWA 1UE1A 4YHHL 3KBXA 1DZ1A 2NYZD 3QJYA 1ZKOA 2KUMA 2IX1A 3S1MH 1U9RA 1PFMA 2PZTA 3S14B 4A93B 3ERQA 4HSPA 4A3FH 3TP7A 5ELDA 5C4XB 4KJOA 1G2TA 1L0YB 5C0XH 5E65A 2L11A 1PH4A 1PYBA 4HJ9A 1I4XA 4JV5L 1ZEQX 1C8CA 2E2IB 4RGMA 2WINB 3A54A 1EFID 2D9UA 2D5DA 1SNDA 1HR0Q 3HG9A 5M3MB 3E9HA 4PV1C 4A3IG 4GS3A 3W1BA 3S1QH 1DM0B 1KTKA 2R92H 2XPBA 3UDGA 1PZKD 3TSSA 2E2HB 1VQNA 3CQZH 3NELA 5EQ0A 4YY3L 1K9MC 1VDZA 3I90A 3KUPA 4L5SA 2K6AA 1EEFD 2WB1B 4DPGA 1PDQA 3GTOH 2YTXA 3MFYA 2WP8J 2JA6H 2B3GA 2RBMA 4WRDA 1G6ZA 1SN8A 1I50H 5C3EG 1SE2A 5KNBA 3VR5A 1N33L 3GTLB 2I5HA 2HHHL 1HCZA 1E1TA 3HRZC 1RD9D 3QOLA 3VA7A 1JCKB 2DNCA 3R2IA 4BXXH 1JT8A 3M3YH 3SHLA 3HS0C 3ER0A 2YSBA 4JI2L 5JVH3 4LF8L 2SNSA 2ITKA 1PTOD 4RG1A 2CWAA 1ZCNA 2CW0C 2PQEA 3FEWX 4DV4L 3J81j 1HPCA 3NBHA 5CYUA 2HCIA 4O42A 2X6LA 2VY3A 2MPMA 4F87A 3B6YA 2UXCQ 2Z0SA 3NWTA 1BBUA 1GKHA 3FKIH 3HOVG 1GO3E 4IFDH 2K5QA 3V05A 5C4JB 4DK0A 4K5VA 1FNVA 1JB3A 1NMVA 2I07B 4BA2I 1QNKA 1K83B 2F0HA 1CZGA 3RZDH 2HIVA 5JJZA 2LS01 4N9TA 1PRTF 2KENA 1HH2P 2AWOA 1E0BA 2F0PA 4IPHA 4NXNL 2Z4IA 5CMDA 3T4AC 4YCVA 3RNUA 3D6CA 2DWVA 1I5HW 4UY8C 3W3AA 1P16A 4K8JA 1J6QA 3SEBA 3H3VH 5FO9B 4JI1Q 2O5IC 4JVZA 3AEVA 1QNUA 3EJIA 1LT4D 1HA6A 4X3SA 4DU9A 3HOWH 1WTWA 1RIPA 3K80C 4A3BG 4N8X1 2ZR6A 3TP8A 4X3KA
chains in the Genus database with same CATH topology
3LWUA 3DM1A 3K81C 3A8JE 2B63B 1TWCH 1IL8A 5IGBA 3QOJA 5E4XA 5GAGC 1J9OA 3M4PA 4X64Q 1V1QA 1O6WA 1VQJA 4IUNA 3JAML 1L2FA 1RL2A 4DV0L 1W6KA 4LUZA 2VW9A 4JI0Q 1EZ8A 4DR5Q 3NK9A 2OQ0A 2ATWA 4MN3A 1NTGA 2VQEL 2XP7A 2YV5A 1C48A 2A6ED 2IJ0A 3UI2A 4BBRG 5LMUQ 1VQDA 2EYLA 2QEXA 5IODA 3KDFB 3L2PA 2VQFQ 3NBHB 3N6RA 3GTPB 3A8KE 1VQFA 5K36G 5FJ8G 3KLSA 2AUKA 3X3MA 4Y7NB 1PYSB 1EZ6A 2UU9Q 4YWKA 4U85A 1D1KA 4GLAC 1D7QA 3J81L 3E0EA 2KJXA 1LLRD 4DR3Q 4WORA 2R7ZB 1Y1WG 2NTTA 2IX3A 4DNTB 3RN2A 2Q2HA 3FRPB 2EYHA 4LF9L 5IGCA 1IBML 1IW7C 1HFNA 1HZBA 1WOCA 2K5DA 2SNMA 5IP9G 3SK4A 2JA8H 1WJJA 3S15H 3CNGA 1D6EC 4BY1H 1X54A 1Y1VH 4IJLA 1ZXTA 3S1MB 1N32Q 2R6GA 3IAYA 1XMQQ 1I3QB 5FLMH 3GTJB 2WV6D 1E2VA 4LJZC 3KJPA 1FL0A 4NMZA 3AYHB 1JOOA 5IT9L 4F7XA 5AJ3Q 5EPLA 1PYWD 5EGTA 1GUWA 3J80c 1PLFA 2WACA 2KCTA 4ZAIA 1D2BA 2Z6KA 4KJNA 1GOZA 2IW3A 3TS0A 2R7FA 3F8TA 4EGVA 1RIPA 1HTPA 3BZCA 4QJFA 2CVRA 2YSFA 4RWSC 2PNRC 4A3LH 1ENFA 1BCPC 4X3UA 4HJ5A 1D8LA 2Z6KC 5COYA 3BDOA 3P7JA 1CA6A 2XNAC 2PPBC 2F4VL 1VQAA 2K01A 4DV6Q 3TP6A 1NAPA 1CK1A 2BA0A 1I4PA 2CWPA 1XPRA 1YITA 3K57A 2ZR5A 4IQZA 2MO1A 3HOYB 4K0KL 3GO5A 2F0TA 5FOBB 4BY7H 4DGZA 4YWMA 3MAQA 2BA1A 2FHTA 4HIDA 5LL6X 2BE5C 1B53A 2ZXPA 4CHTB 2HQEA 5IE8A 3F2CA 2VB3X 1A0IA 3M3YB 4ZLTF 2WB1E 3PUXA 4I65A 2KEDA 1VF7A 2F0VA 1RHPA 1PZID 2X6GA 2KHSA 4IFDI 5M5XH 2KVMA 1D1IA 2A69C 3EA6A 3A0JA 2DNEA 2Q2UA 5I6WA 4JI8Q 3M4QA 1S5CD 2KCMA 2VNUD 1PH8A 3SDZA 2M3OW 5AHTA 4M8AA 1BBXC 1FJGQ 2J4XA 4L5TA 2ICIA 1F9QA 1Q1EA 2OWOA 4RGTA 3A5UA 4CKBA 1E22A 3CRKC 2VZAA 2XVSA 4UAIA 1Q8KA 2UXCL 5JEAH 4P75A 3CCRA 1B8AA 2JA7G 1WVLA 5D3DA 1QOHA 2ZT9C 4L6TB 3PIOA 1EY9A 3PUZA 4HIKA 5C4ZA 2QRVA 1KNEA 4KKUA 3HKSA 4JBKA 4LF7Q 2N8NA 2VL6A 3RMHA 4M1UB 2V4DA 3RLOA 1JWUD 4C2MB 3K7AH 4FF1A 5CC4A 4POGA 4JI7Q 4R8NA 4OHJA 5DNFA 4LUVA 4A3DH 5EKKA 1Y8PB 2KHJA 4QIWE 5E64A 1LTLA 1WCMH 1XTDA 2F3WA 4B9XA 2NVTH 2K33A 3PGZA 1PV4A 2UXDQ 2GVBA 2F03A 4R1JA 4PZ6A 3I3CA 4MIUA 4A3FG 3MWYW 4OWWB 5E5WA 5CGKA 3NHHA 1STYA 2F0MA 1G2SA 2UUAQ 1MI2A 3NTHA 4HMIA 4BBSH 3HOXH 1TY2A 2XPAA 3A7AB 5IYCH 1J5EQ 3M4OH 4DR5L 3A5ZB 2VXWA 5I2YA 1DONA 1CKOA 4A3EG 2IY5B 4G57A 4L5RC 5CV7A 4XQNA 1E2ZA 1SE4A 1SYFA 4A3KB 3TZUA 5C0XJ 2K03A 1YBYA 2WAQE 3S14H 1II3A 4A93H 2XIWA 3I4OA 2JQOA 1WR7A 1SFOB 5C4XH 2VQFL 2ZQTA 3TZDA 2JX8A 1VQMA 3O13A 4ZUIA 5FO8B 1SYCA 4NB3A 2E2IH 2PW7A 3NPPA 3H0GG 2B2YA 4QGUA 3RD4A 1PFSA 1EIHA 5M3MH 1JWMD 4X3TA 1MIUA 5FLXL 2L15A 1ET6A 1K9RA 2NB0A 1B4OA 2EVBA 1OTCA 4U68A 4R4OA 1PVOA 2BDNA 2E2HH 2B2YC 3S15B 1FLCA 4K2LA 4A3GB 4BY1B 3BVMA 5M3FH 1VQPA 4LFCQ 1RKNA 4GN3B 2QEJC 1CHPD 4FNFA 1NY4A 1SYDA 3M85A 5JOBA 1A2TA 1N32L 4YIJA 4FXDA 3F1ZA 5KYLA 5J22A 2EZ5W 4QUCA 5E66A 5A2QL 2F0JA 1JICA 3BU2A 1QILA 2HUGA 3GTLH 3CXCA 3DWAA 5C44B 3T13A 1ONLA 1F77A 4PMBA 1J8IA 1TU2B 1EIGA 1Q12A 4V190 1H95A 4KD4A 1KDCA 1TWHB 5E62A 3E6ZX 1X56A 4FO2A 4U86A 1E7ZA 1O80A 5J3BA 3HOZG 3URYA 5K5PA 3IRBA 5M5YB 3I4MB 2NVYB 2AWNA 1ASYA 1IHZA 5JJKA 1AEXA 1B44D 3HGBA 1K8OA 2MFIA 1BCPF 4IFDJ 2WAEA 1NSNS 3OHXC 2Y0SE 4DV6L 3CW2C 1HQMC 2ZQVA 4BY7B 1EOVA 2CQOA 3PO2G 3FS8A 4DAPA 4X6AH 5C4JH 2AQ3B 1K83H 2F0SA 2RF4A 4MHEA 5JVG3 1K73C 3D4DA 4MNOA 4JI5Q 2L4JA 3CF5A 4NXMQ 3D3RA 1SNCA 1JC7A 3NTKA 3X3NA 4KHPQ 2L4NA 1C9OA 2ALYB 1JJ2A 5D3IB 5IWAQ 1F8AB 1KDBA 1OXVA 2H5XA 3CMAA 1I6VC 4DV5Q 3TN2A 4A3IB 3CU7A 4XYOA 1IKMA 3I4LA 4FF3A 2JA5H 3SK5A 1MD2D 4FDBA 4KKSA 1X3EA 3D0FA 4OO1I 4JI8L 5I9OA 1UEBA 2NBFA 4IJHA 2GN5A 1A3UA 2NN6I 1YJNA 4QQBX 1QCBD 3T1HL 4LNQA 3BYTB 2MO0A 2RSOA 1FJGL 2RHQB 4X65Q 4XXEA 2XP5A 4AYBG 3H94A 2KBNA 2RDFA 4L63B 5C3EB 3CCUA 4OONA 3MXPA 1LTGD 1TVXA 2K04A 3K6OA 1UE5A 1STEA 1XNQQ 3RUZA 4KN4C 1PRTB 1F2MA 4B3MQ 1IKLA 1QVFA 1KAWA 4WFN3 1TT2A 5EPJA 4LF7L 4P73A 1L1OA 2F3IA 3I2ZA 1STHA 1OXTA 4HCSA 1X3GA 1IYUA 1N8RC 1UE7A 1VS0A 4JI7L 4Q0FA 1DOKA 1EY7A 4Y7NH 1WCMB 1FD7D 1JWSD 4HSVA 5DM73 3MVVA 4GN4B 1YZ6A 4KY7A 4MTNA 1HUNA 4KY6A 5FLMG 2B8FA 2PZWA 2F0GA 2K5HA 1L1OC 3NTIA 3G7LA 4FXGC 3T56B 4J15A 5AFWA 1TK7A 1LV9A 2Q8TA 5EJWA 5I6YA 3HOXB 1PTOF 2ICEC 3HOVB 1D5MC 1KAAA 5C3WA 3L9AX 3M4OB 3S1NB 4APVA 2UUAL 1AH9A 4QL5A 1X9NA 4DUYQ 4G4KA 1VQHA 3J80i 4ZKBB 1Q90A 1J5EL 1BKBA 1RODA 2DY7A 3SK8A 1UAPA 4IPGA 2L9HA 2B29A 1SLJA 3HKZG 1E1OA 4A3LG 3SXHA 4JBWA 1I6HB 1F9RA 3I4NB 4C3HG 1I3QH 4OWXB 3GTJH 3LE4A 1K9QA 1PH9A 2RQXA 3D31A 1CSQA 1JE5A 2VS1A 1F9PA 3KF6A 3FP9A 2DK7A 2L55A 1W2BA 4HAEA 1EU4A 2WKCA 4TRDA 5IGFA 1Y14B 1SDFA 5I9PA 3S9WA 3LNNA 1S40A 5EPKA 4ZK9B 2YTYA 4KLKA 1QUQA 3VYSA 2XN9C 3S17B 2D0OA 1X3QA 3HEJA 2LKVA 2ZTEA 4JBMA 4HEDA 2KHIA 3MXNA 4ME3A 1YNJC 5M3FB 4GNXC 3CD6A 1L1OB 2TMPA 2EYFA 5JPNC 3STBC 2MDIA 5JAVA 3WOEA 5CV8A 2BH8A 2JYOA 4LFCL 3BJUA 4TVAB 2M2LA 1VQLA 3HOYH 4AYBE 3QB3A 3FVQA 4XDXA 2O5JC 1E2WA 3H15A 1Q1BA 2EOTA 4A3JG 3TP5A 3UE0A 1YNNC 2B2UC 5D14A 5C3XA 4P71A 2X69A 3J7AF 1EQRA 1XJVA 2K75A 4K2KA 2DGYA 3M7NA 3M7GA 3PUYA 4ILWA 3NQTA 4OO1G 3PO3H 2LY7A 3L4HA 4P72A 1KLGD 1B9NA 2NN6G 3KF8A 5IP7H 2IPKD 2MGSA 2NWGA 4A3MB 5E4WC 3KF6B 4JYAQ 3FPPA 2AQ1B 5JEAJ 2B2VA 2XP6A 4RGOS 2RHSB 1HTLD 1EY8A 1F2YA 4P2CB 4V0BA 1TS4A 1SR3A 3T16A 1NR2A 4DAVA 2MNAA 1YJ9A 1ENCA 4QIWB 2I5LX 4C56C 4AIMA 2YAJB 2SDFA 4PG3A 2I46A 4GLXA 1QUQB 2A6HD 5CR3A 4K5XA 4DAMA 3F2DA 2B2VC 5IYBG 1JMQA 2J7ZA 1VMCA 3ITPA 4C3IG 3HOUG 3EVQA 3MXNB 4JI5L 1C0AA 4C2MH 4NXML 3GTGB 2XP9A 1CHQD 1P8LA 4KHPL 4H7BA 1KXLA 4C3JG 4B9WA 4HIOA 2JA5B 2EXDA 5IWAL 2OQKA 1VQ4A 1SMYC 1HNWQ 4DV5L 2D62A 4A3CH 1ZYRD 1ESFA 2JJQA 1LTAD 4F88A 3WOFA 3E0JA 2UUBQ 1X6OA 3MHBA 3NBIA 1WD0A 4XT3B 4A4IA 1C4QA 3EFXD 1TWAH 4IALA 4JOIC 2PMZB 3KABA 2WAQB 4POFA 4DUZQ 5DEHA 2ES2A 1ICWA 4U84A 4X65L 3I73A 2R61A 2SEBD 2C35B 3NTPA 1PH7A 2PZUA 1OXUA 2QDBA 5LL6S 2XP8A 3SR1A 5IYDG 1PH1A 1HR0W 2Q5AA 1TR5A 5D65A 3E9IA 2KECA 4A3KH 3ND8A 3S2DB 4K14A 1S5FD 5BN3A 1KDAA 3KF8B 2V1CC 3UDIA 1K8MA 4H13C 4WJ3M 2EQSA 1SFOH 1OXSC 3OPOA 1YW5A 1K3RA 1EYGA 2LXKA 1SMXA 3AQQA 4RCOA 2ZJQA 1LTID 1B70B 3F2BA 2E45A 3J7YW 3Q0AA 4JI4L 2F0QA 3KADA 2F0WA 2LXJA 3OOBA 4EVOA 3VDYA 2H4OA 4IUUA 5C0XI 2HIXA 4KHZA 1WTVA 2CHBD 2JA7B 1I4RA 1NJIC 2OF1A 1N36Q 2EJMA 5IGGA 4A3GH 1JE4A 1VQKA 3KOJA 1EOTA 3GTMH 2XTIA 2AHOB 1HJPA 4DUYL 3PIPA 4LFBQ 1UEAB 5C4HA 4CJ2C 2K05A 1F2LA 2WADA 2Z1CA 4ODGA 5G3LF 3GTKB 5HGQA 2JA9A 2JXWA 1PRTD 1LYLA 1GM5A 1Z6HA 2JEBI 2XRSD 5A35A 3FSCA 2EJFC 1A6XA 4NW2A 4DV1Q 1SYEA 1E24A 4P74A 2HDLA 5E3FA 4J6HA 2KOLA 2EY1A 2EPBA 3OMGA 5C44H 3CCSA 2K7VA 3KLRA 2N88A 1TWHH 2R3ZA 4I7ZC 2EJGC 5KNDA 3JAME 1MKHA 2Y0SB 1EY4A 1LUZA 4A75A 1HR0L 5M9OA 1PH6A 5M5YH 3I4MH 2NVYH 2ZR4A 4J8QA 3RLNA 5GROA 4DXGA 2L5TA 4A3EB 3EIVA 1HZCA 3NP8A 4AQYQ 2I5MX 2Z4HA 2IL8A 3QIAA 1VCIA 1FGUA 2RKSA 3P1HA 1XTCD 1U5KA 3S1RB 2UXBQ 4F8MA 3GDEA 5FKAC 1RDPD 1M4VA 2E5LQ 1NE3A 4JCVE 2AKWB 3FMCA 2F0LA 5BN4A 2B63G 2F0KA 1G51A 4BA1I 2AMCB 2Q8IB 3J81E 4C1NI 3H0GB 3LWEA 4ME5A 1HNXQ 4LUOA 3TREA 4RFBA 1V43A 5C5MA 1CSPA 3Q24A 1DYQA 1WTPA 1HXYD 3I56A 2B2TA 2ZTDA 5GAHC 1TWGB 3MFGA 4B3RQ 3PIO3 1GD7A 4YCWA 5HGTA 4A3IH 2DY8A 1KABA 3PO3B 1Q46A 3NWSA 2FFKB 3L3OC 2R93B 2G9DA 1HNZQ 5JJIA 2L0CA 3G71A 3H3VI 2TSSA 1GUOA 2JEAI 2B2TC 4DAYA 4GKJQ 4OGQC 1BCPB 3FPUB 4OIJA 1G8ZD 3FDTA 2FINB 4YCUA 2RDGA 3QO2A 3OTOQ 1LACA 4JI6Q 5IT9E 3UDFA 1D5ZC 5C3EH 3HZXA 3CPFA 2R7ZG 3OW2A 1TQOA 1I4GA 1BO0A 3R8BA 3AFPA 1V9PA 2JSOA 3J80L 2VUMG 4EQOA 3DMUA 5BN5A 1FNUA 3R93A 2XWBB 1XNRQ 3S16B 2QCPX 1TS3A 2L12A 4JI1L 3H91A 1OO9B 3HOZB 2K4KA 1Q81C 2XP4A 1CQFA 3P20A 1HNWL 4GKKQ 3GTQH 3LX0A 4IOAA 1PTOC 2MQHA 4QY7A 2RE3A 4DA2A 3C2PA 2M9VA 5C0XG 1E3PA 3U50C 1TWAB 3IL8A 4X64L 4CJ1B 2UUBL 1CKNA 2PCFB 4OIKA 3DLLA 3UDXA 3VR4A 3PO2B 5KRUA 3HOVH 3J7A5 4KKTA 2D0PA 1UE6A 3TQYA 2NZ1D 4DUZL 3S1NH 1SEBD 4JI0L 2N55A 1HRJA 2IHEA 1YNJD 1CKMA 1AE2A 2EIFA 3STBD 2JK8A 2R92G 5LMUL 2B8GA 2OEOA 4QIBA 4NP5A 2PMZE 3I4NH 1I6HH 1H9JA 2E76C 2N49A 4KMUC 1SSOA 1JR0D 2WKDA 2A19A 4YHHQ 3V2TA 3I55A 1CM9A 4RA8A 4CKEA 1L0XB 2UU9L 4UP9A 4A3BH 4JI3Q 5IY0A 5CV4A 2F0DA 2JA6G 5EKLA 1LTSD 1YNND 1ET9A 4DR3L 2F0FA 2YSIA 2QGQA 4HJ7A 3S24A 4JV5Q 3H6MA 4DR2Q 2K52A 3RZOH 1UUPA 3CC2A 4AYBB 3TRZA 3S17H 4BXXG 2CW0D 4RKLA 4CGYB 3TBIB 3PUWA 3G6EA 2HQLA 3GTMB 3GQBA 3NUCA 1QWYA 2LAJA 1N36L 5ISRA 3I91A 3MEFA 4HIMA 1RF2D 1H9KA 2YYZA 1EL0A 3A74A 2Q8RE 1JB7A 4BBRH 4K6DA 3TDQA 4OX9Q 1GUSA 2NVQB 3K80C 1XMQL 1KRSA 3R2TA 2SOBA 1I4HA 4ZUJA 2A6EC 5K36H 5FJ8H 1CKNB 3VYUA 5AJ3L 4DK1A 1XXGA 2NVXB 2ZJPA 3BDLA 3FKIG 1VQ6A 4ZQ3A 4IFDG 4H0LC 1EYAA 2ID0A 5DLQE 1Y1WH 2Q2IA 2PQAA 3CRLC 1XPOA 1IYVA 1M90C 3CCQA 2HHHQ 4EX5A 2FMMA 1QVGA 1RTNA 1YJWA 5CV9A 4IUQA 4MZ9A 2K14A 3KAGA 1BDOA 4LF8Q 5IP9H 4HMJA 4PZ8A 3I7FA 1X65A 4A3MH 3I70A 1STNA 1MJCA 3OYYA 2ZJRA 1JOKA 1SXTA 3HOWG 2G9HD 2M8IA 3HKZB 1CFMA 1X55A 4AQYL 1S5BD 4C3HB 4G7HC 1PINA 1H9RA 2QKIC 1HZ9A 4X62Q 3CCLA 2UXBL 3UE1A 4GOPA 2E5LL 1DD2A 5EKIA 1R9TH 2DUDA 3PSIA 3E5SA 1YEZA 4NPSA 5JPMC 4LF4Q 2E2JB 2KCNA 4R9WA 4RHRA 5CV6A 3GTGH 5FLXE 4KTAA 4GOPC 1IL2A 4B3RL 2PW5A 4GN5A 3AMUA 3NSWA 2MUYA 1WD1A 2PYKA 2YU9B 5KGUA 3C1FA 3AU7A 3Q22A 4KD3A 5EAYA 2FXQA 1HNZL 2Y8NB 2K5NA 5I4DA 4GKJL 3MEHA 4DK6C 1FR3A 1B3AA 3W1GA 1B7YB 4DN4M 1IW7D 5C6AA 3MQHA 3DWPA 1YI2A 3TDBA 5A2QE 1V1OA 3OTOL 1QZGA 2PQAB 1YHQA 3AB9A 4U673 4XT1B 1SJHD 3KAFA 1SJED 1XX8A 3K5MA 3MXGA 3DEPA 1TWFB 1GXDC 1DGSA 4CBVA 4DNRB 3S2DH 5FO7B 5DM63 1SRUA 2JA8G 1B1ZA 4N9PA 3PMFA 1UNSA 4BY1G 1LT3D 1Y1VG 2CFMA 1QG7A 2EYJA 1SNQA 3L0OA 2A68C 2UUCQ 3GTQB 5ELNA 2BOSA 1PFBA 2EYOA 3PUVA 2DN8A 1KC8C 2UXDL 1V1PA 4DK3C 4GKKL 4IUTA 1IXRA 5LMNQ 1KD1C 1CI3M 1PXUA 2A1AA 2PI2E 3W5OA 3A56A 4REXA 1EY6A 3OWEB 3CMEA 1Q86C 3D6WA 2JA7H 2OT2A 4XYQA 3NEMA 4FF2A 2DK1A 1BCPD 4O2DA 3ULLA 3GV6A 3K59A 2JMFA 1BVSA 4K8IA 1G6PA 2Z8LA 2YTVA 2NTSA 3TC5A 4KI0A 4C3IB 3BYYB 3HOUB 3GTKH 1YHBA 1SE8A 4PQXA 2OTJA 3PF5A 1O7ZA 2A74C 2O2LD 3KAHA 1Q7YC 1EQTA 4TQUS 4Y52H 1PMRA 1U4LA 1YVCA 1HUMA 2C5CA 4A3BB 1H9MA 2BE5D 4GNXA 1CT1D 5F2DA 3MTSA 4O0AA 4OWTB 5GADC 2EE1A 1IBKQ 4BY7G 3KAIA 4Z9CB 4JI3L 3TEHB 2XP3A 3RZOB 4LW1A 5FK9C 3OMCA 1M8AA 4FP5D 1NMFA 2A69D 1H9SA 3QWNA 1W3SA 1GVPA 1KQSA 4DR2L 4ID6A 4IOCA 1VQ9A 1TS2A 3K0YA 2K1BA 4DR4Q 4R4IA 5T1GA 1PHJA 3SE0A 5BR8Q 3NXWA 1A3TA 2B2UA 4A3EH 4BBRB 3BDCA 3LKXA 2QILA 2IWHA 4X66Q 1QJOA 1KIXA 1AZQA 2HT1A 4L5QA 5CQ2A 2K50A 1SYGA 1EYCA 2HCCA 3OSOA 3S1RH 4K6LA 1VQIA 2JP1A 3EN2A 4OX9L 2F4VQ 4DR7Q 1V1PB 1KRTA 1LO5D 3BZDB 4LFAQ 3C46A 4B3TQ 1D5XC 1VQOA 1YHAA 2LMCB 2LFNA 1ML0D 3JAMc 4K0KQ 2ZAJA 4LMQD 4JK1C 1VQBA 1Y1WB 3H0GH 5JEAG 5T1IA 1PH5A 1Q82C 1CTMA 1LABA 1WFQA 4DV2Q 2F0OA 1TWGH 4QUFA 2JV4A 1YNXA 1DCZA 3MQGA 3KCEA 4UDUC 1A8VA 3LGJA 1K8GA 1FGBD 2KEEA 4UP8A 3K58A 1IYJB 2R93H 4NKLA 1FNWA 4WJ4A 3OIPA 2F1MA 2H1EA 4A3DG 4DF7A 4TKOB 4HJ8A 1S3OA 4GNXB 4A0UA 4TSSA 1TIID 1WCMG 1EFWA 3CCVA 1KL9A 4CJ0B 3J81c 1O7YA 4QCLA 1SE3A 1U4RA 2IT1A 3KDFA 1R9TB 4X62L 3G48A 1EQQA 1I5FA 4DFAA 3NENA 4H02A 2HDMA 1GUNA 2MJ8A 1H9SB 5LMNW 1DJRD 3A8IE 3U9SA 1DOLA 3HKZE 3HOXG 4BBSG 5TSSA 4C1NK 3PCOB 5IYCG 1N9WA 3S16H 2IHFA 4LF4L 4JOIA 1TR8A 3T1YQ 4DR1Q 2ENBA 3LKXB 4RGNA 4EQ5A 3HOZH 1JQYD 4AH6A 3S2HB 1STAA 2XRQD 1VQCA 2A8VA 2N3SA 4H44C 3CC7A 1HZAA 3I4NG 4A93G 4ZKCB 5ELOA 4XQQA 4R4TA 5IT9c 5C4XG 2EXZA 2CQAA 5CBEE 1EU3A 2OTLA 4QMGA 3TMEA 5IGEA 3K5NA 5M5WB 3AFQA 2F0NA 3OIQA 1A63A 3PO2H 5NUCA 4IPDA 3CCMA 5E1FA 1EIFA 1EEID 3BG3A 1G291 1Y8NB 1K0RA 1WTOA 1VQ8A 1WTQA 3PQHA 4LWCA 4FF4A 1BXTA 5M3MG 1XNQL 1TS5A 3VYTA 4B3SQ 1F9SA 4LF5Q 2O4XA 4B3ML 1MBYA 4A76A 3P75A 3NE5B 1I94Q 2EDGA 3Q23A 5M3FG 2K32A 2XGTA 2EZVA 4XIGS 5IIFA 1CQVA 2F0IA 3U4ZA 3A55A 3U9OA 3PIP3 4E5RA 2WB1G 4HR7B 4LK1C 1F2ZA 2UUCL 2KCCA 1NUCA 2KXQA 1HFGA 2BH2A 4DV3Q 1VQ7A 5LMNL 3OOCA 3VR6A 1EUJA 3BVZA 1PTOH 4JBJA 1PH2A 1GJXA 4DNIA 1XMOQ 1SBBB 2VUMB 2PNHA 4JC0A 1HHVA 4IUPA 4ZRZA 1SROA 3C3LA 2NVQH 5JJLA 3MZ5A 1BF4A 3IKJA 3VYRA 2AUJD 1S4ZA 4LF6Q 1XPUA 4A3MG 3IFDA 1SNMA 1ESRA 1ENAA 2NVXH 3EBEA 4PNYA 3D8GA 4A3FB 2M8JA 1UWVA 1EWHA 1WMVA 1AW7A 4RKBA 1RCVD 3T53B 5E7NA 1IBKL 3WDNA 2ZXOA 3DUZA 3GP7A 2RDHA 1ASZA 1Y69U 4L8JA 2AQ2B 3J7ZC 1N34Q 4KV6A 1G91A 1S5DD 1O78A 2ZQUA 1Z7TA 1EG4A 4OL7A 1U0LA 2PI2A 4DR4L 3NQIA 2MP1A 1HQRD 3KYHC 5BR8L 1OXXK 3S1QB 4GZYC 2R92B 2JA5G 3WWVA 1LTTD 4X66L 1A62A 4ABNA 3GV3A 2BDOA 1CA5A 4C3HH 3CQZB 3W2DA 2RCNA 1VQ5A 1EG3A 5CV5A 4ZYSA 3R3OA 3CC4A 1A15A 1PA6A 1R4PB 3K8AA 4DR7L 2L1BA 2Q2TA 2CKZB 2E75C 2J0TD 3GTOB 4LFAL 4B3TL 1RP5A 2F4IA 4IURA 4QF4A 2K28A 2JA6B 2WAQG 1I50B 2E2JH 4KN7C 2CCZA 3H3VC 1JJCB 5EBDA 2PO4A 3CAMA 4DV2L 3FSBA 2A73B 5LHY1 3KK7A 1LTRD 3MXUA 4IN3A 2KA7A 1SYBA 1T5XD 2YU9H 1R4QB 2A68D 3VR3A 4DR6Q 3PF4A 1S5ED 4JYAL 1VMPA 1AN8A 4YWLA 5J1ZA 4HTHA 3VR2A 1AE3A 3MA2B 1LM0A 1NCVA 4E6IA 4BWGB 4GLVB 2DMVA 1WYDA 4J1MA 5IGDA 1IBLQ 4QB4A 5CORA 1BOSA 3T1HQ 3DM3A 2YSGA 5KEEA 2F52A 1LT6D 3DHQA 1BNZA 4A3JH 4DV7Q 5G3LD 5FLXc 2F21A 5KIXA 2GA4B 3FKIB 1IZ6A 3G4SA 3KJOA 4BS9A 2BCOA 4ALPA 1TWFH 2N78A 2ZM6Q 3RZDB 1GHKA 3FHWA 1SAPA 1LT5D 2QF7A 1JORA 1WTRA 3ONAB 4EQPA 2K5VA 3T1YL 3GD7A 4DR1L 3I72A 3ZJYC 1RJTA 1U4MA 4OO1H 5C5LA 1BQQT 1TKWB 1TXYA 3K5OA 2NN6H 3CP0A 4RHSA 3OW7A 2VB2X 4K5WA 2E8GA 1XYIA 3HOWB 3PV0A 2JXMB 2OXPA 2NUCA 2M00A 5ELEA 4UPAA 3TCZA 2LSSA 1TWCB 1DXMA 3KLSX 4IUVA 1B50A 1EQVA 2RSNA 2Y0SG 3K5LA 1CZWA 2B2WA 4O1NA 4ULLA 3U58A 4HCEA 5IYBH 4C3IH 1MJEA 4B3SL 1FYCA 3HOUH 4KY5A 1KLUD 4R8IA 2OCEA 4LF5L 4DAYB 3L7ZC 1V8QA 1YIJA 1STBA 3SGIA 2A6HC 1I94L 4C3JH 2GVAA 3K0XA 3DXJC 1XWEA 1NMGA 4RH6A 1BR9A 4WJWA 5CBAE 3SVMA 2MHVA 2WIIB 3IFTA 2RVLA 3HOYG 2B2WC 4KK7A 3U4VA 3D4RA 1KNAA 4RCNA 4XQJA 1KHIA 4S3SA 3F2UA 1T9HA 1ZYRC 1ILQA 3JC66 1X3FA 5EBCA 1PTOB 4DV3L 1TY0A 2K5WA 3EQLC 5J39A 2FMCA 2B39A 3K7UC 3G6JB 2DJYA 3J7AV 3JAMi 3J80E 1I4QA 5HURA 1AP0A 3BVGA 1SNOA 5IYDH 1ILPA 3MC0B 4LFBL 1O7LA 3RN5A 1S72A 3I8ZA 1XMOL 1QVCA 1Q8IA 1AFPA 4YY3Q 3PO3G 3DWQA 5IP7G 1DOMA 2JA8B 1AZPA 2R93G 5I2XA 1Y1VB 3N52A 5DAUA 4DV1L 1A2UA 4LF6L 3Q8DA 1NR4A 1MSHA 2XWJB 2WFWA 4B08A 3T51B 4EQNA 2NZHA 2YSHA 1EIYB 3ODKA 1T5EA 1N33Q 4KHVA 1JJGA 4CKCA 3MCBA 1GUTA 3ICEA 1W6JA 3J81i 1Z47A 1QZHA 4IPCA 4OXPA 1JOQA 3A7LA 1LTBD 1SMYD 4DXFA 4JI2Q 2F0EA 4NDXA 1NBWA 3RLFA 4XTCS 1RTOA 3BS1A 1N34L 1B2TA 5KYIA 5ELBA 3TS2A 5GAEC 5H1SE 3RR5A 2KQ3A 2FJ2A 2F0UA 3CHBD 1B9MA 3H09A 3M4YA 4DV4Q 4A3CG 3EROA 3HP3A 1VQEA 1A3VA 2ASBA 5GQOA 1MGSA 3DEOA 5ELFA 1GUGA 3QG1A 4G7ZC 3ULJA 1PH3A 2EYMA 3BZKA 1BUVT 3D4WA 1EY0A 1VF5C 4IZ8A 1PRTC 1HNXL 1K8AC 2JE6I 4NXNQ 3Q6SA 2F3VA 1WI5A 1Q3LA 3S2HH 4DKAC 1STGA 4R4CA 1WTXA 4A3KG 3CCEA 3ZYYX 5M5XB 3WH0A 1MSGA 4PZ7A 4DR6L 1CUKA 3VA5A 2ZTCA 1Y8OB 3ULPA 2NZOA 5M5WH 3ERSX 4PMCA 2EY6A 3CPWA 4JI6L 1QB5D 3OWFA 5U47A 3MCBB 2B63H 4A3JB 3SK6A 1X3PA 1BBWA 1IBLL 4DV0Q 1EWCA 1M1KC 2R7DA 3KBGA 4DV7L 1EYDA 1L0WA 1GHJA 2E2DC 2EY5A 2I0QA 2VQEQ 1XNRL 4IO9A 4A3GG 1C7YA 4FYDA 2ZM6L 4G7OC 2ZQSA 4Q5VA 1SNPA 3M9BA 5ELCA 1PFNA 4RMFA 3V96A 3ND9A 5KNCA 3K7AB 4HN7A 3CKIB 2E74C 1HA5A 4GOPB 1Z9FA 4UP7A 4LAAA 2A5HA 1U4PA 4A3DB 3C1EA 2D2CC 3GTPH <