3M7NA

Archaeoglobus fulgidus exosome with rna bound to the active site
Total Genus 42
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
42
sequence length
179
structure length
179
Chain Sequence
MRFVMPGDRIGSAEEYVKGEGVYEEGGELFAAVAGKLIIKDRVAKVESISPIPEIVKGDVVLGRVVDLRNSIALIEVSSKKGENRGPSNRGIGILHVSNVDEGYVKEISEAVGYLDILKARVIGDNLRLSTKEEEMGVLRALCSNCKTEMVREGDILKCPECGRVEKRKISTDYGKGEW
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Putative uncharacterized protein AF_0206
publication title Quantitative analysis of processive RNA degradation by the archaeal RNA exosome
pubmed doi rcsb
source organism Archaeoglobus fulgidus
molecule tags Hydrolase/rna
total genus 42
structure length 179
sequence length 179
chains with identical sequence B, C
ec nomenclature
pdb deposition date 2010-03-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF10447 EXOSC1 Exosome component EXOSC1/CSL4
A PF14382 ECR1_N Exosome complex exonuclease RRP4 N-terminal region
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.20.70.10 Mainly Beta Single Sheet Ubiquitin Ligase Nedd4; Chain: W; Ubiquitin Ligase Nedd4; Chain: W; 3m7nA03
2.40.50.100 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 3m7nA01
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 3m7nA02
2PPBC 2N78A 2JA7H 3F8TA 1UE6A 1GD7A 3OOBA 2NVQH 1RIPA 2UUCQ 4GS3A 3KF8B 3CP0A 1W3SA 4DR5L 1HR0Q 1VQ9A 1T9HA 2B63H 4A3FG 3VA7A 1JB7A 3I4MH 4HIOA 3L0OA 4QQBX 1IBML 4A4IA 4BBRG 1H9SB 3BG3A 1A8VA 3FP9A 1I5FA 4YWLA 1N32L 2UXDL 3U9SA 4DV0Q 1QJOA 2ZTCA 4DNRB 4H13C 4JOIA 2Y0SG 2EZ5W 1VCIA 3CCRA 2JA5G 4KHPQ 3RZDH 2JXMB 4UP7A 5C0XJ 3PUXA 1D8LA 3J7ZC 4LUOA 2F3IA 1GUTA 2NVTH 1OXTA 4GOPA 1E7ZA 4YHHQ 3OW2A 1K83H 1PMRA 5IT9c 3JC66 2PMZE 3KAIA 4A3JG 4DV1L 4HJ5A 3L4HA 1S40A 4GLAC 1VQ8A 1TU2B 2H5XA 1VDZA 4DAMA 2D2CC 1LTLA 2K75A 1QUQB 4B3ML 1KHIA 3GTGH 1NMGA 5GAEC 4UP8A 3PF4A 3LE4A 3I4LA 2WB1G 4DNTB 4UP9A 4DV5Q 4BA2I 1KIXA 3KJOA 2PI2A 3ICEA 1I6HH 3FMCA 2R92G 1MJEA 4DK3C 2K32A 4AYBG 1I94Q 3A5UA 2BH2A 3TS0A 4PZ6A 3HKZG 5JEAG 1EWIA 2YV5A 2EQSA 4LFCL 3G4SA 3NE5B 1IBKL 1A63A 4K0KQ 3OOCA 4A3MG 4BY7H 1MIUA 1E1OA 4X65L 4LUVA 1B9NA 1NY4A 2BE5C 1N34L 3PIPA 1HNXL 2NN6H 1BKBA 3NELA 1Q46A 1K73C 1UE7A 3M3YH 1Q81C 2CCZA 1FYCA 1VQCA 3G48A 4A3CH 3CPWA 5KNCA 2IY5B 2OQKA 4DR6Q 3RLOA 3EBEA 5IWAQ 1WOCA 2BDOA 4GOPB 1J5EQ 3S16H 1Y14B 4JYAQ 4O0AA 3IFTA 3NENA 2UXCL 4BBSH 4LF8L 5BN5A 1N33Q 1NMVA 4X6AH 1PH7A 2XP4A 1XMQL 4B3SL 1XNQQ 1YJNA 4QIWE 1YNJC 1B70B 4JI4Q 3AEVA 3MXUA 1EOVA 3UE1A 3Q8DA 3PIOA 1VF5C 1ZYRC 4JG2A 2KA7A 1EG3A 1HZ9A 2D0OA 1LYLA 1GUGA 1KRSA 5LMNL 1K8GA 3GTJH 2IX1A 2QF7A 3PO3G 2ZAJA 4QY7A 2DNCA 3PV0A 4JI7L 3I2ZA 4GN4B 1YIJA 3PO2G 5GQOA 3IRBA 1XPRA 5FJ8G 4P72A 2KCCA 1NE3A 3ULJA 1UE5A 1DXMA 3KAHA 4LF5L 1UWVA 1XMOL 1GUNA 5AJ3L 4G7OC 1VQFA 4IPDA 5KNBA 5C0XH 2UXDQ 5C44H 1RL2A 2BE5D 1Z6HA 3WDNA 1OTCA 1GHJA 2AHOB 1IZ6A 4B3TL 3I4OA 2RF4A 2JQOA 2WAQG 2A69D 1IBLQ 3NTPA 4IOCA 2PQAA 3HOZH 4LFAL 1PV4A 1O7LA 1BVSA 4GKKL 1PA6A 3KF6A 2F52A 2KBNA 3ULPA 4LF9L 4A3DG 4DV1Q 2E76C 3M4QA 1YBYA 2WB1E 1I6VC 2R6GA 1S3OA 3FHWA 2MO1A 4B3MQ 2JV4A 3PGZA 2VUMH 2DK1A 3L7ZC 5IYBH 3A7LA 2JA8H 3TEHB 2ZJPA 4QGUA 3HOUH 1VQDA 3M9BA 2JA9A 4LW1A 3T53B 2FXQA 3ZJYC 3U4VA 1YITA 4HJ8A 2XTIA 2B8GA 2N8NA 3KOJA 2JJQA 1WCMG 4X66Q 1DCZA 1FVIA 4LFCQ 4JBWA 3KAFA 5JJLA 2VY3A 5GROA 4DV2L 1G51A 4GNXA 3W1GA 1HQMC 4JI0L 4DV4Q 1Y1WH 4KHZA 1CKNA 4OWTB 2NVXH 1HNWL 3CD6A 3AYHB 1SR3A 2F4VQ 1NBWA 2GVBA 1B8AA 5GAGC 1N34Q 2EJMA 4HIKA 1QVCA 1Q1BA 2OQ0A 4A76A 4R4CA 5IP9G 4DK0A 1L1OC 2YTVA 1P16A 2JK8A 3HOYH 4A3LH 5H1SE 4UY8C 3CQZH 4JI3Q 2PQAB 4Y52H 3HOXG 4A3CG 4DV3Q 2UUBL 1TWFH 4LWCA 4RCNA 2ASBA 3KF6B 4QJFA 4IJLA 4C3HH 1Q90A 1X3GA 2IT1A 3CRKC 2VL6A 1FJGQ 4HIMA 4HR7B 2R93G 1X9NA 1B7YB 4POFA 1EIFA 1XMQQ 4YCWA 3KABA 4A3EH 1A0IA 2ZQVA 3A8IE 1SLJA 1VQGA 4DPGA 3CCSA 1HNZQ 2R7ZH 1KL9A 2AWOA 2E5LQ 5IY0A 2I5LX 1KD1C 5IYDH 2PNHA 4PMWA 1VQ6A 4JK1C 5LMNQ 3S17H 5M5XH 2VW9A 2A1AA 3HOVG 3T51B 4JI7Q 1VQMA 3TZUA 3CCMA 1VQ5A 5M3FG 2IHEA 2WP8J 1X6OA 4ALPA 1K9RA 2K50A 4GNXB 2KXQA 4A3GH 4LF5Q 4DV7L 2K5HA 4JI1L 2B29A 1WI5A 1YJWA 1CKNB 5IP7G 3GTLH 3E9HA 4DR3Q 3FKIG 2JX8A 4JI2L 1PYBA 1IYVA 3HOWG 4A93H 3I4NH 1VQOA 5C0XG 4JI8L 3W3AA 1TK7A 1Y8NB 4EQ5A 3D0FA 4B3TQ 1O7IA 3UDGA 2DUDA 1W2BA 2B3GA 2CWAA 4DR4L 4LFAQ 4OGQC 3S15H 1E2WA 1VQHA 1PH4A 1XNRQ 1K3RA 4GKKQ 4LFBL 1E2VA 2ZT9C 3DXJC 1QVFA 1KAWA 2ZM6L 4LF9Q 4GKJL 1TWGH 3T56B 1N9WA 3H0GH 1J6QA 3KFUA 2RCNA 2XPAA 2HIVA 4BA1I 1JMCA 4JI5L 1N36L 1VF7A 1X55A 1SMXA 1C7YA 2E2JH 5FLMH 2AWNA 1LACA 4A3IG 5C4XG 4DR7L 4MNOA 1GUOA 1OXXK 1BDOA 3PUWA 2KHIA 3CNGA 1H9KA 1QZGA 5IYBG 4DK1A 4BXXH 2HHHQ 2JA6H 2LXJA 3HOUG 1D7QA 2EXDA 5JJKA 4GN5A 3T1HQ 4ME3A 3VR3A 3T1YL 1Y1VG 3A8JE 1Q1EA 3W5OA 4DR2L 1XPOA 1K8OA 4KN7C 3U50C 3M7NA 3PCOB 3KLRA 1CUKA 4C3IH 4JI0Q 2A6HC 3RZOH 1HNWQ 3K0XA 5C3EG 2I5HA 4Y7NH 1YVCA 3EN2A 3S2HH 4R4TA 1Y1WG 4JOIC 1TWHH 2OWOA 4OX9Q 2RHQB 5IYCG 1MKHA 3CC4A 5A35A 3B6YA 3W1BA 2Q8IB 4LF7L 4X64L 2UXBQ 1K9MC 2UU9Q 5BR8L 2HIXA 1Q8KA 2ZQUA 4KKTA 4DUZQ 2E2HH 3CCQA 2UUBQ 3I72A 2OTJA 4H44C 1JT8A 5JEAJ 4KMUC 4B3RL 3K81C 1SRUA 4BY1H 4NXNL 4E5RA 4OO1I 4AH6A 1M1KC 3CXCA 2QA4A 5LMUL 5K36G 2DJYA 1XTDA 2XP3A 3KADA 2E2IH 4TKOB 1PH6A 1LABA 4HJAA 4U85A 2HT1A 1DD2A 2IHFA 5FLXc 4U84A 4DR1L 2XP8A 4JV5L 1K8AC 1YJ9A 2ZTDA 4IPHA 4P75A 3PUYA 2ZR6A 1K9QA 2XGTA 4HIDA 2UUAL 2R7ZG 4C3JH 4YWMA 4YY3L 3CC2A 1OXUA 1U5KA 2BA1A 3KLWA 1H9JA 4DK6C 5M3MG 1I50H 4DKAC 3LGJA 3GTQH 3VR2A 2XP5A 1AH9A 2MNAA 1EFWA 1BBUA 3DLLA 4DV7Q 2A6HD 5ELOA 2NZOA 1KQSA 1HR0W 2VQEL 1S72A 5AHTA 2Q5AA 2JA7G 1SFOH 3DM3A 4IPGA 1JJ2A 4JI2Q 4DR5Q 1FGUA 1PVOA 1IYUA 2Y0SE 2AUKA 1WFQA 3SGIA 1IBMQ 3PF5A 4QIBA 3K7UC 1ONLA 2B63G 1N32Q 1SE8A 3FPPA 3I4MG 1V9PA 2GVAA 2YSHA 2JXWA 1FR3A 2JEAI 3AQQA 2CWPA 4DUYL 3SDZA 1X65A 1XJVA 4LFBQ 1PFSA 1X56A 2UUCL 1A62A 4JBMA 2ZM6Q 4TQUS 1Z7TA 1PYSB 4BBRH 4GKJQ 1HR0L 2MO0A 2AKWB 1YNXA 3N6RA 1O6WA 4IFDI 3VR6A 4JI5Q 1TXYA 3H0GG 3F2BA 3S1MH 3BU2A 1NTGA 1SMYC 2YU9H 1GJXA 1I5HW 2K4KA 1IW7C 2YYZA 4KHPL 1VS0A 5EAYA 3AB9A 1IXRA 1Z9FA 2V4DA 1FL0A 1L0WA 3S1RH 4YHHL 3EIVA 4AYBE 4JC0A 3VR5A 2A19A 3T1YQ 4L5RC 3HKZE 1WJJA 2JE6I 1PHJA 1VQ4A 2BH8A 2E8GA 1EQQA 4OONA 1A6XA 2K52A 4GLVB 2Z6KC 1CFMA 1IBKQ 2BA0A 1E24A 3CPFA 3EQLC 1YHBA 2JMFA 1L2FA 2R92H 4L8JA 4KKSA 3F2DA 1YZ6A 2R7FA 4X65Q 3GD7A 1VQNA 4APVA 1VQLA 1Q86C 2VNUD 3MEFA 1YHAA 4NPSA 1H9RA 2ES2A 2K5NA 5JEAH 4BY7G 3HFZB 1HNXQ 2OTLA 1I94L 5BR8Q 3CCUA 2NN6G 1Y69U 4RMFA 3RLFA 4A3MH 4B3RQ 3RNUA 4REXA 3CMAA 2ID0A 3AFPA 4K0KL 3CCEA 1QVGA 1GVPA 1F8AB 2ALYB 3HKSA 5HGQA 5LMUQ 3TC5A 1HH2P 3J7A5 1EUJA 5DLQE 1VQBA 3MXNB 3RN5A 2UXCQ 4IPCA 1ASZA 1H95A 4DNIA 1YNNC 2VQFL 4LF8Q 4IFDJ 2ZJRA 4DR1Q 1IW7D 4BBSG 4TVAB 3U58A 1BBWA 4LUZA 4R4QA 3I56A 1R9TH 4B3SQ 4DR6L 3UDFA 3CCVA 4DV6L 2UUAQ 3BDOA 3M4YA 3VR4A 4YY3Q 3BZCA 4NXML 3TQYA 1Y8OB 1H9MA 4J15A 4L5SA 1N8RC 1JJCB 2LAJA 1NJIC 3STBC 1EYGA 4GNXC 3KDFA 1PH9A 3CW2C 1N33L 3UE0A 1PH3A 3GQBA 1GKHA 4UPAA 1XNQL 4G7HC 4HJ7A 5E7NA 4YWKA 1PINA 3OPOA 2VQEQ 4JI4L 1JJGA 2A8VA 4O2DA 4LK1C 4AQYL 2CFMA 4A3BH 3QG1A 1XMOQ 3U4ZA 5AJ3Q 1PH5A 2F1MA 5CQ2A 1CKMA 4DAYB 3KAGA 3CF5A 2WAQE 2K33A 1V8QA 2KENA 4H02A 3WWVA 3PO2H 5JJIA 4DUYQ 3TCZA 2IX0A 5C44G 5FJ8H 3CCLA 4XTCS 2EVBA 3H3VI 2V1CC 1B9MA 2VS1A 3GTPH 4MTNA 3JAMc 3I73A 4OO1H 1Q12A 5IE8A 4U86A 3OTOL 1VQPA 2NZHA 4I7ZC 3HOZG 2B8FA 4IJHA 3QJYA 1YI2A 4A75A 3CC7A 2DMVA 2M8JA 3GO5A 2KCMA 3AFQA 3K8AA 1KC8C 3ODKA 2ZQSA 2MQHA 2PCFB 3G71A 1IBLL 1T5EA 1V43A 1TWCH 1TWAH 2GN5A 4A3DH 3E9IA 1YW5A 4RG1A 2VUMG 1HZCA 3JAMi 1E1TA 3J80c 5GADC 2N49A 2JA8G 2CQOA 3J81c 2WFWA 2YSGA 4EX5A 3STBD 1X3FA 3KDFB 1HCZA 4LF4L 3KCEA 2KCTA 3VDYA 2DNEA 1WYDA 2YSIA 2AUJD 4DV2Q 5BN3A 5ELNA 1CSQA 2Q2UA 3MFYA 1G291 3KYHC 4OWXB 4GZYC 3E0EA 1WCMH 3A7AB 1GO3E 2AMCB 3J80i 2YTYA 5C4JH 3GTKH 1Q82C 3J81i 1HZBA 4X66L 2DN8A 3PUVA 1MJCA 2D5DA 3KJPA 3BJUA 4OXPA 1AE2A 2A68C 4A3KH 4GOPC 3I7FA 3A8KE 2YTXA 3CCJA 2EDGA 4R1JA 1VQKA 1HTPA 4DV4L 4IFDH 3HOYG 1Q7YC 2O5JC 4A3LG 4H0LC 3SE0A 3K80C 2F4VL 1ASYA 5IP9H 1G6PA 2XP9A 1I3QH 1E3PA 2CKZB 2VQFQ 1GHKA 2Z0SA 1XPUA 3ULLA 2XP6A 2K5VA 3HOXH 2YSFA 2A69C 2R7DA 3TS2A 1OXVA 2C35B 4P73A 4JI3L 4DV6Q 4WJ4A 4DV3L 4NXMQ 3UDXA 2LXKA 5LMNW 4KI0A 4A3EG 3ND8A 1E2ZA 4LF6L 3TDBA 2ZR4A 1X54A 4G7ZC 4NB3A 3S2DH 4JBKA 2R93H 3LNNA 1DGSA 5IYDG 1FJGL 3H15A 3M85A 4KKUA 1VQIA 3IKJA 3RLNA 2XPBA 1EG4A 1HZAA 1C0AA 1CSPA 3BZKA 4X62L 1HNZL 1ZCNA 2O5IC 4AQYQ 2ZQTA 3QIAA 1YEZA 2E5LL 1KXLA 4JI1Q 2L15A 5KNDA 3HOVH 3OYYA 1GUSA 2Q2TA 4GLXA 1OXSC 4A3GG 3UDIA 3CRLC 3GTOH 4PZ7A 4A3BG 1K8MA 1SROA 5M3FH 1EWHA 2EIFA 4JI8Q 4JI6L 1Y8PB 2F21A 2M8IA 2ZTEA 2PI2E 4A93G 3I4NG 2A68D 5IP7H 1IYJB 4P74A 3A0JA 4PZ8A 3L2PA 4DR4Q 2LMCB 1PH2A 3FKIH 3S14H 3F2CA 1CKOA 3A74A 3OTOQ 1EIYB 4LJZC 4OO1G 3WH0A 4OWWB 4L5TA 3HOWH 3LWUA 4DR3L 4A3FH 5J3BA 2Z6KA 2VZAA 4LNQA 4XIGS 1WR7A 4IOAA 3ER0A 1EQRA 1VQAA 3CAMA 1N36Q 4KN4C 3ND9A 2QGQA 4DV0L 2JA5H 4FDBA 5HY6A 2HQLA 4DR7Q 2NN6I 1ZKOA 2RHSB 4YCVA 1XNRL 3ERSX 5FLMG 2YSBA 1VQEA 1K0RA 3TRZA 3NEMA 2DGYA 3F1ZA 4KLKA 4QL5A 3OW7A 1L1OA 4POGA 2OCEA 1Z47A 3S1NH 1LUZA 4BXXG 2ATWA 2JA6G 4A3JH 4R4IA 4A3IH 3M4PA 5C4XH 2MDIA 3HGBA 4LF4Q 1TKWB 5GAHC 2I0QA 1HJPA 5BN4A 1JE5A 4DR2Q 3NBHB 3S24A 2ZR5A 2D62A 2M3OW 2E74C 2HHHL 4PG3A 2ITKA 2RE3A 4AIMA 2DWVA 2A6EC 1Y1VH 2K7VA 4PV1C 1UEBA 2LSSA 4WJ3M 4L5QA 3I55A 1CTMA 2CW0C 3T1HL 2DK7A 4DV5L 2ZJQA 3H3VH 2EJGC 3A5ZB 3PSIA 1O78A 1M90C 1P8LA 4LF7Q 4X64Q 4YCUA 5C3EH 3J81j 4IO9A 4A3KG 1LM0A 3GDEA 1PH8A 2XP7A 3RN2A 3H94A 3M4OH 5IYCH 3GTMH 4IQZA 2MFIA 4P71A 4IFDG 1JMQA 1UE1A 1KRTA 4OX9L 4NXNQ 1C9OA 1YHQA 2EJFC 3D4RA 3TREA 4BY1G 2E45A 1H9SA 2E75C 4JCVE 1GM5A 2UXBL 4HJ9A 2Q2IA 2K14A 2UU9L 1NMFA 5C0XI 1SN8A 4GN3B 2D0PA 5M5WH 4DUZL 3G6EA 4JV5Q 4R4OA 2JEBI 1HPCA 2QEXA 1V1QA 4LF6Q 1L1OB 5IWAL 5K36H 5M5YH 3RR5A 1J5EL 1WMVA 1U0LA 4JYAL 2I5MX 1IL2A 3K7AH 4MZ9A 4C2MH 1VQJA 1PH1A 2N3SA 2KHJA 2L4JA 4X62Q 1E22A 1QUQA 3CMEA 3S1QH 2NVYH 2A6ED 1CI3M 5M3MH 3P20A 3PUZA 4JI6Q 3PO3H 1VQ7A 2Q2HA 2PNRC 1X3EA 2L5TA 4JBJA 3D31A 1QZHA 1AE3A
chains in the Genus database with same CATH superfamily
2PPBC 3TBIB 4IUQA 2N78A 5C6AA 1JWUD 3T16A 1S5CD 1WTXA 2JA7H 3F8TA 1UE6A 1EU3A 3IFDA 1GD7A 4R8IA 2R3ZA 3OOBA 2NVQH 1RIPA 2UUCQ 1QOHA 2F0FA 4BS9A 3OMCA 4GS3A 2HCIA 5DAUA 3KF8B 4A0UA 3CP0A 1W3SA 5FKAC 3SK6A 4DR5L 1HR0Q 2F0TA 1VQ9A 1T9HA 2B63H 4A3FG 3VA7A 1JB7A 3I4MH 3GTGB 4HIOA 2EYMA 3L0OA 4FXDA 4QQBX 4U673 1IBML 1NR4A 4A4IA 4BBRG 1H9SB 1A8VA 3BG3A 3FP9A 1I5FA 2NWGA 4YWLA 3J7YW 1N32L 4C1NK 2UXDL 4NW2A 3EVQA 5E66A 3U9SA 3U9OA 4DV0Q 1QJOA 4BWGB 2K05A 1WTWA 1JC7A 2ZTCA 1ZXTA 4DNRB 4H13C 4JOIA 2Y0SG 1I6HB 1YNND 2EZ5W 1VCIA 4M8AA 2PMZB 3CCRA 2JA5G 2FINB 2B2YA 4KHPQ 3RZDH 2JXMB 2WKDA 5EPKA 1DM0B 4UP7A 5C0XJ 3PUXA 5EPLA 2IPKD 5ELFA 2CH4A 4P2CB 4XT1B 1D8LA 3J7ZC 4LUOA 2F3IA 1GUTA 5TSSA 1SYCA 1OXTA 4DN4M 4GOPA 2NVTH 3GV6A 3PQIA 2IW3A 4FVMA 2Q8TA 1E7ZA 4YHHQ 3OW2A 4CDCC 4RH6A 5HURA 1K83H 2CH4W 3KBXA 1PMRA 5IT9c 3JC66 2WAEA 1S5BD 5ELEA 2KQ3A 2PMZE 1PRTF 4L63B 1EYDA 2CVRA 3KAIA 4A3JG 4DV1L 4NKLA 4HJ5A 3L4HA 1S40A 4GLAC 1VQ8A 1TU2B 4BY7B 2H5XA 2NTTA 1AEXA 1VDZA 1C48A 4DAMA 2D2CC 1LTLA 2K75A 3MAQA 2Z6BA 4DFAA 1QUQB 4B3ML 2SNMA 1KHIA 1STYA 1QB5D 1STNA 5EJWA 3GTGH 3MTSA 1NMGA 5GAEC 3FSCA 4UP8A 3PF4A 3M3YB 3LE4A 3I4LA 2FMMA 2WB1G 4DNTB 4UP9A 4DV5Q 1EOTA 4BA2I 1D5XC 1KIXA 2KOLA 4HSPA 2PI2A 3KJOA 1PZID 1KLGD 3TP5A 3ICEA 1I6HH 4HAEA 3TMEA 3FMCA 4B08A 2R92G 1MJEA 4DK3C 5EBCA 2K32A 4DGZA 2L9HA 1WVLA 4IUPA 1PRTB 1BNZA 5IGGA 4AYBG 3S16B 5CV6A 2MPMA 1I94Q 3A5UA 2BH2A 3TS0A 4PZ6A 4CJ1B 2RDFA 3I90A 3HKZG 1VMPA 5JEAG 1EWIA 4PNYA 2YV5A 3VYUA 1MI2A 2EQSA 3E3XA 4BBSB 2B2VA 4LFCL 3G4SA 4WJWA 3NE5B 3VYSA 1IBKL 3X3NA 1A63A 4U68A 4K0KQ 3OOCA 4A3MG 2ZXRA 3BVMA 4BY7H 1MIUA 2XIWA 1E1OA 1NNXA 4X65L 4LUVA 1CK1A 3FS8A 2G9DA 3BDLA 1B9NA 2Z4IA 1NY4A 2BE5C 2F4IA 1N34L 3PIPA 1HNXL 2NN6H 1BKBA 1L0YB 1V1OA 1RJTA 3NELA 2HCCA 1HFGA 2VB3X 1Q46A 2F0JA 1K73C 1ILQA 1QWYA 1UE7A 3M3YH 1WTVA 1GXDC 3UI2A 1Q81C 2CCZA 3GTJB 4XT3B 1FYCA 1VQCA 3G48A 4A3CH 5LL6S 3BYTB 3CPWA 5KNCA 2IY5B 2OQKA 4ZCKA 4DR6Q 3RLOA 2WV6D 3EBEA 5IWAQ 1WOCA 2BDOA 2OXPA 4GOPB 1J5EQ 3TP8A 3ERQA 1MD2D 4RHSA 3S16H 1Y14B 4JYAQ 1LLRD 1XXGA 1TS3A 5AFWA 2DY8A 3T13A 4RFBA 4O0AA 3IFTA 3NENA 2UXCL 4BBSH 5EKKA 2B2TA 4LF8L 4WORA 5BN5A 3R2IA 1N33Q 1NMVA 4X6AH 1T5XD 2F0SA 1PH7A 5C44B 5DM73 2XP4A 2NBFA 1SBBB 3K58A 1TR8A 1MBYA 1XMQL 4B3SL 1XNQQ 1YJNA 5JPMC 4QIWE 3NBHA 2F0EA 4PMBA 1YNJC 1B70B 2SNSA 4JI4Q 3AEVA 3TP6A 3DHQA 3MXUA 1EOVA 3UE1A 3JAML 3Q8DA 3PIOA 1WTQA 1VF5C 1ZYRC 4JG2A 2KA7A 3VYTA 1EG3A 4PMCA 1HZ9A 2D0OA 3HOZB 1LYLA 1GUGA 1KRSA 5LMNL 3V96A 2EZVA 1K8GA 3GTJH 2IX1A 2QF7A 3GV3A 5E64A 1U4MA 3PO3G 2ZAJA 4QY7A 2B2UC 2DNCA 3DEOA 1A2TA 3CHBD 3PV0A 1SE2A 4JI7L 2HQEA 3I2ZA 4GN4B 4TSSA 1YIJA 3PO2G 3TN2A 3C1EA 5GQOA 3IRBA 1XPRA 5FJ8G 1AFPA 4P72A 2KCCA 1JOKA 1NE3A 3ULJA 1EY5A 1O7YA 1UE5A 1DXMA 3KAHA 4LF5L 1UWVA 2PZTA 2VUMB 2F0MA 3VYRA 1XMOL 1GUNA 5AJ3L 1LTTD 2JA8B 4G7OC 3HOUB 1VQFA 3MCBA 4IPDA 2OF1A 5E4XA 2EYHA 4ZAIA 5KNBA 5C0XH 3J80L 2UXDQ 5C44H 1RL2A 2BE5D 1Z6HA 2LY7A 3WDNA 1OTCA 1GHJA 2AHOB 5IIFA 3J81L 5JAVA 1IZ6A 4JW0A 4B3TL 1LT3D 3I4OA 5LHY1 5EKIA 2RF4A 4RGNA 2JQOA 3MZ5A 2WAQG 3HRZC 4ODGA 2A69D 1IBLQ 3NTPA 2A5HA 4IOCA 2PQAA 3C2PA 3P7JA 3HOZH 4LFAL 1PV4A 1O7LA 1BVSA 4GKKL 5C3WA 1PA6A 3KF6A 2F52A 4FP5D 4HEDA 4KY5A 1QG7A 2KBNA 3ULPA 4LF9L 5DNFA 1SDFA 4A3DG 4DV1Q 1PTOF 3AMUA 2E76C 4EQOA 3IAYA 2QDLA 1TVXA 1YBYA 3M4QA 1Y1WB 1Q8IA 2NVXB 3KUPA 5ELDA 3WOEA 2NZ1D 2WB1E 1I6VC 4HTHA 2F0KA 3W2DA 3KLSX 2R6GA 4DA2A 1S3OA 3FHWA 2MO1A 4B3MQ 1EY4A 2JV4A 3PGZA 3FVQA 2IX3A 4KHVA 4OHJA 2VUMH 4UAIA 2DK1A 3L7ZC 5IYBH 1BQQT 2F3WA 3A7LA 2EXZA 1RP5A 2JA8H 3TEHB 2ZJPA 4QGUA 3HOUH 1VQDA 3M9BA 2ENBA 5CV8A 2JA9A 3HOYB 4O1NA 4LW1A 3T53B 3E5SA 3O13A 3CQZB 1ZYRD 2FXQA 3ZJYC 2WINB 3U4VA 2WKCA 2CHBD 4HJ8A 5KYLA 1YITA 1CT1D 4CJ0B 1IL8A 2XTIA 1ESFA 4IZ8A 2B8GA 5IT9E 2N8NA 2JP1A 3KOJA 3J80E 1TWFB 2JJQA 1Q3LA 1EEFD 2EYLA 1KDCA 1WCMG 2MHVA 3BDCA 4X66Q 1DCZA 2L11A 3J81E 5D3IB 4C3HB 4KK7A 1W6JA 3J7AF 3SVMA 1FVIA 4LFCQ 4JBWA 1SNPA 2KEEA 3KAFA 5JJLA 1RTNA 1R4QB 2VY3A 4IN3A 1ENCA 5GROA 5COYA 3P75A 2AQ3B 4DV2L 1G51A 4GNXA 2RQXA 3W1GA 1HQMC 4JI0L 4DV4Q 3KLSA 2QILA 1Y1WH 4KHZA 1CKNA 3MC0B 4OWTB 2NVXH 1HNWL 3Q6SA 1XYIA 4E6IA 3CD6A 4A3EB 1G2SA 3AYHB 4FF4A 2FMCA 1SR3A 1CZGA 3T4AC 2F4VQ 1NBWA 2GVBA 1EIHA 1B8AA 4FF1A 5GAGC 3MCBB 1N34Q 2EJMA 2RVLA 4HIKA 1SEBD 1SSOA 4ID6A 1QVCA 2R7ZB 1SXTA 1Q1BA 2OQ0A 4A76A 4R4CA 5IP9G 5T1IA 1KNAA 4RKBA 4DK0A 1PZJD 1FNUA 1L1OC 1WTPA 3S17B 5M5XB 3TP7A 2YTVA 2XNAC 2I07B 1P16A 1SYGA 2JK8A 4MHEA 3HOYH 4A3LH 5H1SE 4UY8C 3CQZH 4ZK9B 3V2TA 4JPBW 4JI3Q 2PQAB 3HP3A 4Y52H 3HOXG 4A3CG 4DV3Q 2N88A 2UUBL 1G2TA 1TWFH 4LWCA 4R9WA 4RCNA 2ASBA 3KF6B 1BBXC 4QJFA 3H6MA 5KGUA 4IJLA 1RHPA 4C3HH 4A3GB 1Q90A 1X3GA 1PTOD 1PYWD 2IT1A 2F0QA 1EQTA 1STEA 1PFBA 1ET6A 3GTLB 2NVQB 3CRKC 2VL6A 1FJGQ 1IKMA 4HIMA 4HR7B 5C4ZA 2R93G 2KECA 1X9NA 1B7YB 4CHTB 4POFA 1EIFA 1XMQQ 4YCWA 3OIPA 4A93B 3KABA 3I4NB 3NWSA 4A3EH 3ZYYX 3TSSA 1A0IA 2ZQVA 5IGCA 3A8IE 1SLJA 1VQGA 4JVZA 5JJZA 4DPGA 1ICFB 3CCSA 1HNZQ 2R7ZH 1KL9A 2AWOA 2E5LQ 3I3CA 5IY0A 2I5LX 1KD1C 5IYDH 3OHXC 2PNHA 4PMWA 5IGBA 1VQ6A 3S15B 4JK1C 1TIID 2PW5A 5LMNQ 5FO8B 5M5XH 3S17H 2O4XA 2VW9A 5D65A 2K5QA 3DM1A 1F2LA 1BUVT 3A55A 2A1AA 3HOVG 1UEAB 4ZKCB 2F03A 1KDBA 3T51B 1RTOA 1TWGB 4JI7Q 3DWAA 1VQMA 3I8ZA 3TZUA 2RDHA 3CCMA 1TR5A 1VQ5A 5M3FG 2NB0A 3H0GB 3MHBA 2IHEA 2C9OA 2WP8J 1X6OA 4ALPA 1K9RA 2K50A 1TS2A 3SK8A 2LFNA 4GNXB 2KXQA 5JVH3 4A3GH 1QILA 4LF5Q 4DV7L 4NDXA 4TRDA 2E2JB 2K5HA 5DEHA 4JI1L 4FF3A 1XX8A 2B29A 1WI5A 1YJWA 1QE6A 1CKNB 5KIXA 5IP7G 3GTLH 1BCPC 3NTKA 3E9HA 4DR3Q 1B53A 2J4XA 1II3A 3FKIG 2JX8A 4N8X1 4JI2L 1PYBA 3K5NA 2JA6B 1IYVA 1ICWA 3HOWG 4A93H 1UAPA 3I4NH 1VQOA 5C0XG 4JI8L 3K57A 3W3AA 2D9UA 2H4OA 1TK7A 1Y8NB 4EQ5A 3D0FA 1RDPD 3N52A 4B3TQ 1C8CA 2CQAA 1O7IA 3HEJA 4OL7A 3UDGA 1IKLA 1ML0D 2DUDA 4ZRZA 4K8JA 3L3OC 2N55A 5E65A 1W2BA 2B3GA 3NUCA 3KK7A 2CWAA 2MJ8A 4DR4L 4LFAQ 1S5DD 4OGQC 1HUMA 1E2WA 3S15H 1VQHA 1PH4A 1XNRQ 1K3RA 4GKKQ 4LFBL 1A3VA 1E2VA 2QRVA 2ZT9C 3DXJC 1QVFA 1MSGA 3FPUB 3MEHA 1KAWA 2BDNA 1KDAA 2ZM6L 3R8BA 4LF9Q 5CC4A 2P5ZX 4C3IB 4GKJL 1TWGH 1FLCA 2K6AA 3SK5A 4WFN3 3T56B 1LTAD 3RZOB 1N9WA 4ME5A 1OO9B 3DWPA 3H0GH 1J6QA 3KFUA 2RCNA 1TS4A 1TT2A 2XPAA 1U4PA 2HIVA 4BA1I 4N9PA 4Y7NB 3S2HB 1JMCA 4JI5L 1N36L 1VF7A 1TWHB 1X55A 1SMXA 1GOZA 3NK9A 1C7YA 1F9QA 2E2JH 5FLMH 2AWNA 1LACA 4A3IG 2HUGA 3DWQA 1JE4A 5NUCA 4C56C 5C4XG 4DR7L 4MNOA 1GUOA 1OXXK 1NAPA 1BDOA 2KHIA 3PUWA 4DAPA 3CNGA 4K2KA 4H7BA 1H9KA 4K8IA 1QZGA 4Q0FA 3D6WA 1SNCA 5IYBG 4DK1A 4BXXH 2HHHQ 2JA6H 2I46A 2LXJA 5LL6X 3HOUG 1D7QA 3J7AV 1ENFA 2EXDA 5JJKA 3H09A 2E2HB 1STGA 2WADA 5ISRA 4GN5A 1A3UA 3T1HQ 4ME3A 2Z4HA 4FXGC 5CR3A 3VR3A 4BY1B 3T1YL 1Y1VG 3EROA 1PLFA 3L9AX 1PXUA 1ZEQX 2NYZD 3A8JE 1Q1EA 3K6OA 3W5OA 3K5LA 1QNKA 2F0NA 3SXHA 4KJNA 4DR2L 1XPOA 2Z8LA 4OEMB 1HXYD 2F0PA 3NSWA 1F9RA 1K8OA 4KN7C 5E1FA 3U50C 4QCLA 3M7NA 1AZPA 3PCOB 2FJ2A 3KLRA 4HMJA 1CUKA 2XWJB 2E2IB 4C3IH 4JI0Q 2A6HC 2LS01 1U4RA 3RD4A 3RZOH 1HNWQ 3R3OA 5U47A 3K0XA 5C3EG 2I5HA 2SOBA 4Y7NH 1YVCA 3EN2A 3S2HH 4R4TA 1TQOA 2RCFA 4JOIC 4X3KA 1Y1WG 1TWHH 2OWOA 3NBIA 4IUTA 4OX9Q 1M4VA 3S9WA 2XRSD 2RBMA 2RHQB 5IYCG 2IL8A 4PQXA 1L0XB 1MKHA 1SE3A 4C3JB 2K28A 4CDDC 5A2QE 5EPJA 3CC4A 5A35A 3I91A 3B6YA 3W1BA 2Q8IB 4LF7L 4X64L 4HCSA 2UXBQ 3Q22A 5FO7B 4HMIA 3E6ZX 1K9MC 2F0HA 2UU9Q 4EQPA 5BR8L 2HIXA 1Q8KA 2ZQUA 4KKTA 4DUZQ 2E2HH 3CCQA 2UUBQ 3I72A 3NXWA 2OTJA 5JPNC 2B2UA 4H44C 1JT8A 5JEAJ 4KMUC 4B3RL 1I50B 3K81C 3OSOA 3GTQB 1SRUA 4K5VA 4BY1H 4RWSC 4NXNL 2KUMA 5CMDA 4E5RA 3BVZA 2M9VA 4OO1I 4AH6A 1M1KC 3CXCA 2QA4A 5LMUL 4C3HG 1STAA 2DJYA 4S3SA 4V0BA 1F2MA 1XTDA 2SDFA 5K36G 3F2UA 2XP3A 3KADA 4QIWB 2E2IH 1SFOB 4TKOB 1PH6A 1LABA 5JOBA 4HJAA 5J22A 2JYOA 1V1PA 4U85A 2F0VA 5IGFA 2HT1A 4FO2A 1STHA 1DD2A 2IHFA 1A15A 4U84A 5FLXc 4DR1L 2XP8A 3PQHA 4JV5L 1KLUD 1K8AC 1YJ9A 2ZTDA 4IPHA 4P75A 3NP8A 3PUYA 2ZR6A 1K9QA 1EFID 4YIJA 4EVOA 2XGTA 4HIDA 2UUAL 2R7ZG 4C3JH 4YWMA 4YY3L 3CC2A 1DYQA 4MIUA 1MGSA 1EY8A 1OXUA 1U5KA 2F0GA 2BA1A 5I9OA 1I4GA 3KLWA 5I4DA 2BCOA 1H9JA 3MA2B 2L55A 4RA8A 4DK6C 4BBRB 4Z9CB 3MQGA 5M3MG 2L1BA 2B2WA 5CBEE 1D2BA 5HGTA 1X32A 1I50H 4DKAC 3LGJA 2F0WA 4UDUC 1B3AA 5EBDA 3GTQH 2PYKA 3VR2A 1LT6D 4RGMA 2XP5A 1AH9A 2MNAA 1EFWA 1BBUA 3DLLA 4DV7Q 3S1MB 2A6HD 1F9PA 5ELOA 2EPBA 1K28A 1BXTA 2YU9B 2NZOA 4ULLA 1KQSA 1HR0W 2VQEL 1F77A 1S72A 5EQ0A 2Q5AA 5AHTA 2JA7G 1SFOH 3DM3A 2L0CA 2TMPA 4IPGA 4F7XA 1JJ2A 4JI2Q 3ITPA 4DR5Q 4G57A 1NCVA 1FGUA 1PVOA 1IYUA 3VA5A 2Y0SE 2AUKA 1AZQA 2E2DC 1WFQA 3SGIA 3S1RB 1J8IA 1IBMQ 2K5WA 3PF5A 2ICEC 4QIBA 3K7UC 1I4PA 2IJ0A 3H3VC 1ONLA 5IT9L 3DUZA 2B63G 1N32Q 4ZUIA 1SE8A 3FPPA 3I4MG 1V9PA 2GA4B 2GVAA 3NHHA 2YSHA 2JXWA 2PZUA 1FR3A 2MGSA 2JEAI 3AQQA 2CWPA 2F0UA 4DUYL 2RA4A 1EU4A 3SDZA 1B3QA 1PDQA 1X65A 1F2ZA 1XJVA 5KRUA 2PO4A 4LFBQ 1PFSA 1X56A 2UUCL 1A62A 4JBMA 4CDEC 1LT5D 2ZM6Q 4TQUS 1Z7TA 1PYSB 4BBRH 4GKJQ 3DEPA 1HR0L 5CBAE 2MO0A 2AKWB 2WB1B 1YNXA 2EE1A 3N6RA 4RHRA 3BZDB 3OWFA 1O6WA 2XN9C 4IFDI 3PMFA 3VR6A 4JI5Q 3MXNA 1TXYA 3H0GG 2R92B 3F2BA 3K59A 3S1MH 2F0OA 3BU2A 4IUUA 2M2LA 1NTGA 5CV9A 1SMYC 4LMQD 2YU9H 3MXPA 4QB4A 1V1PB 1GJXA 1I5HW 2K4KA 1IW7C 1LTBD 2YYZA 1DONA 5KEEA 2EYPA 3HKZB 3EA6A 4KHPL 1VS0A 5EAYA 3AB9A 1IXRA 3MVVA 5I2XA 2VXWA 1Z9FA 1FL0A 2V4DA 1W6KA 1L0WA 3S1RH 4R8NA 4IUNA 2A73B 4YHHL 4RCOA 1FD7D 1BR9A 1YNJD 1LO5D 3EIVA 1EEID 4AYBE 4JC0A 3VR5A 4A3MB 2A19A 4J1MA 3T1YQ 2G5DA 4L5RC 3HKZE 1JQYD 4X3SA 1WJJA 4B9WA 2JE6I 1PHJA 1SJHD 1EZ8A 4MN3A 1VQ4A 2PW7A 5L37A 2BH8A 1PTOB 2E8GA 3QWNA 4OIKA 2XVSA 1EQQA 5CYUA 1CQVA 4OONA 1A6XA 2K52A 3D4WA 3G7LA 3BS1A 4GLVB 1HA6A 1CA5A 2Z6KC 4M1UB 2QCPX 1CFMA 5E3FA 1IBKQ 2BA0A 1E24A 3CPFA 4KV6A 3EQLC 1EL0A 1YHBA 2JMFA 1L2FA 2R92H 5IGDA 4L8JA 1M8AA 2PZWA 4KKSA 3F2DA 1PFNA 1R9TB 1YZ6A 1JWMD 1CHQD 2RDGA 2R7FA 4X65Q 4ZYSA 1SNOA 3GD7A 1VQNA 4APVA 1VQLA 4QMGA 1Q86C 4RKLA 3MEFA 1YHAA 4NPSA 1H9RA 4DAYA 2K5NA 2ES2A 2VNUD 5JEAH 1LTGD 1KABA 1O80A 4BY7G 3HFZB 1HNXQ 2OTLA 1HUNA 4FYDA 1I94L 5C5LA 1D1KA 5BR8Q 3CCUA 2MUYA 2NN6G 3LWEA 1Y69U 4RMFA 3RLFA 4A3MH 4B3RQ 2QEJC 3K0YA 3K5MA 3DMUA 1SNQA 3OWEB 3RNUA 4REXA 5ELBA 3R93A 3CMAA 2ID0A 3AFPA 5J39A 2VB2X 4K0KL 3CCEA 1DOKA 3RUZA 1QVGA 4KY6A 4Q5VA 4HN7A 1GVPA 3H91A 4XXEA 1B1ZA 3A54A 3E0JA 1F8AB 2J7ZA 2ALYB 3HKSA 5HGQA 5LMUQ 1HFNA 3TC5A 1PTOH 3HG9A 1HH2P 2ZXPA 3J7A5 5G3LF 3EJIA 1EUJA 1SNMA 5DLQE 1VQBA 3MXNB 3RN5A 2UXCQ 4IPCA 1JWSD 5IODA 4N8FA 1ASZA 1EWCA 4IUVA 1H95A 2HDMA 1B44D 4DNIA 4F88A 1YNNC 2VQFL 4LF8Q 4IFDJ 2ZJRA 4A3BB 2WACA 4DR1Q 1ESRA 1IW7D 2EYFA 1LTSD 4BBSG 4CKEA 4TVAB 3U58A 1BBWA 4LUZA 4R4QA 3I56A 3AU7A 1R9TH 4B3SQ 4DR6L 2MP1A 3PO2B 2F0DA 3UDFA 3CCVA 4CJ2C 4XYQA 4DV6L 2UUAQ 3BDOA 3M4YA 3VR4A 3FDTA 3BZCA 4YY3Q 3ONAB 4NXML 3URYA 1KNEA 3D6CA 3TQYA 1Y8OB 1H9MA 2X69A 4J15A 4L5SA 2JN4A 3BYYB 3GTPB 1G91A 1N8RC 1JJCB 3D4DA 1FNWA 2LAJA 1NJIC 3STBC 4I7AA 1EYGA 4GNXC 3KDFA 5I6YA 1PH9A 3CW2C 1N33L 1WD1A 1NR2A 1TS5A 3SHLA 3UE0A 1PH3A 1GKHA 3GQBA 4UPAA 1XNQL 2QKIC 4G7HC 1X3PA 4HJ7A 5E7NA 4YWKA 1PINA 3OPOA 5FLXE 2VQEQ 1G8ZD 4JI4L 4ZUJA 1JJGA 2A8VA 2O2LD 4O2DA 4LK1C 4AQYL 4FF2A 2CFMA 4A3BH 3QG1A 1XMOQ 3U4ZA 5AJ3Q 1PH5A 1SYEA 2K1BA 2F1MA 1TWCB 1BOSA 1BCPF 5CQ2A 1CKMA 5ELCA 1AW7A 4DAYB 1TWAB 3KAGA 4A3DB 1AN8A 3CF5A 2WAQE 5CORA 2K33A 1V8QA 2KENA 2AQ2B 4H02A 3WWVA 3PO2H 5JJIA 4DUYQ 3TCZA 2IX0A 5C44G 5FJ8H 3CCLA 4DXGA 4XTCS 1HTLD 2EVBA 3H3VI 2V1CC 5EGTA 1B9MA 4KTAA 2VS1A 3GTPH 4MTNA 3JAMc 3I73A 4OO1H 1EYCA 2WIIB 1F9SA 1Q12A 3C1FA 5IE8A 2F0LA 4U86A 4DF7A 2KVMA 1D5ZC 3OMGA 3OTOL 1VQPA 2NZHA 4QUFA 2EY2A 1WTOA 1J9OA 4I7ZC 1R4PB 3HOZG 4J6HA 2B8FA 5G3LD 4IJHA 3QJYA 1BCPB 1YI2A 1D5MC 4A75A 2EYOA 1D6EC 5E62A 3CC7A 4CKBA 2DMVA 1WCMB 2KCNA 2M8JA 1LTID 1LT4D 5A2QL 3GO5A 2KCMA 3AFQA 3K8AA 3SEBA 1KC8C 3ODKA 5C4JB 3GTKB 2ZQSA 2MQHA 1AP0A 2PCFB 3G71A 2R61A 3I70A 1IBLL 2OT2A 2DY7A 2B39A 1JORA 1T5EA 1V43A 4F8MA 1TWCH 3NTHA 2AQ1B 1TWAH 2XSCA 4KJOA 2GN5A 4FNFA 4A3DH 3LKXA 3MWYW 3E9IA 1YW5A 2HDLA 3CU7A 4RG1A 1HZCA 3IL8A 4A3KB 3JAMi 2VUMG 1E1TA 3J80c 5GADC 2N49A 2SEBD 5D3DA 1PRTC 4DU9A 1DZ1A 2JA8G 2CQOA 3J81c 5I2YA 4MTKA 2KJXA 2WFWA 2YSGA 1ET9A 4EX5A 3STBD 1XWEA 1ENAA 1X3FA 3KDFB 1HCZA 2FFKB 5T1GA 4LF4L 3NQIA 1VMCA 3P1HA 3KCEA 5F2DA 1I3QB 2X6LA 3OIQA 1JB3A 1EY6A 2KCTA 3VDYA 2DNEA 5IGEA 1WYDA 3BVGA 1NSNS 2YSIA 1G6ZA 2DJGC 2AUJD 4DV2Q 1JCKB 5ELNA 5BN3A 1CSQA 2Q2UA 5CV4A 3HOXB 4RGOS 3MFYA 4L6TB 1STBA 1G291 3KYHC 4OWXB 2EY5A 4LAAA 4GZYC 5JVG3 3E0EA 1U4LA 1WCMH 4B9XA 4K5WA 3A7AB 1BCPD 1GO3E 2AMCB 1CA6A 3J80i 5C3XA 2NTSA 2YTYA 5C4JH 3GTKH 2NUCA 1Q82C 1D1IA 3J81i 1HZBA 2B2YC 4X66L 2K03A 2DN8A 2F3VA 4K6DA 3PUVA 2BOSA 3M7GA 3S2DB 1A2UA 2K04A 1SYFA 1MJCA 2R93B 1EY9A 2D5DA 3KJPA 3K5OA 3BJUA 2HD3A 4IURA 1AE2A 2A68C 4OXPA 4GOPC 4A3KH 1SAPA 3I7FA 1K0SA 3A8KE 2YTXA 2EYJA 5K5PA 3CCJA 2EDGA 4R1JA 1CHPD 1VQKA 1HTPA 4DV4L 1HHVA 2OEOA 4IFDH 3HOYG 2J0TD 1Q7YC 4A3LG 2O5JC 4N9TA 4H0LC 3SE0A 3K80C 2F4VL 5I6WA 1ASYA 5E4WC 5IP9H 4NMZA 1G6PA 5E5WA 2XP9A 1I3QH 4ZKBB 1MHWC 4WRDA 1WTRA 3MFGA 1PFMA 1E3PA 2CKZB 2VQFQ 3QR8A 4XQNA 1GHKA 3HOVB 1O7ZA 2ICIA 2Z0SA 1XPUA 3ULLA 2XP6A 4UHVA 3GTOB 2K5VA 4OELB 2YSFA 3HOXH 2A69C 2R7DA 3TS2A 1JOOA 5M3FB 1OXVA 2C35B 1SJED 4KD3A 3C3LA 4P73A 4JI3L 4DV6Q 4WJ4A 1A3TA 3SR1A 4DV3L 4NXMQ 1QCBD 3UDXA 4QF4A 4K2LA 3LKXB 2LXKA 5LMNW 1BO0A 4KI0A 4A3EG 3ND8A 1E2ZA 1PRTD 5FOBB 4LF6L 3TDBA 2ZR4A 1X54A 4G7ZC 4NB3A 3S2DH 4JBKA 2RSNA 3FKIB 3S14B 2K01A 2R93H 1EIGA 4HSVA 3LNNA 1DGSA 4G4KA 5M9OA 5IYDG 3HOWB 4A3FB 1EQVA 2B2VC 3FEWX 1FJGL 4IALA 1SYDA 5CGKA 3H15A 1BF4A 4RAUC 3M85A 4KKUA 1VQIA 3IKJA 3RLNA 2KEDA 2XPBA 1EG4A 1HZAA 3CKIB 1UUPA 1C0AA 5C5MA 1CSPA 2Q8RE 5C4HA 3BZKA 4X62L 2Y0SB 3SK4A 1HNZL 1U9RA 1ZCNA 1JICA 4AQYQ 2O5IC 2ZQTA 1S4ZA 3QIAA 1YEZA 2E5LL 2JA5B 4JI1Q 1KXLA 2L15A 4XQQA 5KNDA 2Z1CA 5FO9B 1S5ED 3HOVH 3OYYA 1GUSA 2Q2TA 4GLXA 1OXSC 4A3GG 4CKCA 3UDIA 3CRLC 3Q23A 2L12A 3GTOH 1RCVD 4PZ7A 4ZLTF 4A3BG 4DXFA 1K8MA 1SROA 4DAVA 5M3FH 3C46A 1EWHA 2EIFA 4JI8Q 4JI6L 2XWBB 3QB3A 4ZQ3A 1Y8PB 1EY7A 4ILWA 2F21A 2M8IA 3A56A 3S1NB 2F0IA 2ZTEA 2PI2E 4A3JB 4A93G 3I4NG 4A3IB 1F2YA 2A68D 4QUCA 5C4XB 4K6LA 5IP7H 1IYJB 3V05A 4P74A 3A0JA 4PZ8A 3KBGA 3L2PA 4DR4Q 4J8QA 2LMCB 3G6JB 1SYBA 1PH2A 3FKIH 3S14H 3LX0A 3F2CA 1CKOA 3A74A 3OTOQ 4KY7A 3Q0AA 1EIYB 4LJZC 4OO1G 3WH0A 4OWWB 4RGTA 4L5TA 3HOWH 2M00A 3LWUA 3HS0C 4DR3L 4A3FH 2B2TC 4XYOA 1K3BC 5J3BA 3NWTA 2Z6KA 2VZAA 3X3MA 4LNQA 4XIGS 1JOQA 1WR7A 4IOAA 3ER0A 1EQRA 1Y1VB 1B2TA 5IOCA 1VQAA 3QOJA 1RODA 3CAMA 1N36Q 4KN4C 3HZXA 2QGQA 3ND9A 4EGVA 2IWHA 4DV0L 2JA5H 4FDBA 5HY6A 2HQLA 4DR7Q 2PQEA 4AYBB 2NN6I 4V190 1ZKOA 2RHSB 4YCVA 1XNRL 3ERSX 5FLMG 2YSBA 1VQEA 1K0RA 3TZDA 4CDFC 3TRZA 1B50A 2XRQD 3NEMA 2DGYA 2X6GA 3JAME 1UNSA 3F1ZA 2B2WC 4KLKA 4QL5A 3OW7A 3QOLA 1L1OA 5C3EB 1DOMA 4POGA 4C1NI 1PTOC 2OCEA 1Z47A 2FHTA 3S1NH 1LUZA 1EYAA 4BXXG 2ATWA 2JA6G 1X3QA 1I4HA 1DJRD 4CGYB 4A3JH 4R4IA 4A3IH 1HRJA 3M4PA 3EFXD 3PIP3 3M4OB 5C4XH 2MDIA 3GTMB 4HCEA 3HGBA 4LF4Q 3TDQA 5I9PA 3RMHA 1TKWB 5GAHC 2I0QA 1HJPA 1I4QA 1SE4A 3D3RA 2KHSA 1JE5A 5BN4A 1LTRD 4DR2Q 2H1EA 1SNDA 3NBHB 3S24A 2EY6A 2ZR5A 1LV9A 2D62A 2M3OW 2E74C 4OIJA 4A0TA 2HHHL 1RD9D 2RKSA 4PG3A 2ITKA 2RE3A 3FSBA 4AIMA 2DWVA 2A6EC 1Y1VH 2K7VA 1GUWA 4C3IG 4PV1C 5M5WB 1UEBA 2LSSA 5CV5A 4WJ3M 4L5QA 4XDXA 3I55A 1CTMA 2CW0C 3T1HL 1WD0A 4ABNA 1B4OA 2DK7A 4DV5L 4XQJA 2ZJQA 1RKNA 3H3VH 2EJGC 4EQNA 1S5FD 5M5YB 3A5ZB 3PSIA 1O78A 1M90C 3GP7A 1P8LA 4LF7Q 4X64Q 1C4QA 1TY0A 1HQRD 1I4RA 3MXGA 3WOFA 4YCUA 3K7AB 5C3EH 3J81j 1HA5A 4IO9A 4A3KG 1LM0A 4C2MB 3GDEA 3R2TA 1PH8A 2XP7A 2EY1A 5FLXL 3RN2A 2QW7A 3H94A 3M4OH 5IYCH 2EOTA 3GTMH 3NPPA 2TSSA 2ZXOA 1QNUA 2MFIA 4IQZA 3PIO3 4P71A 4IFDG 1JMQA 3KF8A 1UE1A 1KRTA 4NXNQ 4OX9L 1C9OA 2JSOA 4KD4A 1YHQA 1I4XA 5KYIA 2EJFC 3D4RA 3TREA 1FGBD 4BY1G 2E45A 3S1QB 3FRPB 1H9SA 2NVYB 1FNVA 2E75C 4JCVE 2YAJB 1GM5A 4K14A 2UXBL 5M3MB 4HJ9A 2Q2IA 2K14A 1E0BA 1EZ6A 1XTCD 5FK9C 2C5CA 2UU9L 1NMFA 5C0XI 1SN8A 3MQHA 4GN3B 1SMYD 5DM63 2D0PA 5M5WH 1ILPA 4DUZL 3PO3B 4X3TA 3G6EA 1RF2D 1PZKD 2RSOA 4JV5Q 5D14A 4R4OA 1WTHA 2JEBI 1HPCA 3Q24A 2G9HD 1TY2A 4X3UA 5CV7A 2QEXA 1V1QA 4LF6Q 1L1OB 5IWAL 5M5YH 5K36H 1CM9A 1CZWA 3RR5A 1J5EL 2JA7B 1WMVA 1DOLA 1EY0A 1U0LA 1NUCA 4FXKC 2A74C 4JYAL 1MSHA 2I5MX 1IL2A 3K7AH 4C3JG 4MZ9A 1CQFA 4C2MH 2B63B 1VQJA 3I4MB 1PH1A 2N3SA 2Z9HA 2KHJA 2Y8NB 2DJFC 5EKLA 2L4JA 2K5DA 4X62Q 1E22A 1QUQA 2QDBA 2LKVA 3CMEA 4O42A 1KAAA 1IHZA 3S1QH 2WAQB 2NVYH 2A6ED 4I65A 4CBVA 3D8GA 1CI3M 3RZDB 3NTIA 2CW0D 5M3MH 3P20A 3PUZA 3NQTA 1JR0D 4JI6Q 1KTKA 2NVTB 3QO2A 3PO3H 1VQ7A 5J1ZA 2Q2HA 4F87A 2PNRC 1X3EA 2L5TA 1K83B 4JBJA 2L4NA 3D31A 1QZHA 4K5XA 1AE3A 4NP5A
chains in the Genus database with same CATH topology
2PPBC 3TBIB 4IUQA 5C6AA 2N78A 1JWUD 3T16A 1S5CD 1WTXA 2JA7H 3F8TA 1UE6A 1EU3A 3IFDA 4R8IA 1GD7A 2R3ZA 3OOBA 2NVQH 1RIPA 2UUCQ 1QOHA 2F0FA 4BS9A 3OMCA 4GS3A 2HCIA 5DAUA 3KF8B 4A0UA 3CP0A 1W3SA 5FKAC 3SK6A 4DR5L 1HR0Q 2F0TA 1VQ9A 1T9HA 2B63H 4A3FG 3VA7A 1JB7A 3I4MH 3GTGB 4HIOA 2EYMA 3L0OA 4FXDA 4QQBX 4U673 1IBML 1NR4A 4A4IA 4BBRG 1H9SB 3BG3A 1A8VA 3FP9A 2NWGA 1I5FA 3J7YW 4YWLA 1N32L 4C1NK 2UXDL 4NW2A 3EVQA 5E66A 3U9SA 3U9OA 4DV0Q 1QJOA 4BWGB 2K05A 1WTWA 1JC7A 2ZTCA 1ZXTA 4DNRB 4H13C 4JOIA 2Y0SG 1I6HB 1YNND 2EZ5W 1VCIA 4M8AA 2PMZB 3CCRA 2JA5G 2FINB 2B2YA 4KHPQ 3RZDH 2JXMB 2WKDA 5EPKA 1DM0B 5C0XJ 4UP7A 3PUXA 5EPLA 2IPKD 5ELFA 4P2CB 4XT1B 1D8LA 3J7ZC 4LUOA 2F3IA 1GUTA 5TSSA 1SYCA 1OXTA 4DN4M 4GOPA 2NVTH 3GV6A 2IW3A 4FVMA 2Q8TA 1E7ZA 4YHHQ 3OW2A 4RH6A 5HURA 1K83H 3KBXA 1PMRA 5IT9c 3JC66 2WAEA 1S5BD 5ELEA 2KQ3A 2PMZE 1PRTF 4L63B 1EYDA 2CVRA 3KAIA 4A3JG 4DV1L 4NKLA 4HJ5A 3L4HA 1S40A 4GLAC 1VQ8A 1TU2B 4BY7B 2H5XA 2NTTA 1AEXA 1VDZA 1C48A 4DAMA 2D2CC 1LTLA 2K75A 3MAQA 4DFAA 1QUQB 4B3ML 2SNMA 1STYA 1KHIA 1QB5D 1STNA 5EJWA 3GTGH 3MTSA 1NMGA 5GAEC 3FSCA 4UP8A 3PF4A 3M3YB 3LE4A 3I4LA 2FMMA 2WB1G 4DNTB 4UP9A 4DV5Q 1EOTA 4BA2I 1D5XC 1KIXA 2KOLA 4HSPA 2PI2A 3KJOA 1PZID 1KLGD 3TP5A 3ICEA 1I6HH 4HAEA 3TMEA 3FMCA 4B08A 2R92G 1MJEA 4DK3C 5EBCA 2K32A 4DGZA 2L9HA 1WVLA 4IUPA 1PRTB 1BNZA 5IGGA 4AYBG 3S16B 5CV6A 2MPMA 1I94Q 3A5UA 2BH2A 3TS0A 4CJ1B 4PZ6A 2RDFA 3I90A 3HKZG 1VMPA 5JEAG 1EWIA 4PNYA 3VYUA 2YV5A 1MI2A 2EQSA 4BBSB 2B2VA 4LFCL 3G4SA 4WJWA 3NE5B 3VYSA 1IBKL 3X3NA 1A63A 4U68A 4K0KQ 3OOCA 4A3MG 2ZXRA 3BVMA 4BY7H 1MIUA 2XIWA 1E1OA 4X65L 4LUVA 1CK1A 3FS8A 2G9DA 3BDLA 1B9NA 2Z4IA 1NY4A 2BE5C 2F4IA 1N34L 3PIPA 1HNXL 2NN6H 1BKBA 1L0YB 1V1OA 1RJTA 3NELA 2HCCA 1HFGA 2VB3X 1Q46A 2F0JA 1K73C 1ILQA 1QWYA 1UE7A 3M3YH 1WTVA 1GXDC 3UI2A 1Q81C 2CCZA 3GTJB 4XT3B 1FYCA 1VQCA 3G48A 4A3CH 5LL6S 3BYTB 3CPWA 5KNCA 2IY5B 2OQKA 4DR6Q 3RLOA 2WV6D 3EBEA 5IWAQ 1WOCA 2BDOA 2OXPA 4GOPB 1J5EQ 3TP8A 3ERQA 1MD2D 4RHSA 3S16H 1Y14B 4JYAQ 1LLRD 1XXGA 1TS3A 5AFWA 2DY8A 3T13A 4RFBA 4O0AA 3IFTA 3NENA 2UXCL 4BBSH 5EKKA 2B2TA 4LF8L 4WORA 5BN5A 3R2IA 1N33Q 1NMVA 4X6AH 1T5XD 2F0SA 1PH7A 5C44B 5DM73 2XP4A 2NBFA 1SBBB 3K58A 1TR8A 1MBYA 1XMQL 4B3SL 1XNQQ 1YJNA 5JPMC 4QIWE 3NBHA 2F0EA 4PMBA 1YNJC 1B70B 2SNSA 4JI4Q 3AEVA 3TP6A 3DHQA 3MXUA 1EOVA 3UE1A 3JAML 1WTQA 3Q8DA 3PIOA 1VF5C 1ZYRC 4JG2A 2KA7A 3VYTA 1EG3A 4PMCA 1HZ9A 2D0OA 3HOZB 1LYLA 1GUGA 1KRSA 5LMNL 3V96A 2EZVA 1K8GA 3GTJH 2IX1A 2QF7A 3GV3A 5E64A 1U4MA 3PO3G 2ZAJA 4QY7A 2B2UC 2DNCA 3DEOA 1A2TA 3CHBD 3PV0A 1SE2A 4JI7L 2HQEA 3I2ZA 4GN4B 4TSSA 1YIJA 3PO2G 3TN2A 3C1EA 5GQOA 3IRBA 1XPRA 5FJ8G 1AFPA 4P72A 2KCCA 1JOKA 1NE3A 3ULJA 1EY5A 1O7YA 1UE5A 1DXMA 3KAHA 4LF5L 1UWVA 2PZTA 2VUMB 2F0MA 3VYRA 1XMOL 1GUNA 5AJ3L 1LTTD 2JA8B 4G7OC 3HOUB 1VQFA 3MCBA 4ZAIA 2OF1A 5E4XA 2EYHA 5KNBA 5C0XH 3J80L 4IPDA 2UXDQ 5C44H 1RL2A 2BE5D 1Z6HA 2LY7A 3WDNA 1OTCA 1GHJA 5IIFA 3J81L 2AHOB 5JAVA 1IZ6A 4B3TL 1LT3D 5LHY1 3I4OA 5EKIA 2RF4A 4RGNA 2JQOA 3MZ5A 2WAQG 3HRZC 4ODGA 2A69D 1IBLQ 3NTPA 2A5HA 4IOCA 2PQAA 3C2PA 3P7JA 3HOZH 4LFAL 1PV4A 1O7LA 1BVSA 4GKKL 5C3WA 1PA6A 3KF6A 4FP5D 2F52A 4HEDA 4KY5A 1QG7A 2KBNA 3ULPA 4LF9L 5DNFA 1SDFA 4A3DG 4DV1Q 1PTOF 3AMUA 2E76C 4EQOA 3IAYA 1TVXA 1YBYA 3M4QA 1Y1WB 1Q8IA 2NVXB 3KUPA 5ELDA 3WOEA 2NZ1D 2WB1E 1I6VC 4HTHA 2F0KA 3W2DA 3KLSX 2R6GA 4DA2A 1S3OA 3FHWA 2MO1A 4B3MQ 1EY4A 2JV4A 3PGZA 3FVQA 2IX3A 4KHVA 4OHJA 2VUMH 4UAIA 2DK1A 3L7ZC 5IYBH 1BQQT 2F3WA 3A7LA 2EXZA 1RP5A 2JA8H 3TEHB 2ZJPA 4QGUA 3HOUH 1VQDA 3M9BA 2ENBA 5CV8A 2JA9A 3HOYB 4O1NA 4LW1A 3T53B 3E5SA 3O13A 3CQZB 1ZYRD 2FXQA 3ZJYC 2WINB 3U4VA 2WKCA 2CHBD 4HJ8A 5KYLA 1YITA 1CT1D 4CJ0B 1IL8A 2XTIA 1ESFA 4IZ8A 2B8GA 5IT9E 2N8NA 2JP1A 3KOJA 3J80E 1TWFB 2JJQA 1Q3LA 1EEFD 2EYLA 1KDCA 1WCMG 2MHVA 3BDCA 3J81E 1DCZA 2L11A 4X66Q 5D3IB 4C3HB 4KK7A 1W6JA 3J7AF 3SVMA 1FVIA 4LFCQ 4JBWA 1SNPA 2KEEA 3KAFA 5JJLA 1RTNA 1R4QB 2VY3A 4IN3A 1ENCA 5GROA 5COYA 3P75A 2AQ3B 4DV2L 1G51A 4GNXA 2RQXA 3W1GA 1HQMC 4JI0L 4DV4Q 3KLSA 2QILA 1Y1WH 4KHZA 1CKNA 3MC0B 4OWTB 2NVXH 1HNWL 3Q6SA 1XYIA 4E6IA 3CD6A 4A3EB 1G2SA 4FF4A 3AYHB 2FMCA 1SR3A 1CZGA 3T4AC 2F4VQ 1NBWA 1EIHA 2GVBA 1B8AA 4FF1A 5GAGC 3MCBB 1N34Q 2EJMA 2RVLA 4HIKA 1SEBD 1SSOA 4ID6A 2R7ZB 1QVCA 1SXTA 1Q1BA 2OQ0A 4A76A 4R4CA 5IP9G 5T1IA 1KNAA 4RKBA 4DK0A 1PZJD 1FNUA 1WTPA 1L1OC 3S17B 5M5XB 3TP7A 2YTVA 2XNAC 2I07B 1SYGA 1P16A 2JK8A 4MHEA 3HOYH 4A3LH 5H1SE 4UY8C 3CQZH 4ZK9B 3V2TA 4JI3Q 2PQAB 3HP3A 4Y52H 3HOXG 4A3CG 4DV3Q 2N88A 1G2TA 2UUBL 1TWFH 4LWCA 4R9WA 4RCNA 2ASBA 3KF6B 1BBXC 4QJFA 3H6MA 5KGUA 4IJLA 1RHPA 4C3HH 4A3GB 1Q90A 1X3GA 1PTOD 1PYWD 2IT1A 2F0QA 1EQTA 1STEA 1PFBA 1ET6A 3GTLB 2NVQB 3CRKC 2VL6A 1IKMA 1FJGQ 4HIMA 4HR7B 5C4ZA 2R93G 2KECA 1X9NA 4CHTB 1B7YB 4POFA 1EIFA 1XMQQ 4YCWA 3OIPA 4A93B 3KABA 3I4NB 3NWSA 4A3EH 3ZYYX 3TSSA 1A0IA 2ZQVA 5IGCA 3A8IE 1SLJA 1VQGA 5JJZA 4DPGA 3CCSA 1HNZQ 2R7ZH 1KL9A 2AWOA 2E5LQ 3I3CA 5IY0A 2I5LX 1KD1C 5IYDH 3OHXC 2PNHA 4PMWA 5IGBA 1VQ6A 3S15B 4JK1C 1TIID 2PW5A 5LMNQ 5FO8B 5M5XH 3S17H 2O4XA 2VW9A 5D65A 2K5QA 3DM1A 1F2LA 1BUVT 3A55A 2A1AA 3HOVG 1UEAB 4ZKCB 2F03A 1KDBA 3T51B 1RTOA 1TWGB 4JI7Q 3DWAA 1VQMA 3I8ZA 3TZUA 2RDHA 3CCMA 1TR5A 1VQ5A 5M3FG 2NB0A 3H0GB 3MHBA 2IHEA 2C9OA 2WP8J 1X6OA 4ALPA 1K9RA 2K50A 1TS2A 3SK8A 2LFNA 4GNXB 2KXQA 5JVH3 4A3GH 1QILA 4LF5Q 4DV7L 4NDXA 4TRDA 2E2JB 5DEHA 4FF3A 2K5HA 4JI1L 1XX8A 2B29A 1WI5A 1YJWA 1QE6A 1CKNB 5KIXA 5IP7G 3GTLH 1BCPC 3NTKA 3E9HA 4DR3Q 1B53A 2J4XA 1II3A 3FKIG 2JX8A 4JI2L 3K5NA 1PYBA 2JA6B 1IYVA 1ICWA 3HOWG 4A93H 1UAPA 3I4NH 1VQOA 5C0XG 3K57A 4JI8L 3W3AA 2D9UA 2H4OA 1TK7A 1Y8NB 4EQ5A 3N52A 1RDPD 3D0FA 4B3TQ 1C8CA 2CQAA 1O7IA 3HEJA 4OL7A 3UDGA 1IKLA 1ML0D 4ZRZA 2DUDA 4K8JA 3L3OC 2N55A 5E65A 1W2BA 3NUCA 2B3GA 3KK7A 2CWAA 2MJ8A 4DR4L 4LFAQ 1S5DD 4OGQC 1HUMA 1E2WA 3S15H 1VQHA 1PH4A 1XNRQ 1K3RA 4GKKQ 4LFBL 1A3VA 1E2VA 2QRVA 2ZT9C 3DXJC 1QVFA 1MSGA 3FPUB 3MEHA 2BDNA 1KAWA 1KDAA 2ZM6L 3R8BA 4LF9Q 5CC4A 4C3IB 4GKJL 1TWGH 1FLCA 2K6AA 3SK5A 4WFN3 3T56B 1LTAD 3RZOB 4ME5A 1N9WA 1OO9B 3DWPA 3H0GH 1J6QA 3KFUA 2RCNA 1TS4A 1TT2A 2XPAA 1U4PA 2HIVA 4BA1I 4N9PA 4Y7NB 3S2HB 1JMCA 4JI5L 1N36L 1VF7A 1TWHB 1X55A 1SMXA 1GOZA 3NK9A 1C7YA 1F9QA 2E2JH 5FLMH 2AWNA 1LACA 4A3IG 2HUGA 3DWQA 1JE4A 5NUCA 4C56C 5C4XG 4DR7L 4MNOA 1GUOA 1OXXK 1NAPA 1BDOA 3PUWA 4DAPA 2KHIA 3CNGA 4K2KA 4H7BA 1H9KA 4K8IA 1QZGA 4Q0FA 3D6WA 1SNCA 5IYBG 4DK1A 4BXXH 2HHHQ 2JA6H 2I46A 5LL6X 2LXJA 3HOUG 1D7QA 3J7AV 1ENFA 2EXDA 5JJKA 3H09A 2E2HB 1STGA 2WADA 5ISRA 4GN5A 1A3UA 3T1HQ 4ME3A 2Z4HA 4FXGC 5CR3A 3VR3A 4BY1B 3T1YL 1Y1VG 3EROA 1PLFA 3L9AX 1PXUA 1ZEQX 2NYZD 3A8JE 1Q1EA 3K6OA 3W5OA 3K5LA 1QNKA 2F0NA 3SXHA 4KJNA 4DR2L 1XPOA 2Z8LA 1HXYD 2F0PA 3NSWA 1F9RA 1K8OA 4KN7C 5E1FA 4QCLA 3U50C 3M7NA 1AZPA 3PCOB 2FJ2A 3KLRA 4HMJA 1CUKA 2XWJB 2E2IB 4C3IH 4JI0Q 2A6HC 2LS01 1U4RA 3RD4A 3RZOH 1HNWQ 3R3OA 5U47A 3K0XA 5C3EG 2I5HA 2SOBA 4Y7NH 1YVCA 3EN2A 3S2HH 4R4TA 1TQOA 4X3KA 4JOIC 1Y1WG 1TWHH 2OWOA 3NBIA 4IUTA 4OX9Q 1M4VA 3S9WA 2XRSD 2RBMA 2RHQB 5IYCG 2IL8A 4PQXA 1L0XB 1MKHA 1SE3A 4C3JB 2K28A 5A2QE 5EPJA 3CC4A 5A35A 3I91A 3B6YA 3W1BA 2Q8IB 4LF7L 4X64L 4HCSA 2UXBQ 3Q22A 5FO7B 4HMIA 3E6ZX 1K9MC 2F0HA 2UU9Q 4EQPA 5BR8L 2HIXA 1Q8KA 2ZQUA 4KKTA 4DUZQ 2E2HH 3CCQA 2UUBQ 3I72A 3NXWA 2OTJA 5JPNC 2B2UA 4H44C 1JT8A 5JEAJ 4KMUC 4B3RL 1I50B 3K81C 3OSOA 3GTQB 1SRUA 4K5VA 4BY1H 4RWSC 4NXNL 2KUMA 5CMDA 4E5RA 3BVZA 2M9VA 4OO1I 4AH6A 1M1KC 3CXCA 2QA4A 5LMUL 4C3HG 1STAA 2DJYA 4S3SA 4V0BA 1F2MA 2SDFA 5K36G 1XTDA 3F2UA 2XP3A 3KADA 4QIWB 2E2IH 1SFOB 4TKOB 1PH6A 1LABA 5JOBA 4HJAA 5J22A 1V1PA 2JYOA 4U85A 2F0VA 5IGFA 2HT1A 4FO2A 1STHA 1DD2A 2IHFA 1A15A 4U84A 5FLXc 4DR1L 2XP8A 3PQHA 4JV5L 1KLUD 1K8AC 1YJ9A 2ZTDA 4IPHA 4P75A 3NP8A 3PUYA 2ZR6A 1K9QA 1EFID 4YIJA 4EVOA 2XGTA 4HIDA 2UUAL 2R7ZG 4C3JH 4YWMA 4YY3L 3CC2A 1DYQA 4MIUA 1MGSA 1EY8A 1OXUA 2F0GA 1U5KA 2BA1A 5I9OA 1I4GA 3KLWA 5I4DA 2BCOA 1H9JA 3MA2B 2L55A 4RA8A 4DK6C 4BBRB 4Z9CB 3MQGA 5M3MG 2L1BA 2B2WA 5CBEE 1D2BA 5HGTA 1X32A 1I50H 4DKAC 3LGJA 2F0WA 4UDUC 1B3AA 5EBDA 3GTQH 2PYKA 3VR2A 1LT6D 4RGMA 2XP5A 1AH9A 2MNAA 1EFWA 1BBUA 3DLLA 3S1MB 4DV7Q 2A6HD 1F9PA 5ELOA 2EPBA 1BXTA 2YU9B 4ULLA 2NZOA 1KQSA 1HR0W 2VQEL 1F77A 1S72A 5EQ0A 2Q5AA 5AHTA 2JA7G 1SFOH 3DM3A 2L0CA 2TMPA 4F7XA 4IPGA 1JJ2A 4JI2Q 3ITPA 4DR5Q 4G57A 1NCVA 1FGUA 1PVOA 1IYUA 3VA5A 2Y0SE 2AUKA 1AZQA 2E2DC 1WFQA 3SGIA 3S1RB 1J8IA 1IBMQ 2K5WA 3PF5A 2ICEC 4QIBA 3K7UC 1I4PA 2IJ0A 3H3VC 1ONLA 5IT9L 3DUZA 2B63G 1N32Q 4ZUIA 1SE8A 3FPPA 3I4MG 1V9PA 2GA4B 3NHHA 2GVAA 2YSHA 2JXWA 2PZUA 1FR3A 2MGSA 2JEAI 3AQQA 2CWPA 2F0UA 4DUYL 2RA4A 1EU4A 3SDZA 1PDQA 1X65A 1F2ZA 1XJVA 5KRUA 2PO4A 4LFBQ 1PFSA 1X56A 2UUCL 1A62A 4JBMA 1LT5D 2ZM6Q 4TQUS 1Z7TA 1PYSB 4BBRH 4GKJQ 3DEPA 1HR0L 5CBAE 2MO0A 2AKWB 2WB1B 1YNXA 2EE1A 3N6RA 4RHRA 3BZDB 3OWFA 1O6WA 2XN9C 4IFDI 3PMFA 3VR6A 4JI5Q 3MXNA 1TXYA 3H0GG 2R92B 3F2BA 3K59A 3S1MH 2F0OA 3BU2A 4IUUA 2M2LA 1NTGA 5CV9A 1SMYC 4LMQD 2YU9H 3MXPA 4QB4A 1V1PB 1GJXA 1I5HW 2K4KA 1IW7C 1LTBD 2YYZA 1DONA 5KEEA 2EYPA 3HKZB 3EA6A 4KHPL 1VS0A 5EAYA 3AB9A 1IXRA 3MVVA 5I2XA 2VXWA 1Z9FA 2V4DA 1FL0A 1W6KA 1L0WA 3S1RH 4R8NA 4IUNA 2A73B 4YHHL 4RCOA 1FD7D 1BR9A 1YNJD 1LO5D 3EIVA 1EEID 4AYBE 4JC0A 3VR5A 4A3MB 2A19A 4J1MA 3T1YQ 4L5RC 3HKZE 1JQYD 4X3SA 1WJJA 4B9WA 2JE6I 1PHJA 1SJHD 1EZ8A 4MN3A 1VQ4A 2PW7A 2BH8A 1PTOB 2E8GA 3QWNA 4OIKA 2XVSA 1EQQA 5CYUA 1CQVA 4OONA 1A6XA 2K52A 3D4WA 3G7LA 3BS1A 4GLVB 1HA6A 1CA5A 2Z6KC 4M1UB 2QCPX 1CFMA 5E3FA 1IBKQ 2BA0A 1E24A 3CPFA 4KV6A 3EQLC 1EL0A 1YHBA 2JMFA 1L2FA 2R92H 5IGDA 4L8JA 1M8AA 2PZWA 4KKSA 3F2DA 1PFNA 1R9TB 1YZ6A 1JWMD 1CHQD 2RDGA 2R7FA 4X65Q 4ZYSA 1SNOA 3GD7A 1VQNA 4APVA 1VQLA 4QMGA 1Q86C 4RKLA 4DAYA 2VNUD 1YHAA 1H9RA 3MEFA 2K5NA 4NPSA 2ES2A 5JEAH 1LTGD 1KABA 1O80A 4BY7G 3HFZB 1HNXQ 2OTLA 1HUNA 4FYDA 1I94L 5C5LA 1D1KA 5BR8Q 3CCUA 2MUYA 2NN6G 3LWEA 1Y69U 4RMFA 3RLFA 4A3MH 4B3RQ 2QEJC 3K0YA 3K5MA 3DMUA 1SNQA 3OWEB 3RNUA 4REXA 5ELBA 3R93A 3CMAA 2ID0A 3AFPA 5J39A 2VB2X 4K0KL 3CCEA 1DOKA 3RUZA 1QVGA 4KY6A 4Q5VA 4HN7A 3H91A 1GVPA 4XXEA 1B1ZA 3A54A 3E0JA 1F8AB 2J7ZA 2ALYB 3HKSA 1HFNA 5HGQA 5LMUQ 3TC5A 1PTOH 3HG9A 1HH2P 2ZXPA 3J7A5 5G3LF 3EJIA 1EUJA 1SNMA 5DLQE 1VQBA 3MXNB 3RN5A 2UXCQ 4IPCA 1JWSD 5IODA 1ASZA 1EWCA 4IUVA 1H95A 2HDMA 1B44D 4F88A 4DNIA 1YNNC 2VQFL 4LF8Q 4IFDJ 4A3BB 2ZJRA 2WACA 4DR1Q 1ESRA 1IW7D 2EYFA 1LTSD 4BBSG 4CKEA 4TVAB 3U58A 1BBWA 4LUZA 4R4QA 3I56A 3AU7A 1R9TH 4B3SQ 4DR6L 2MP1A 3PO2B 2F0DA 3UDFA 3CCVA 4CJ2C 4XYQA 4DV6L 2UUAQ 3BDOA 3M4YA 3VR4A 3FDTA 3BZCA 4YY3Q 3ONAB 4NXML 3URYA 1KNEA 3D6CA 3TQYA 1Y8OB 1H9MA 2X69A 4J15A 4L5SA 3BYYB 3GTPB 1G91A 1N8RC 3D4DA 1JJCB 1FNWA 2LAJA 1NJIC 3STBC 1EYGA 4GNXC 3KDFA 5I6YA 1PH9A 3CW2C 1N33L 1WD1A 1NR2A 1TS5A 3SHLA 3UE0A 1PH3A 3GQBA 1GKHA 4UPAA 1XNQL 2QKIC 4G7HC 1X3PA 4HJ7A 5E7NA 4YWKA 1PINA 3OPOA 5FLXE 2VQEQ 1G8ZD 4JI4L 4ZUJA 1JJGA 2A8VA 2O2LD 4O2DA 4LK1C 4AQYL 4FF2A 2CFMA 4A3BH 3QG1A 1XMOQ 3U4ZA 5AJ3Q 1PH5A 1SYEA 2K1BA 2F1MA 1TWCB 1BOSA 1BCPF 5CQ2A 5ELCA 1CKMA 1AW7A 4DAYB 1TWAB 3KAGA 4A3DB 1AN8A 3CF5A 5CORA 2WAQE 2K33A 1V8QA 2KENA 2AQ2B 4H02A 3WWVA 3PO2H 5JJIA 4DUYQ 3TCZA 2IX0A 5C44G 5FJ8H 3CCLA 4DXGA 4XTCS 1HTLD 2EVBA 3H3VI 2V1CC 5EGTA 1B9MA 4KTAA 2VS1A 3GTPH 4MTNA 3JAMc 3I73A 4OO1H 1EYCA 2WIIB 1F9SA 1Q12A 3C1FA 5IE8A 2F0LA 4U86A 4DF7A 2KVMA 1D5ZC 3OMGA 3OTOL 1VQPA 2NZHA 4QUFA 2EY2A 1WTOA 1J9OA 4I7ZC 1R4PB 3HOZG 4J6HA 2B8FA 5G3LD 4IJHA 3QJYA 1BCPB 1YI2A 1D5MC 4A75A 2EYOA 1D6EC 5E62A 3CC7A 4CKBA 2DMVA 1WCMB 2KCNA 2M8JA 1LTID 1LT4D 5A2QL 3GO5A 2KCMA 3AFQA 3K8AA 3SEBA 1KC8C 3ODKA 5C4JB 3GTKB 2ZQSA 2MQHA 1AP0A 2PCFB 3G71A 2R61A 3I70A 1IBLL 2OT2A 2DY7A 2B39A 1JORA 1T5EA 1V43A 4F8MA 1TWCH 3NTHA 2AQ1B 1TWAH 2XSCA 4KJOA 4FNFA 2GN5A 4A3DH 3LKXA 3MWYW 3CU7A 1YW5A 2HDLA 3E9IA 4RG1A 3IL8A 1HZCA 4A3KB 3JAMi 2VUMG 1E1TA 3J80c 5GADC 2SEBD 5D3DA 2N49A 1PRTC 4DU9A 1DZ1A 2JA8G 2CQOA 3J81c 5I2YA 2KJXA 2WFWA 2YSGA 1ET9A 4EX5A 3STBD 1XWEA 1ENAA 1X3FA 3KDFB 1HCZA 2FFKB 5T1GA 4LF4L 3NQIA 1VMCA 3P1HA 3KCEA 5F2DA 1I3QB 2X6LA 3OIQA 1JB3A 1EY6A 2KCTA 3VDYA 2DNEA 5IGEA 1WYDA 3BVGA 1NSNS 2YSIA 1G6ZA 2AUJD 4DV2Q 1JCKB 5BN3A 5ELNA 1CSQA 2Q2UA 5CV4A 3HOXB 4RGOS 3MFYA 4L6TB 1STBA 1G291 3KYHC 4OWXB 2EY5A 4LAAA 4GZYC 5JVG3 3E0EA 1U4LA 1WCMH 4B9XA 4K5WA 3A7AB 1BCPD 1GO3E 1CA6A 2AMCB 3J80i 5C3XA 2NTSA 2YTYA 5C4JH 3GTKH 2NUCA 1Q82C 1D1IA 3J81i 1HZBA 2B2YC 4X66L 2K03A 2DN8A 2F3VA 4K6DA 3PUVA 2BOSA 3M7GA 3S2DB 1A2UA 2K04A 1SYFA 2R93B 1MJCA 1EY9A 2D5DA 3KJPA 3K5OA 3BJUA 4OXPA 4IURA 1AE2A 2A68C 4A3KH 4GOPC 1SAPA 3I7FA 3A8KE 2YTXA 2EYJA 5K5PA 3CCJA 2EDGA 4R1JA 1CHPD 1VQKA 1HTPA 4DV4L 1HHVA 2OEOA 4IFDH 3HOYG 2J0TD 1Q7YC 2O5JC 4A3LG 4N9TA 4H0LC 3SE0A 3K80C 2F4VL 5I6WA 1ASYA 5E4WC 5IP9H 4NMZA 1G6PA 5E5WA 2XP9A 1I3QH 4ZKBB 4WRDA 1WTRA 3MFGA 1PFMA 1E3PA 2CKZB 2VQFQ 1GHKA 4XQNA 3HOVB 1O7ZA 2ICIA 2Z0SA 1XPUA 3ULLA 2XP6A 3GTOB 2K5VA 3HOXH 2YSFA 2A69C 2R7DA 3TS2A 1JOOA 5M3FB 1OXVA 2C35B 1SJED 4KD3A 3C3LA 4P73A 4JI3L 4DV6Q 4WJ4A 1A3TA 3SR1A 4DV3L 4NXMQ 1QCBD 3UDXA 4QF4A 4K2LA 3LKXB 2LXKA 5LMNW 1BO0A 4KI0A 4A3EG 3ND8A 1E2ZA 1PRTD 5FOBB 4LF6L 3TDBA 2ZR4A 1X54A 4G7ZC 4NB3A 3S2DH 4JBKA 2RSNA 3FKIB 3S14B 2K01A 2R93H 1EIGA 4HSVA 3LNNA 1DGSA 4G4KA 5M9OA 5IYDG 3HOWB 4A3FB 1EQVA 2B2VC 3FEWX 1FJGL 4IALA 1SYDA 5CGKA 3H15A 1BF4A 4RAUC 3M85A 4KKUA 1VQIA 3IKJA 3RLNA 2KEDA 2XPBA 1EG4A 1HZAA 3CKIB 1UUPA 1C0AA 5C5MA 1CSPA 2Q8RE 5C4HA 3BZKA 4X62L 2Y0SB 3SK4A 1HNZL 1U9RA 1ZCNA 1JICA 2O5IC 4AQYQ 2ZQTA 1S4ZA 3QIAA 1YEZA 2JA5B 2E5LL 4JI1Q 1KXLA 2L15A 4XQQA 5KNDA 2Z1CA 5FO9B 1S5ED 3HOVH 3OYYA 1GUSA 2Q2TA 4GLXA 1OXSC 4A3GG 4CKCA 3Q23A 3CRLC 3UDIA 2L12A 3GTOH 1RCVD 4PZ7A 4ZLTF 4A3BG 4DXFA 1K8MA 1SROA 4DAVA 5M3FH 3C46A 1EWHA 2EIFA 4JI8Q 4JI6L 2XWBB 3QB3A 4ZQ3A 1Y8PB 1EY7A 4ILWA 2F21A 2M8IA 3A56A 3S1NB 2F0IA 2ZTEA 2PI2E 4A3JB 4A93G 3I4NG 4A3IB 1F2YA 2A68D 4QUCA 5C4XB 4K6LA 5IP7H 1IYJB 3V05A 4P74A 3A0JA 4PZ8A 3KBGA 3L2PA 4DR4Q 4J8QA 2LMCB 3G6JB 1SYBA 1PH2A 3FKIH 3S14H 3LX0A 3F2CA 1CKOA 3A74A 3OTOQ 4KY7A 3Q0AA 1EIYB 4LJZC 4OO1G 3WH0A 4OWWB 4RGTA 4L5TA 3HOWH 2M00A 3LWUA 3HS0C 4DR3L 4A3FH 2B2TC 4XYOA 5J3BA 3NWTA 2Z6KA 2VZAA 3X3MA 4LNQA 4XIGS 1JOQA 1WR7A 4IOAA 3ER0A 1EQRA 1Y1VB 1B2TA 5IOCA 1VQAA 3QOJA 1RODA 3CAMA 1N36Q 4KN4C 3HZXA 3ND9A 4EGVA 2QGQA 2IWHA 4DV0L 2JA5H 4FDBA 5HY6A 2HQLA 4DR7Q 2PQEA 4AYBB 2NN6I 4V190 1ZKOA 2RHSB 4YCVA 1XNRL 3ERSX 5FLMG 2YSBA 1VQEA 3TZDA 1K0RA 3TRZA 1B50A 2XRQD 3NEMA 2X6GA 3JAME 2DGYA 1UNSA 3F1ZA 2B2WC 4KLKA 4QL5A 3OW7A 3QOLA 1L1OA 5C3EB 1DOMA 4POGA 4C1NI 1PTOC 2OCEA 1Z47A 2FHTA 3S1NH 1LUZA 1EYAA 4BXXG 2ATWA 2JA6G 1X3QA 1I4HA 1DJRD 4CGYB 4A3JH 4R4IA 4A3IH 1HRJA 3PIP3 3EFXD 3M4OB 3M4PA 3GTMB 2MDIA 5C4XH 4HCEA 3HGBA 4LF4Q 3TDQA 5I9PA 3RMHA 1TKWB 5GAHC 2I0QA 1HJPA 1I4QA 1SE4A 3D3RA 2KHSA 5BN4A 1JE5A 1LTRD 4DR2Q 2H1EA 1SNDA 3NBHB <