3M7NA

Archaeoglobus fulgidus exosome with rna bound to the active site
Total Genus 42
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
42
sequence length
179
structure length
179
Chain Sequence
MRFVMPGDRIGSAEEYVKGEGVYEEGGELFAAVAGKLIIKDRVAKVESISPIPEIVKGDVVLGRVVDLRNSIALIEVSSKKGENRGPSNRGIGILHVSNVDEGYVKEISEAVGYLDILKARVIGDNLRLSTKEEEMGVLRALCSNCKTEMVREGDILKCPECGRVEKRKISTDYGKGEW
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Quantitative analysis of processive RNA degradation by the archaeal RNA exosome
pubmed doi rcsb
source organism Archaeoglobus fulgidus
molecule tags Hydrolase/rna
molecule keywords Putative uncharacterized protein AF_0206
total genus 42
structure length 179
sequence length 179
chains with identical sequence B, C
ec nomenclature
pdb deposition date 2010-03-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF10447 EXOSC1 Exosome component EXOSC1/CSL4
A PF14382 ECR1_N Exosome complex exonuclease RRP4 N-terminal region
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.20.70.10 Mainly Beta Single Sheet Ubiquitin Ligase Nedd4; Chain: W; Ubiquitin Ligase Nedd4; Chain: W; 3m7nA03
2.40.50.100 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 3m7nA01
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 3m7nA02
4PZ8A 4DV1Q 4NXMQ 2O5IC 4GKKQ 1FR3A 2F3IA 1IW7D 4DNRB 5C4XG 5BR8Q 1K3RA 4LFBL 3I55A 3CNGA 3T53B 4A3FH 1GHJA 2HQLA 5JEAJ 1VQDA 2AHOB 3VDYA 4A93G 2YU9H 4NXML 3KAIA 4YCUA 4DV7L 2E5LL 5IT9c 3STBC 2BH2A 3ODKA 3KF6A 1HZAA 4QIBA 2BE5D 4JBWA 4JI2L 4A3BG 5C0XG 1YNJC 1WR7A 4LF4L 1XPRA 3T1HQ 5FJ8G 2YYZA 2A6EC 2VUMH 1YEZA 1VQPA 1S40A 1QZGA 5HY6A 3K7UC 1N36Q 2M3OW 1N34Q 4GOPB 1XMQQ 4DR7L 2F21A 4JI7Q 2XP5A 2B63G 2ZR5A 1VQJA 3GDEA 3CD6A 4FDBA 1SN8A 4PV1C 2VQFL 3T1YL 1HCZA 2GN5A 2JE6I 4GOPA 2KCCA 3OYYA 3JAMc 1N32Q 5JEAH 3I56A 1K0RA 1XPOA 1BDOA 3MEFA 2ZTDA 4A3IG 1Y1WG 1PH7A 3SGIA 4LF7Q 2ALYB 4DNIA 3M9BA 1TKWB 5M3MG 1RIPA 4RG1A 3CRKC 2YTXA 1PH3A 4X64Q 4DK0A 1B9MA 2JA6G 3VR2A 4OONA 4A3LG 1QJOA 3KYHC 2JV4A 4KHZA 1HJPA 2WAQG 4WJ4A 4GKKL 4DV7Q 2HIXA 4JI3Q 1PHJA 2A6HC 2K50A 4HIMA 4YWLA 1H9JA 1OTCA 1RL2A 2LXJA 4E5RA 3S1QH 1K9RA 1U0LA 1AE3A 4LFAQ 5M3FH 3Q8DA 1I3QH 1HNXQ 5M5WH 1EG3A 3I4MH 4HIDA 1JMQA 2ES2A 1HNWL 2KHJA 4Y7NH 3CPFA 3PO2G 1Y14B 1L0WA 4KKSA 2MNAA 5IE8A 4TVAB 4LNQA 4K0KQ 2UXCL 1CUKA 5JJLA 3FKIH 1LM0A 1HH2P 1YVCA 2OCEA 4GLAC 2LSSA 2NVXH 3LGJA 3OTOL 1JB7A 4JK1C 5LMUL 2L5TA 3CCJA 2ZR4A 3RZOH 2DNCA 2XPBA 2PQAB 3CF5A 3J80c 1XPUA 3ND9A 4LF9Q 1HNZQ 3PUVA 1G6PA 3TS0A 2ZJQA 3S1NH 4DK6C 4JOIC 3OTOQ 2JA5H 1PH1A 4DR5L 3BDOA 1CSPA 1A6XA 2WB1E 3CMEA 3TCZA 3I7FA 5FLMH 1DCZA 4J15A 2WP8J 3AB9A 3WH0A 1VQOA 5GROA 2MFIA 2A69C 4LFBQ 4G7HC 4C3JH 2B3GA 4OO1I 3UDXA 3S1RH 2R7ZH 3T56B 3NEMA 1X3GA 3RLNA 4IJHA 4LF6L 4B3TL 2E74C 3M3YH 1W3SA 2E75C 4REXA 3FHWA 1K9MC 1EIFA 4DV4L 4HIOA 3HOZH 1UEBA 4OXPA 4A3EH 1SROA 3ICEA 3CW2C 2R7DA 3HFZB 4JG2A 4IFDG 1FL0A 3PIPA 2CWAA 4JI8L 4A3KH 3PO2H 3AFQA 3L7ZC 3AYHB 5GAEC 4A3FG 2Q2HA 1EYGA 3NENA 4HIKA 1PH5A 1E2ZA 3I4NG 1LTLA 3M4QA 1I5FA 3MFYA 1VQMA 2R7FA 1IZ6A 3EBEA 4X6AH 2WAQE 1N34L 2R6GA 1SR3A 4A3DG 1QVFA 4GNXA 1ASZA 1Q81C 3L4HA 3TZUA 4P72A 4IPHA 2GVBA 1VDZA 5KNCA 3CCSA 1QZHA 5C3EG 4LF6Q 2IHFA 1KD1C 3KLWA 1SMYC 4DPGA 4DR3Q 3KCEA 3NE5B 1HZBA 5K36G 3I72A 2E5LQ 4GN5A 4IPDA 2VW9A 4DR6Q 2B29A 2PNHA 5ELNA 2JA6H 1V9PA 2PNRC 4X66L 1ZKOA 3CP0A 1L1OA 3KDFA 3J7A5 2WFWA 1GM5A 1CFMA 3PO3H 2Q2TA 1Y1WH 2L15A 4MTNA 4JI6Q 1C0AA 4JI6L 1EWHA 1R9TH 4LF8Q 1EG4A 2R7ZG 4JV5L 3BU2A 3W5OA 1NJIC 2O5JC 5C0XH 2DJYA 2XP6A 3T1HL 1Y1VG 4NB3A 3M4OH 1AE2A 1SE8A 3OW7A 2H5XA 3RR5A 2VQEL 2VUMG 5GADC 2OTLA 4GNXC 3A74A 1E24A 4UY8C 2KCTA 5BN4A 1HR0L 3LWUA 3GQBA 1KHIA 1T9HA 4LUZA 2VS1A 2IX1A 3HKZG 2NVQH 2PQAA 1MIUA 1IBKQ 2ZR6A 2YSHA 1X9NA 1T5EA 4GLXA 2ITKA 1W2BA 4JCVE 5M3FG 4LF8L 1YIJA 1B70B 3W3AA 1PINA 4JI4Q 4JBMA 1QVCA 3ER0A 1YJWA 2ID0A 1N33L 3F2CA 1HNXL 1MKHA 3J81j 1A62A 1TWCH 1XMQL 4DR7Q 1B7YB 1GUOA 5EAYA 3QJYA 1X6OA 4BY7G 3W1BA 1H9MA 1N33Q 4Y52H 1Q82C 2XGTA 1YI2A 2R92H 4PZ6A 1VF7A 4A3JH 2M8JA 4YWMA 1OXVA 2JA5G 2K33A 3D31A 2CFMA 2VZAA 1Q7YC 4LW1A 1PH9A 1SLJA 3ZJYC 2IHEA 3CCEA 1UE1A 1XNQL 1HTPA 4QL5A 1L2FA 1G291 2ZQTA 3DM3A 3PO3G 1VS0A 1NBWA 5BR8L 2XTIA 1VCIA 1JE5A 1KRTA 4R4TA 3CQZH 2QA4A 2EJFC 5CQ2A 4DUYQ 1IBMQ 4DV0Q 1FJGQ 2EIFA 4KN4C 3STBD 1E3PA 4JV5Q 1CTMA 2PI2A 1Z7TA 4DR2L 2HHHL 5E7NA 1MJEA 4YHHL 4BBSH 2JA7H 3RLOA 4KHPL 3UDFA 1Q8KA 1WFQA 3BZKA 4C2MH 4JI7L 3S15H 3T51B 4POFA 1H95A 3A8IE 1VQIA 2K52A 1YHAA 5LMUQ 4YWKA 3QG1A 3M85A 5IYBG 4LUOA 4OWXB 3F2DA 3RN5A 2JQOA 2KA7A 3HOZG 1KRSA 1TWAH 1IXRA 2IY5B 3PSIA 2BA1A 1N32L 4LWCA 1EQRA 4A3KG 4X62L 4BA2I 2A69D 1D8LA 3EN2A 3L2PA 5IYCG 1L1OB 3KDFB 3I4NH 3E9IA 2DK1A 4B3SQ 2EVBA 3K81C 3W1GA 3H3VI 2JXMB 2D62A 3HOWH 2ZJRA 1A63A 1PH4A 1JJ2A 3BG3A 1K8GA 1JT8A 2UU9Q 3M7NA 4H02A 4YY3L 3K80C 1LUZA 3JAMi 1PVOA 1GKHA 2EQSA 1H9SA 3GTOH 4JI5Q 3S2DH 2OQ0A 2KHIA 2OTJA 3LE4A 3ULLA 3HOUH 3KFUA 2I0QA 4IFDH 5IWAQ 3TC5A 4DNTB 1D7QA 4OO1G 4LF5Q 4L5QA 1UE6A 3A7AB 4TQUS 4DV5L 2YTVA 5IY0A 3VR3A 2E45A 2E2JH 1Q86C 1DD2A 4BBRH 3KJOA 5IYDG 1I94L 3F2BA 5DLQE 4XTCS 4JI4L 2QF7A 1VQ6A 2KENA 3F8TA 2ATWA 2V1CC 1X3EA 1M1KC 2ZQVA 1WJJA 3KJPA 1X3FA 4DUZQ 4AQYL 4JI1Q 1KAWA 3IKJA 3OW2A 1KL9A 1WCMH 1EUJA 1X65A 2AKWB 1XNRQ 2EJGC 3EQLC 4EQ5A 2OWOA 2XP8A 4BY1H 2CCZA 1UE7A 4L5RC 4DV3Q 4IO9A 1HQMC 2RF4A 4A3GG 4IPGA 1NY4A 1CKMA 2HIVA 5KNDA 5IWAL 2LXKA 5IYCH 1HR0W 3H0GH 3CC4A 2AUJD 1VQLA 1OXSC 3VR5A 1PH6A 4R4QA 3BJUA 1QUQB 1QVGA 2ZTEA 1X56A 3OOBA 2N8NA 4HJ5A 3IFTA 4OGQC 1WMVA 3J81c 2R93G 1LACA 3UDGA 4KLKA 1NMFA 2JJQA 3GTMH 4DV2Q 1YHQA 4QQBX 1Y8OB 2PCFB 3ND8A 3CCRA 4L5TA 4A3BH 4QGUA 3A8JE 4IQZA 4OWWB 3U4VA 4DAMA 1WOCA 4OO1H 1EOVA 5IP9H 1L1OC 2XP3A 2A6HD 4DR5Q 1YW5A 3K0XA 4UP9A 4XIGS 3JC66 3TEHB 2B63H 1DXMA 1U5KA 4AYBE 2DK7A 1OXTA 5FJ8H 1Q90A 4PZ7A 4A4IA 4JOIA 4DV3L 2UUBQ 2DN8A 4DR3L 2R92G 3KLRA 3CMAA 3KABA 3ULPA 3PUWA 3H15A 4DV4Q 2KCMA 1CSQA 2AWOA 3GTPH 2YSIA 1FJGL 2UUCQ 2EZ5W 2JXWA 1S72A 4B3ML 4P71A 1IW7C 3FPPA 1IL2A 4EX5A 4A3IH 1NE3A 3MXUA 3FKIG 1Q1BA 3S14H 2F52A 2UUAL 2JMFA 2EJMA 3G4SA 1KXLA 4DK1A 1YNXA 2A1AA 2YSBA 2UXBL 3K8AA 2LMCB 2ZJPA 5A35A 3CPWA 3GTGH 2BE5C 1P16A 2HHHQ 3CC7A 2JA8G 1WYDA 1LABA 4HJ9A 1YBYA 4U86A 2Y0SG 4P75A 4GNXB 4WJ3M 2ZM6L 2DMVA 4HJ7A 4DR4L 2PPBC 1BBUA 5IYBH 1O6WA 1C9OA 4LFCQ 4A93H 1HNWQ 3N6RA 1VQEA 5C4JH 4YCVA 1YITA 4LF7L 5AJ3Q 3F1ZA 1VQAA 2A68D 4BXXG 4DAYB 2HT1A 2NZHA 4PMWA 1CI3M 1VQ7A 1E2WA 1HZ9A 2BA0A 5AHTA 1I5HW 3IRBA 2B8GA 3AFPA 3RLFA 3RNUA 3WWVA 4DR2Q 2I5LX 1ZCNA 2N49A 1AH9A 2IX0A 2VQEQ 3PF5A 2L4JA 2LAJA 4C3HH 4DR6L 3HOXG 3ULJA 3G6EA 4TKOB 1J5EL 4HR7B 4H13C 2AUKA 5JJIA 3A5UA 1HZCA 3VR4A 1H9KA 1CKNB 1VQBA 2KXQA 1IBKL 3E9HA 1Z9FA 5FLXc 1Y8NB 4A3GH 2VQFQ 3T1YQ 1ONLA 4QIWE 1PV4A 1G51A 1XJVA 1FGUA 5LMNL 3RZDH 3H0GG 1SRUA 4MNOA 3K7AH 3UDIA 3A0JA 2F4VL 4O2DA 4AYBG 3KADA 2WB1G 5M5YH 4IFDJ 1XMOQ 1B9NA 3U4ZA 1I50H 1GUGA 4O0AA 4QY7A 4LK1C 3SDZA 3D0FA 1TWFH 4OX9L 3OOCA 2A6ED 3E0EA 3PUYA 4AH6A 3KAHA 1V1QA 2UUAQ 3J7ZC 4A3DH 4BA1I 1C7YA 4BY1G 4X66Q 1E1TA 3HOYH 5C3EH 1HPCA 1I6VC 3A7LA 4NXNL 5C44G 2VL6A 3TS2A 4ALPA 1BKBA 1XNRL 1VQFA 1VQ5A 3BZCA 2D0PA 4A3MG 2PMZE 5M3MH 3CCQA 2XP9A 3P20A 1X54A 1GVPA 2I5MX 2MQHA 3HOXH 4DUYL 1IBML 2RHQB 2K5NA 2GVAA 4HJ8A 4DV6L 2UUBL 1KQSA 2OQKA 3LNNA 3UE0A 1Y1VH 4LFCL 4RCNA 1Q1EA 1Q46A 1O7LA 2UU9L 4LF5L 5LMNW 1KIXA 2VNUD 2UXBQ 4GKJQ 1YHBA 3PIOA 1EQQA 1O78A 3A8KE 4JI1L 2DGYA 4DR1Q 1TU2B 4IJLA 2BH8A 2YTYA 1NTGA 4DR4Q 3VA7A 5BN3A 4DK3C 3NBHB 3GTJH 3U58A 5GQOA 1VQ8A 3I4LA 3HOVG 1I6HH 2RE3A 3KAFA 2DWVA 4ME3A 4DV1L 4LUVA 4A3EG 1VQGA 2B8FA 4A76A 1JMCA 4BBRG 1GJXA 2CKZB 1TWHH 1IYVA 1XNQQ 1FVIA 2AMCB 4NPSA 1TXYA 2JA9A 2Y0SE 1K8OA 4L8JA 3KF8B 4JI5L 2N78A 3KF6B 4DR1L 3NTPA 1NMGA 3CXCA 5C44H 3FMCA 3GTLH 4KMUC 4BBSG 2I5HA 5GAGC 1HR0Q 4GN4B 1SFOH 4IFDI 1SMXA 4A3MH 1JJCB 5GAHC 3CRLC 2NN6G 4P73A 1FYCA 2CQOA 1NMVA 4DV6Q 1PA6A 4K0KL 2UXCQ 4G7OC 4X65L 1J5EQ 5J3BA 2M8IA 3TRZA 1E2VA 4DUZL 1ASYA 1K8AC 3NELA 3D4RA 3KAGA 1EWIA 1K9QA 3GTKH 4X64L 2ZT9C 2R93H 4AIMA 1H9RA 3VR6A 1GUNA 3G48A 2YV5A 2KBNA 1N36L 2PI2E 2JEAI 1E22A 3PV0A 5IP7G 2Z6KA 5C0XJ 4GN3B 2VY3A 5IP9G 5KNBA 4JI3L 2N3SA 2F4VQ 2BDOA 3CCUA 3I2ZA 1A0IA 1CKNA 4YY3Q 2XP7A 1PH2A 2E2HH 1XMOL 4DV2L 2V4DA 1GUTA 4A3CG 3HOYG 1EIYB 3CCVA 2C35B 4B3RL 2CWPA 1Y8PB 2MO0A 3DLLA 4JBKA 1CKOA 3PCOB 4U85A 3U50C 1BVSA 4R1JA 2NN6I 3J80i 1M90C 1VQKA 4JYAQ 2DNEA 3CCLA 2FXQA 3CC2A 4GZYC 1K8MA 1Y69U 2MDIA 3PUZA 1N8RC 2ZM6Q 2JK8A 1DGSA 3OPOA 1MJCA 3AQQA 2CW0C 2A19A 3TREA 4C3IH 4YCWA 3KOJA 3HOWG 3H3VH 4GKJL 4GOPC 2ASBA 5JEAG 4GLVB 3ERSX 3PF4A 3FP9A 2DUDA 4BY7H 4GS3A 4LF9L 1IBLL 2F1MA 1TWGH 5C4XH 2Z6KC 1VQCA 3S17H 4A3LH 2E2IH 3B6YA 2NVTH 1H9SB 1GD7A 1PFSA 1WI5A 1B8AA 1WCMG 4UPAA 1PH8A 3S2HH 3J81i 1KC8C 2JEBI 1Z47A 1VQHA 4KKUA 1V8QA 1GHKA 2UXDL 2ZQSA 2K14A 4UP8A 1GO3E 1QUQA 1VQNA 4B3RQ 4BXXH 1Z6HA 1IYJB 2YSFA 4JI8Q 4B3SL 3RN2A 1O7IA 2QGQA 2RCNA 4R4CA 3S16H 5C0XI 2QEXA 4A3JG 1K83H 1E1OA 2NZOA 2NN6H 4P74A 4KI0A 4QJFA 2RHSB 5JJKA 1YNNC 3TQYA 4JYAL 1IYUA 1JJGA 4LF4Q 4A75A 4KHPQ 1VF5C 5K36H 5H1SE 3WDNA 2K7VA 2E76C 4APVA 4DKAC 4L5SA 5AJ3L 1YJNA 1I94Q 2Q8IB 1S3OA 1OXUA 4R4IA 2MO1A 5LMNQ 3G71A 3DXJC 1VQ9A 4JC0A 1K73C 4KKTA 1F8AB 3UE1A 3HOVH 1UWVA 4MZ9A 1N9WA 1V43A 1P8LA 4U84A 3CCMA 4RMFA 3GO5A 4JI0Q 3TDBA 4LFAL 4POGA 1HNZL 1ZYRC 4H0LC 1EFWA 3HOUG 5IP7H 3PUXA 2ZTCA 4H44C 1X55A 2JA7G 2Q2IA 4IOCA 1LYLA 2K75A 3M4PA 1UE5A 5FLMG 5BN5A 4LJZC 3U9SA 3CAMA 4JI0L 2IT1A 5IYDH 2YSGA 3I4MG 1E7ZA 2K5VA 4A3CH 3M4YA 2EXDA 2Z0SA 3H94A 2XP4A 4AQYQ 3I4OA 4B3MQ 3MXNB 4B3TQ 2UUCL 2ZQUA 1TK7A 2E8GA 3S1MH 2A8VA 2EDGA 2JX8A 5HGQA 2UXDQ 5M5XH 3AEVA 2A68C 3HGBA 3PGZA 1YZ6A 4X65Q 2Q2UA 1BBWA 4HJAA 3S24A 3QIAA 1PYBA 5ELOA 3HKSA 3GTQH 4NXNQ 2ZAJA 4DV5Q 3EIVA 2Q5AA 3SE0A 1Q12A 1YJ9A 3L0OA 4OWTB 4I7ZC 3I73A 2AWNA 2K4KA 2K32A 2K5HA 2NVYH 1J6QA 4R4OA 4IPCA 2D2CC 1PYSB 1IBLQ 2JA8H 1XTDA 4YHHQ 3HKZE 4G7ZC 1VQ4A 4OX9Q 1A8VA 1PMRA 1GUSA 3A5ZB 2XPAA 4IOAA 2D5DA 4X62Q 4PG3A 1OXXK 4JBJA 4JI2Q 4KN7C 3GD7A 4DV0L 2D0OA 4UP7A
chains in the Genus database with same CATH superfamily
4PZ8A 4DV1Q 3TN2A 5EQ0A 4NXMQ 1RF2D 2O5IC 4GKKQ 2PW7A 4KV6A 1FR3A 3MCBB 3WOFA 2F3IA 3S1MB 1IW7D 4K2LA 4L63B 4DNRB 3FRPB 5C4XG 5BR8Q 2F0OA 2FMMA 1K3RA 1KLUD 4A93B 4LFBL 3I55A 1TR8A 3CNGA 2IWHA 3T53B 3UI2A 3KK7A 4A3FH 1GHJA 1HUNA 1JWUD 5E5WA 1HTLD 2HQLA 5JEAJ 1ILQA 1VQDA 2AHOB 5IT9L 3VDYA 4A93G 4JPBW 3SXHA 3KAIA 1PTOC 4YCUA 4AYBB 2YU9H 4NXML 4DV7L 2E5LL 3C46A 5IT9c 3STBC 2BH2A 4FF1A 3ODKA 2WAEA 1QE6A 1U4PA 3KF6A 4RWSC 1HZAA 4QIBA 2BE5D 4JBWA 3SK5A 4JI2L 4A3BG 5C0XG 1YNJC 1WR7A 4LF4L 1XPRA 2D9UA 1TS5A 2RCFA 5TSSA 3T1HQ 3PO3B 5FJ8G 2YYZA 2A6EC 2VUMH 1YEZA 2WV6D 1VQPA 1S40A 1QZGA 1G6ZA 5HY6A 3K7UC 5HGTA 1N36Q 4B9XA 1EYAA 2M3OW 3HG9A 1N34Q 4GOPB 1XMQQ 4DR7L 2F21A 4JI7Q 2CH4A 2XP5A 5J1ZA 1J8IA 2B63G 2ZR5A 1VQJA 2QILA 5J22A 3GDEA 4MHEA 3CD6A 1K3BC 4FDBA 1SN8A 4PV1C 5FO8B 2VQFL 3T1YL 2KUMA 1HCZA 2GN5A 2JE6I 4GOPA 2KCCA 2SDFA 1PFNA 3OYYA 3JAMc 1N32Q 2CVRA 3NHHA 5JEAH 2RBMA 3I56A 1K0RA 1XPOA 1BDOA 3MEFA 1STBA 2ZTDA 4A3IG 4TRDA 5FO7B 3NK9A 2NVQB 2XN9C 3HRZC 4N9TA 1Y1WG 1PH7A 2RDFA 2BCOA 1LO5D 3SGIA 4LF7Q 1EY5A 2ALYB 1S5BD 3R2TA 4DNIA 3M9BA 1TKWB 2L1BA 5M3MG 1RIPA 4RG1A 3CRKC 4A3IB 2YTXA 1PH3A 4X64Q 3W2DA 4DK0A 1LTBD 1B9MA 2JA6G 3VR2A 4OONA 4DAPA 1QJOA 4A3LG 3NTKA 3KYHC 1D5MC 4TSSA 1RTOA 3NBHA 5IGCA 5COYA 5JAVA 4RHRA 2JV4A 4KHZA 1EY9A 1HJPA 4H7BA 2ICEC 2WAQG 1A2UA 2N88A 4WJ4A 4GKKL 4IUQA 3SK4A 4DV7Q 2HIXA 1LTID 4JI3Q 1PHJA 4CDEC 2A6HC 2K50A 4HIMA 4YWLA 1TS2A 3JAME 2HUGA 1LV9A 1H9JA 1OTCA 3BVMA 3X3MA 1F2LA 2Z4HA 4N8FA 4ZKBB 1RL2A 2LXJA 3EA6A 4E5RA 4CJ0B 2B39A 3S1QH 3Q23A 1K9RA 3E5SA 1SJED 5FLXE 1U0LA 2OEOA 1UNSA 1AE3A 4LFAQ 4A3DB 5M3FH 1UAPA 5L37A 3ZYYX 3Q8DA 3QB3A 1I3QH 1F2MA 1HNXQ 3NPPA 2X69A 1AFPA 1FGBD 1JOKA 5M5WH 1EG3A 2OXPA 4EQPA 4N9PA 3I4MH 4HIDA 4B08A 4F87A 4ZLTF 1JMQA 2ES2A 1HNWL 2KHJA 4Y7NH 5IODA 3MXPA 5EBDA 1SEBD 1TIID 3CPFA 3PO2G 2F0DA 1CHPD 1Y14B 2EYHA 4EQOA 5EPKA 4KHVA 1FD7D 1K28A 5EPLA 1WTQA 1L0WA 4KKSA 2AQ1B 1O7ZA 1SYGA 1KNEA 2ZXRA 2MNAA 3N52A 4HEDA 5IE8A 4FXKC 4TVAB 4LNQA 4K0KQ 2UXCL 4K14A 1CUKA 5JJLA 3FKIH 4DF7A 1LM0A 1HH2P 1YVCA 2J4XA 2OCEA 4GLAC 2LSSA 5E4WC 2NVXH 1SNQA 3SR1A 2RA4A 1WCMB 3LGJA 4XXEA 3OTOL 1V1PA 1JB7A 4JK1C 5LMUL 2IW3A 2L5TA 3CCJA 2ZR4A 1KDAA 1SNCA 3RZOH 2DNCA 1Y1VB 2XPBA 1MSGA 2BDNA 2F0IA 2PQAB 3J80c 3CF5A 3OSOA 5CORA 1XPUA 1G2TA 3ND9A 4RHSA 4LF9Q 2WB1B 1HNZQ 1LT5D 3PUVA 1G6PA 3TS0A 1ESFA 2DY8A 2ZJQA 3S1NH 4DK6C 4JOIC 3OTOQ 5KGUA 3J7AV 1S5DD 2JA5H 1PH1A 4DR5L 3BDOA 4IUVA 2RDGA 4K8IA 1CSPA 2R3ZA 2K6AA 5CBAE 1A6XA 2WB1E 3CMEA 3TCZA 1B3QA 3I7FA 1EQTA 4M1UB 5FLMH 1DCZA 4J15A 4B9WA 4C3HG 2WP8J 3AB9A 3WH0A 5DM63 1VQOA 5GROA 2MFIA 2A69C 3DWPA 4LFBQ 4G7HC 4K5XA 4C3JH 2B3GA 4OO1I 3UDXA 1WTVA 3GTMB 3S1RH 2R7ZH 1EFID 3NEMA 3T56B 1X3GA 3RLNA 4IJHA 4LF6L 2LKVA 4B3TL 2E74C 3M3YH 2WKDA 1AEXA 1EY0A 1WD0A 1W3SA 2E75C 4REXA 3FHWA 3J81E 1K9MC 1EIFA 1DYQA 1HUMA 4DV4L 2JA6B 1F2YA 3GTQB 4HIOA 3HOZH 2H1EA 1UEBA 5E66A 1WTWA 2B2UA 1S5CD 4OXPA 2MJ8A 4HN7A 2NZ1D 4A3EH 1SROA 3ICEA 3CW2C 1SE4A 3O13A 1TQOA 4RKLA 2R7DA 2RSOA 3HFZB 4JG2A 4IFDG 1FL0A 3PIPA 2CWAA 4JI8L 4A3KH 1R4QB 3PO2H 4XT3B 3AFQA 3L7ZC 3MXNA 3AYHB 5GAEC 4A3FG 2SEBD 2Q2HA 2K03A 1EYGA 1STNA 1DONA 3NENA 1NNXA 2QKIC 1A2TA 4HIKA 1PH5A 3H6MA 1EZ8A 4RFBA 1E2ZA 1BF4A 5EJWA 3VYUA 2RDHA 1HA5A 5D65A 3I4NG 5G3LD 2K01A 1LTLA 2PW5A 3M4QA 2KEDA 1I5FA 3MFYA 1VQMA 2R7FA 1IZ6A 3EBEA 5D14A 4X6AH 2WAQE 1N34L 1SR3A 2R6GA 4A3DG 1QVFA 4GNXA 1ASZA 4Z9CB 1Q81C 3L4HA 3TZUA 4P72A 4IPHA 4A0TA 1VDZA 2GVBA 3BYYB 5CR3A 5KNCA 3CCSA 3TP7A 1QZHA 5C3EG 2ENBA 1QNKA 4LF6Q 2HCIA 2IHFA 2KOLA 1D6EC 4K6LA 1KD1C 4IUTA 5KYIA 3KLWA 1DOKA 1SMYC 4DPGA 4DR3Q 3KCEA 3C1FA 3NE5B 3Q6SA 4DXFA 2OT2A 3H91A 1HZBA 3VA5A 5K36G 3I72A 2E5LQ 4GN5A 2JSOA 4HMJA 4IPDA 2VW9A 1NAPA 4DR6Q 2KEEA 4ODGA 1EY6A 2B29A 5CYUA 1D5ZC 2PNHA 4X3UA 1B53A 5ELNA 2JA6H 1V9PA 4IALA 3MTSA 2PNRC 1S5FD 4X66L 3S14B 1ZKOA 4R8NA 1IL8A 3CP0A 1TVXA 1L1OA 3KDFA 3MHBA 4KD3A 1C8CA 5DNFA 1D5XC 3J7A5 1ZYRD 2WFWA 1GM5A 1CFMA 3PO3H 2Q2TA 2QRVA 1Y1WH 2L15A 4MTNA 4JI6Q 1C0AA 4JI6L 1EWHA 1R9TH 2Q8RE 4LF8Q 1EG4A 1MBYA 2R7ZG 4JV5L 3BU2A 3W5OA 1NJIC 2O5JC 5C0XH 1SSOA 2DJYA 2XP6A 3T1HL 1Y1VG 1WTHA 4NB3A 3M4OH 1CHQD 1AE2A 1SE8A 1BCPD 2H5XA 3OW7A 3RR5A 2VQEL 2VUMG 3K0YA 5GADC 2OTLA 4IUUA 5CV9A 4GNXC 2M9VA 3A74A 4M8AA 1E24A 4UY8C 1FNVA 2KCTA 5BN4A 3RMHA 5IGFA 1HR0L 3GV6A 3KBXA 3LWUA 1RJTA 1D2BA 1G2SA 3GQBA 1KHIA 1T9HA 4LUZA 1SYBA 1U4LA 2VS1A 2XRQD 4E6IA 2IX1A 1EY8A 1II3A 3HKZG 2NVQH 3K5NA 2PQAA 1MIUA 4K5WA 1IBKQ 2ZR6A 2YSHA 2EOTA 1X9NA 1SE3A 1T5EA 4GLXA 1BCPF 1D1KA 4FYDA 2F0SA 2ITKA 1W2BA 2F0UA 2HQEA 4JCVE 5M3FG 4LF8L 2Z1CA 1B70B 1YIJA 3W3AA 1PINA 4JI4Q 1J9OA 4JBMA 1QVCA 3ER0A 1YJWA 2ID0A 3QWNA 1N33L 1BQQT 4KY6A 3F2CA 1HNXL 2K5DA 1MKHA 1JQYD 3J81j 3BVGA 1A62A 1TWCH 1CQVA 1X32A 1XMQL 4DR7Q 1EU3A 2QCPX 1B7YB 4BBSB 2F03A 2F0WA 1DOMA 1SFOB 1GUOA 5EAYA 3QJYA 1X6OA 4A3MB 5C4HA 4FNFA 4BY7G 4ZUJA 3W1BA 4DA2A 1H9MA 4EGVA 3QR8A 2EYJA 1EEID 1N33Q 1TS3A 2HDLA 4Y52H 1Q8IA 1Q82C 2XGTA 4OHJA 1YI2A 2R92H 4PZ6A 3HP3A 1VF7A 4A3JH 1YNND 2M8JA 3CHBD 4YWMA 4ULLA 1PRTC 1OXVA 2JA5G 2K33A 3D31A 2CFMA 2VZAA 1Q7YC 4JW0A 4LW1A 1GUWA 4RA8A 2I07B 2QW7A 4HSVA 1PH9A 4UAIA 3A56A 1SLJA 3FVQA 2PZWA 1BUVT 3ZJYC 2IHEA 3CCEA 1UE1A 3R8BA 1XNQL 1HTPA 4QL5A 1L2FA 1PXUA 1SNDA 4R9WA 1G291 2ZQTA 3DM3A 2B2TC 3PO3G 1PRTF 1VS0A 4CDFC 1NBWA 2RQXA 1EWCA 5BR8L 2XTIA 1VCIA 3GTKB 4RGNA 1JE5A 1KRTA 1ICFB 4R4TA 1E0BA 3CQZH 2QA4A 4CJ2C 3NSWA 2EJFC 3BZDB 5CQ2A 3CU7A 4DUYQ 1IBMQ 4DV0Q 1FJGQ 2EIFA 3FDTA 3VYRA 5E1FA 3D4DA 4OIJA 4KN4C 3STBD 4IN3A 1E3PA 3HZXA 4ZCKA 4JV5Q 1EEFD 1CM9A 1CTMA 2PI2A 1CA6A 1Z7TA 4DR2L 2HHHL 5E7NA 4DAYA 4FXDA 1MJEA 2J7ZA 4YHHL 5KEEA 4BBSH 2JA7H 3RLOA 4KHPL 3UDFA 1LT4D 1Q8KA 3NQIA 1WFQA 3BZKA 4C2MH 5I2XA 4JI7L 3S15H 3T51B 1LTAD 4POFA 1H95A 3TSSA 1WD1A 3A8IE 1VQIA 2K1BA 5NUCA 1RTNA 1X3QA 2WIIB 2K52A 1YHAA 5LMUQ 1CQFA 3MA2B 4YWKA 3P7JA 2SNMA 3QG1A 2F0NA 3M85A 5IYBG 3D8GA 3J81L 4HSPA 4LUOA 2B2YC 4OWXB 3F2DA 3RN5A 2JQOA 2KA7A 4KY7A 3HOZG 2E2DC 2KCNA 1F2ZA 2TMPA 1KRSA 1TWAH 2HD3A 3DEPA 1IXRA 1FLCA 4FXGC 5I4DA 2B2YA 2IY5B 1LT3D 1TY2A 2BA1A 3PSIA 1N32L 4LWCA 1EQRA 4A3KG 3TMEA 1JB3A 5C4JB 3OWEB 4X62L 4CDCC 4C3JB 1KTKA 1MGSA 4BA2I 2X6GA 2FMCA 2A69D 2ZXOA 4IUNA 3NWSA 1D8LA 3EN2A 2K5WA 3AMUA 3L2PA 5IYCG 3DWAA 3L3OC 5FO9B 5K5PA 1L1OB 3KDFB 3R93A 3I4NH 3E9IA 3R3OA 2DK1A 4B3SQ 2EVBA 1HFGA 2KECA 2YAJB 3K81C 3W1GA 3H3VI 2JXMB 3HOXB 1TY0A 2RKSA 3GV3A 3HOVB 2D62A 3BDLA 5J39A 3HOWH 5EKKA 3MVVA 4NMZA 2ZJRA 1A63A 1PTOB 1IKMA 1PH4A 5I9OA 1JJ2A 3BG3A 3D6WA 3NTIA 2LS01 1K8GA 1HHVA 2JA7B 3OIQA 1W6KA 1JT8A 2UU9Q 2Z8LA 3M7NA 1MI2A 4H02A 4YY3L 3K80C 1LUZA 5ELFA 4PNYA 3JAMi 1PVOA 1AP0A 3VYSA 3WOEA 1GKHA 4ID6A 1VMPA 2EQSA 1H9SA 3GTOH 1EIGA 4JI5Q 3S2DH 2OQ0A 4XQJA 2KHIA 3ULLA 3LE4A 3HOUH 2OTJA 3KFUA 2I0QA 5IWAQ 4IFDH 4ILWA 5ISRA 1HFNA 5U47A 3TC5A 4DNTB 5D3DA 1KNAA 4BY7B 1D7QA 4OO1G 4C3IG 3X3NA 4LF5Q 3I4MB 4L5QA 4LMQD 3QOLA 1TWAB 2EYPA 1UE6A 3A7AB 4TQUS 4DV5L 2YTVA 5FK9C 2Z9HA 5IY0A 2FINB 2E45A 2KJXA 3FSBA 3VR3A 1Q86C 2F0TA 2E2JH 2F3WA 5EGTA 4BBRH 3KJOA 1DD2A 5IYDG 1ET9A 3CKIB 1I94L 5I9PA 3F2BA 5DLQE 3A54A 2O4XA 4QMGA 4XTCS 2MPMA 4JI4L 1O7YA 2QF7A 5KIXA 1RDPD 1VQ6A 3K5MA 3BYTB 2KENA 3E0JA 4ZRZA 3F8TA 3DM1A 2F0GA 2ATWA 2V1CC 2NWGA 1X3EA 1I4RA 1RHPA 1SYFA 2WAQB 4QUFA 1M1KC 1EZ6A 1WTXA 2ZQVA 1STYA 2JN4A 3FKIB 1WJJA 3KJPA 1X3FA 4DUZQ 4QCLA 4AQYL 3E6ZX 4JI1Q 1KAWA 3IKJA 1JORA 3OW2A 1KL9A 1WCMH 1EUJA 1X65A 2AKWB 1XNRQ 2F3VA 2EJGC 3EQLC 4EQ5A 2QDBA 2OWOA 2XP8A 4BY1H 5CMDA 2CCZA 1UE7A 2XNAC 1TWFB 4L5RC 4DV3Q 3A55A 2B63B 3MCBA 1HQMC 4IO9A 2RF4A 4A3GG 4IPGA 4HAEA 1NY4A 1CKMA 3S16B 2HIVA 5KNDA 5IWAL 2LXKA 5IYCH 1HR0W 1K83B 3H0GH 3CC4A 3K58A 2AUJD 1VQLA 2NB0A 1OXSC 5C3EB 2XWBB 1ET6A 3VR5A 1PH6A 4R4QA 1KDCA 1QUQB 3BJUA 4MN3A 1QVGA 2ZTEA 1X56A 3OOBA 2N8NA 4HJ5A 3OWFA 4WRDA 3IFTA 3HS0C 1BNZA 4OGQC 2FFKB 1WMVA 3J81c 5IOCA 1LACA 3MFGA 2R93G 2L11A 3UDGA 4KLKA 1NMFA 2JJQA 1C4QA 3GTMH 5KRUA 4DV2Q 1YHQA 3S1RB 4RCOA 2R7ZB 4QQBX 1Y8OB 1BR9A 3Q24A 2PCFB 2B2UC 4PMCA 1V1PB 4XQQA 4ZAIA 1WVLA 3ND8A 3CCRA 4L5TA 5A2QL 1QNUA 1LTSD 4A3BH 2ICIA 1C48A 4RGTA 3A8JE 4QGUA 4IQZA 4OWWB 3U4VA 3TDQA 4DAMA 4C3JG 5T1IA 1L0YB 2F0KA 1WOCA 4OO1H 1EOVA 4XYOA 4BS9A 1NR4A 5IP9H 5E4XA 1L1OC 4DN4M 2XP3A 5I6YA 5DEHA 1EQVA 2A6HD 1JR0D 4DR5Q 1YW5A 4BY1B 3K0XA 4UP9A 3J7YW 4A3KB 4XIGS 3JC66 5JOBA 3TEHB 2B63H 1DXMA 1U5KA 2CQAA 3T4AC 1X3PA 2M00A 4AYBE 1SYDA 2J0TD 4X3SA 2DK7A 3D6CA 3JAML 1UEAB 1ESRA 3GTGB 2EXZA 1PRTB 1OXTA 5FJ8H 1Q90A 1U4RA 4PZ7A 2PYKA 4A4IA 4JOIA 1RODA 4DV3L 3P75A 2UUBQ 5E64A 4IUPA 2DN8A 4CKEA 3OMCA 1A3UA 4CHTB 3VYTA 4DR3L 3IAYA 2HCCA 2F0MA 2EYOA 2R92G 4EQNA 3KLRA 3CMAA 3KABA 2F0EA 3ULPA 4C56C 3MQGA 1EY4A 1CZGA 3K5OA 2JP1A 3PUWA 3H15A 4DV4Q 2KCMA 3E3XA 5M5XB 1CSQA 2IL8A 2AWOA 1SMYD 1M4VA 1ENFA 4RGMA 3GTPH 2YSIA 1FJGL 1U4MA 2UUCQ 2EZ5W 2JXWA 1S72A 4B3ML 4P71A 1IW7C 4G4KA 3FPPA 1IL2A 4EX5A 4A3IH 3PIO3 1NE3A 3FKIG 3MEHA 3MXUA 1BBXC 1Q1BA 1SNPA 3S14H 3HKZB 2F52A 2UUAL 2JMFA 2EJMA 1SJHD 2XSCA 2F0HA 4WFN3 2Z6BA 4S3SA 3G4SA 1ICWA 4K2KA 1KXLA 3GTLB 3K59A 4DK1A 2C5CA 1YNXA 2A1AA 4FP5D 4BWGB 2YSBA 2UXBL 2KHSA 3K8AA 2LMCB 2ZJPA 1NUCA 5G3LF 5A35A 3CPWA 5E62A 4CKCA 3GTGH 2BE5C 1P16A 2HHHQ 1MSHA 1BO0A 3KBGA 1JCKB 3CC7A 1JOOA 1B1ZA 2QDLA 4C3HB 2JA8G 1WYDA 5D3IB 1F9QA 1LABA 1QCBD 4NKLA 5M3FB 4N8X1 4HJ9A 1YBYA 5EKIA 4U86A 2Y0SG 4P75A 4GNXB 4NP5A 4CDDC 4WJ3M 4V190 2VB2X 1R4PB 3NTHA 2ZM6L 2DMVA 2DJGC 4HJ7A 4DR4L 2PPBC 4Y7NB 3FSCA 1BBUA 3FPUB 5IYBH 1O6WA 1C9OA 4LFCQ 1BXTA 4A93H 1HNWQ 4PMBA 4LAAA 2OF1A 3N6RA 5C4XB 2IJ0A 5ELCA 3T13A 4U68A 5I2YA 1VQEA 5C4JH 1CT1D 3MQHA 4YCVA 1YITA 4LF7L 5AJ3Q 1PDQA 3ERQA 4FO2A 3F1ZA 1VQAA 1RCVD 2A68D 4BXXG 5IGEA 3K5LA 4DAYB 2HT1A 2NZHA 1AZPA 4I7AA 4PMWA 3H3VC 1CI3M 2A5HA 2AQ2B 4WJWA 2CHBD 1VQ7A 1E2WA 1HZ9A 2NVXB 2BA0A 5AHTA 1RKNA 5T1GA 5C3XA 2B2TA 2EYMA 1I5HW 4C1NK 2R61A 5LL6X 3IRBA 2M2LA 3V96A 2B8GA 3AFPA 3RLFA 3RNUA 5CV8A 1TR5A 4XT1B 1QG7A 4UHVA 3WWVA 4DR2Q 1JWMD 3J7AF 1W6JA 1ENCA 2I5LX 3AU7A 1ZCNA 2N49A 4HMIA 1AH9A 2IX0A 2VQEQ 3PF5A 2L4JA 1NCVA 5ELEA 2CH4W 2LAJA 4C3HH 2RVLA 4DR6L 3HOXG 3S2DB 3S1NB 2F0FA 3HOUB 3M7GA 3ULJA 3G6EA 4TKOB 2LY7A 3T16A 1J5EL 1AN8A 4HR7B 5IGGA 4H13C 3QOJA 2AUKA 4QIWB 5JJIA 3A5UA 1HZCA 5LHY1 3VR4A 1H9KA 1CKNB 1VQBA 1EYCA 2F0JA 2KXQA 5E65A 1IBKL 3E9HA 4R8IA 1Z9FA 5FLXc 5CBEE 5JPMC 1Y8NB 4A3GH 5C3WA 2VQFQ 4KY5A 3T1YQ 4OIKA 1ONLA 4QIWE 5FLXL 1PV4A 4ZKCB 3RUZA 1WTPA 1G51A 1XJVA 1FGUA 5LMNL 3OIPA 1ML0D 5EPJA 5IT9E 3RZDH 3H0GG 3I70A 1SRUA 4MNOA 3K7AH 2PZUA 1A3VA 3UDIA 1F9PA 3A0JA 2F4VL 4O2DA 4AYBG 1FNUA 1CA5A 3KADA 2CW0D 2HDMA 1HRJA 2WB1G 5M5YH 1ZXTA 4IFDJ 5CV6A 1FNWA 1XMOQ 1B9NA 3U4ZA 3FS8A 1I50H 1GUGA 2LFNA 4O0AA 4QY7A 4YIJA 3MAQA 4C3IB 4LK1C 3SDZA 3D0FA 1STEA 2NBFA 1TWFH 1SYCA 4OX9L 3OOCA 4QUCA 1BCPC 2A6ED 3E0EA 5A2QE 3PUYA 4AH6A 3KAHA 3PIP3 1V1QA 2UUAQ 3J7ZC 4A3DH 4BA1I 1C7YA 3G6JB 4ZUIA 4BY1G 1XTCD 4X66Q 5M5WB 1E1TA 3HOYH 5C3EH 2IPKD 1HPCA 1I6VC 3A7LA 2F0VA 4NXNL 2L9HA 5C44G 1TWGB 3Q22A 2G5DA 2SNSA 2EYFA 2VL6A 2EY6A 4ALPA 3TS2A 1BKBA 1XNRL 1VQFA 1VQ5A 3GTJB 4L6TB 3BZCA 4A3GB 5I6WA 1IKLA 2D0PA 2VXWA 2A73B 4A3MG 2PMZE 5M3MH 3RZDB 2N55A 1G91A 1EOTA 3CCQA 2XP9A 2NTSA 3P20A 1X54A 3SHLA 1GVPA 2I5MX 2MQHA 1NSNS 1I4XA 2K04A 3HOXH 1G8ZD 4DUYL 1IBML 1STAA 2FHTA 3KF8A 3HOWB 2KVMA 2G9HD 4MIUA 2RHQB 2EY2A 1LT6D 2PMZB 2K5NA 3S9WA 2GVAA 1T5XD 4HJ8A 4DV6L 2UUBL 1KQSA 2OQKA 4U673 3LNNA 3UE0A 1Y1VH 3TBIB 4LFCL 4ABNA 1XYIA 4RCNA 1Q1EA 2EPBA 4DAVA 3P1HA 1Q46A 3ONAB 1O7LA 2O2LD 2UU9L 5ELBA 2PZTA 4KJNA 5LMNW 3C3LA 4LF5L 1R9TB 1KIXA 2VNUD 2UXBQ 1KLGD 4GKJQ 1YHBA 3PIOA 1JICA 4NW2A 1EQQA 1ILPA 3SEBA 1O78A 2B2VA 3A8KE 1QOHA 4JI1L 2DGYA 3HOYB 4DR1Q 1JC7A 2QEJC 1TU2B 4IJLA 5F2DA 2BH8A 2YTYA 1JE4A 1IHZA 5FOBB 4ZYSA 4IURA 1NTGA 4DR4Q 1I4QA 2F4IA 3VA7A 5JPNC 2E2JB 5BN3A 4DK3C 1STHA 3NBHB 3GTJH 3U58A 2NYZD 5GQOA 1VQ8A 3I4LA 3HOVG 1I6HH 2RE3A 3KAFA 1I4HA 2DWVA 2Y0SB 1F77A 4ME3A 4DV1L 4LUVA 5CGKA 4A3EG 1VQGA 1RP5A 1SDFA 2B8FA 2K28A 4A76A 2L4NA 3BVZA 1JMCA 4BBRG 4QB4A 2CKZB 3EFXD 1TWHH 1XNQQ 2R93B 1IYVA 1L0XB 1GJXA 2B2WA 1FVIA 1S5ED 2AMCB 4I65A 4KD4A 4NPSA 1TXYA 2JA9A 2Y0SE 3SVMA 1K8OA 1WTRA 1PZID 4L8JA 1SNOA 3KF8B 4JI5L 2N78A 4RH6A 3KF6B 4DU9A 1YNJD 4DR1L 3NTPA 1NMGA 3CXCA 5C44H 3FMCA 3GTLH 4CJ1B 1TWCB 2EY5A 4KMUC 4BBSG 2I5HA 4HCSA 3R2IA 2VUMB 5GAGC 1HR0Q 1EL0A 4EVOA 4GN4B 1SFOH 1K0SA 4IFDI 1SMXA 4A3MH 5JJZA 1JJCB 5C5MA 5GAHC 1UUPA 4MTKA 3CRLC 1MD2D 1BOSA 3NQTA 2NN6G 4P73A 1FYCA 3K57A 4UDUC 1VMCA 3NWTA 2CQOA 1NMVA 3V2TA 4DV6Q 1PA6A 1V1OA 2F0QA 4K0KL 2UXCQ 4G7OC 4X65L 3I3CA 2BOSA 1QILA 4ZQ3A 1J5EQ 5J3BA 2M8IA 1XXGA 4JVZA 1E2VA 5DAUA 3TRZA 4DUZL 1S4ZA 2IX3A 1SBBB 1ASYA 2B2VC 1K8AC 4F8MA 1B4OA 3SK8A 3NELA 3D4RA 3MWYW 4ZK9B 3OMGA 3KAGA 3BS1A 1EWIA 1LTRD 4Q0FA 1A15A 1K9QA 4J6HA 2WKCA 4A3BB 3GTKH 4X64L 2ZT9C 1TWHB 2R93H 1Q3LA 2F0LA 3L9AX 1TT2A 3ITPA 2NUCA 4AIMA 1H9RA 3VR6A 1GUNA 3G48A 2YV5A 2KBNA 1N36L 1RD9D 5C44B 2PI2E 2JEAI 2NVYB 1E22A 4XQNA 3PV0A 5IP7G 4X3TA 2Z6KA 5C0XJ 4GN3B 2VY3A 3QO2A 3NBIA 5IP9G 5KNBA 4JI3L 2N3SA 2F4VQ 2BDOA 3CCUA 3I2ZA 1A0IA 1CKNA 3BDCA 2WACA 4YY3Q 2XP7A 3M4OB 2VB3X 1HQRD 1PH2A 3J80E 3I91A 1WTOA 2E2HH 5CV4A 1XMOL 1LTGD 4DV2L 1I3QB 2V4DA 1GUTA 1SNMA 4A3CG 3I8ZA 3HOYG 3I90A 1EIYB 2WINB 3CCVA 2C35B 4B3RL 2CWPA 1JWSD 2EYLA 1Y8PB 2MO0A 2XVSA 2L0CA 3NXWA 2JYOA 1EIHA 2MP1A 1LLRD 3DLLA 4HTHA 4XDXA 1SAPA 3EVQA 3IL8A 4JBKA 1CKOA 3PCOB 4U85A 3U50C 2E2IB 5EKLA 3PQHA 1BVSA 1D1IA 4OEMB 4R1JA 2NN6I 3J80i 1PTOD 3LKXA 5C5LA 1M90C 1VQKA 4JYAQ 4OELB 2DNEA 1AZQA 3CCLA 2FXQA 4F88A 3CC2A 1Y69U 1K8MA 4GZYC 2MDIA 3PUZA 1TS4A 3TP6A 3H09A 4O1NA 2ZXPA 1N8RC 2ZM6Q 2JK8A 1DGSA 3LX0A 5CV5A 2P5ZX 3OPOA 5M5YB 1MJCA 1PTOH 3AQQA 1ENAA 2CW0C 3RZOB 3MXGA 2A19A 1PTOF 1QWYA 3TREA 4C3IH 4YCWA 3KOJA 3HOWG 3H3VH 1M8AA 4GKJL 2XWJB 4GOPC 2ASBA 3DUZA 5JEAG 1I4PA 5EBCA 4ME5A 1A3TA 4GLVB 2E2HB 3GTOB 3ERSX 2GA4B 3PF4A 4CKBA 2JA5B 3FP9A 2DUDA 4BY7H 4GS3A 4LF9L 4P2CB 2TSSA 3V05A 5ELDA 1IBLL 1I4GA 2XIWA 2F1MA 1CK1A 3GP7A 3G7LA 1TWGH 5C4XH 2Z6KC 1VQCA 4PQXA 3S17H 3PQIA 2XRSD 4A3LH 2E2IH 3HEJA 1PZJD 3B6YA 3NP8A 2NVTH 1H9SB 1GD7A 3LWEA 1B2TA 1PFSA 3CQZB 1WI5A 1B8AA 4A0UA 3SK6A 1WCMG 4UPAA 1PH8A 1EYDA 1JOQA 3S2HH 3J81i 1MHWC 1KC8C 3Q0AA 4CGYB 2JEBI 1Z47A 3MZ5A 1VQHA 4KKUA 1V8QA 1GHKA 2UXDL 2ZQSA 2K14A 4G57A 4XYQA 1XX8A 3EROA 4DGZA 3D3RA 4UP8A 4J1MA 5DM73 4K5VA 1GO3E 1QUQA 1VQNA 2MUYA 4QF4A 1OO9B 4A3EB 4BXXH 4B3RQ 3OHXC 1Z6HA 3D4WA 2EY1A 5IIFA 1IYJB 2YSFA 1KAAA 1DZ1A 4C2MB 4F7XA 3S15B 4JI8Q 3PO2B 4B3SL 2Y8NB 3RN2A 1PFBA 5C4ZA 1AW7A 1O7IA 2QGQA 2RCNA 3S1QB 4R4CA 3S16H 2SOBA 5C0XI 2QEXA 4A3JG 3C1EA 4KJOA 3LKXB 1F9SA 5CC4A 1K83H 1NR2A 3H0GB 1E1OA 2NZOA 2NN6H 3DWQA 4P74A 1DOLA 4KI0A 3F2UA 4QJFA 2RHSB 3KLSX 1STGA 5JJKA 5LL6S 1YNNC 3TQYA 1PRTD 4JYAL 1IYUA 1JJGA 4LF4Q 1DJRD 4RGOS 1GOZA 4A75A 4KHPQ 1VF5C 2K05A 5K36H 5H1SE 3WDNA 3S17B 2K7VA 2E76C 1PZKD 4APVA 5CV7A 4DKAC 4L5SA 5AJ3L 1YJNA 1I94Q 1PYWD 1I6HB 2NVTB 3RD4A 1S3OA 2Q8IB 5E3FA 1OXUA 1XWEA 4R4IA 3DMUA 2DJFC 2MO1A 5LMNQ 3G71A 4HCEA 2L55A 3DXJC 1VQ9A 4KTAA 5M9OA 1KABA 4JC0A 3K7AB 3I4NB 1K73C 3S2HB 4KKTA 1B3AA 1KDBA 2B2WC 3IFDA 1F8AB 3UE1A 3HOVH 1UWVA 4RKBA 4FF3A 2AQ3B 4MZ9A 1N9WA 1CZWA 1V43A 3C2PA 1P8LA 4DFAA 4U84A 3CCMA 3EJIA 4RMFA 3GO5A 4JI0Q 3TDBA 1EY7A 3TP8A 1QB5D 2PQEA 4LFAL 4POGA 1HNZL 1I50B 4H0LC 1ZYRC 2L12A 2Z4IA 1EFWA 1LTTD 1HA6A 3HOUG 5IP7H 2ZTCA 3PUXA 4H44C 1X55A 2JA7G 2F0PA 3KLSA 2Q2IA 4FF2A 4IOCA 1Y1WB 1LYLA 2K75A 2JA8B 5FKAC 3MC0B 3M4PA 4J8QA 3J80L 3PMFA 1UE5A 5FLMG 2G9DA 5JVH3 5BN5A 4LJZC 2X6LA 3U9SA 1DM0B 3CAMA 4OL7A 4K6DA 4JI0L 4X3KA 2IT1A 5HURA 5IYDH 3KUPA 2RSNA 1PFMA 2YSGA 3I4MG 1E7ZA 5C6AA 3DEOA 2K5VA 4A3CH 3M4YA 2EXDA 4RAUC 1SXTA 2Z0SA 3H94A 4CBVA 2XP4A 2EZVA 4AQYQ 5AFWA 3I4OA 1O80A 3MXNB 4B3MQ 4B3TQ 4BBRB 2UUCL 4FVMA 2ZQUA 1SE2A 2K5QA 1TK7A 2E8GA 3S1MH 2A8VA 2PO4A 1B50A 2H4OA 2EDGA 4NDXA 2JX8A 4KK7A 5HGQA 2UXDQ 3K6OA 5M5XH 3AEVA 2A68C 3U9OA 3HGBA 5M3MB 3PGZA 3M3YB 1YZ6A 3NUCA 4C1NI 4X65Q 2EE1A 2FJ2A 1BBWA 4A3FB 2Q2UA 2I46A 4HJAA 3S24A 4FF4A 4IZ8A 3QIAA 3GTPB 1EU4A 2C9OA 1PYBA 5ELOA 3HKSA 2YU9B 2WADA 1HXYD 3GTQH 4NXNQ 2ZAJA 4DV5Q 1SYEA 3EIVA 2A74C 3HOZB 2Q5AA 3SE0A 3FEWX 1GXDC 1Q12A 1U9RA 3L0OA 4OWTB 1YJ9A 4I7ZC 3DHQA 2Q8TA 3I73A 2AWNA 2K4KA 2K32A 2K5HA 2NVYH 3URYA 4DXGA 1J6QA 4R4OA 5KYLA 2NTTA 4IPCA 1F9RA 2D2CC 5IGBA 1PYSB 1IBLQ 2JA8H 1XTDA 4WORA 3TP5A 4YHHQ 3HKZE 4G7ZC 1VQ4A 4OX9Q 1A8VA 1PMRA 4Q5VA 4O42A 1GUSA 3A5ZB 2XPAA 4IOAA 4V0BA 3TZDA 2MGSA 2D5DA 4X62Q 2R92B 4A3JB 4PG3A 1OXXK 4JBJA 4JI2Q 1B44D 2KQ3A 1BCPB 5JVG3 5IGDA 4KN7C 4K8JA 1ZEQX 2DY7A 3GD7A 1PLFA 2MHVA 4DV0L 2D0OA 4UP7A
chains in the Genus database with same CATH topology
4PZ8A 4DV1Q 3TN2A 5EQ0A 4NXMQ 1RF2D 2O5IC 4GKKQ 2PW7A 4KV6A 1FR3A 3MCBB 3WOFA 3S1MB 2F3IA 1IW7D 4K2LA 4L63B 4DNRB 3FRPB 5C4XG 5BR8Q 2F0OA 2FMMA 1K3RA 1KLUD 4A93B 4LFBL 3I55A 1TR8A 3CNGA 2IWHA 3T53B 3UI2A 3KK7A 4A3FH 1GHJA 1HUNA 1JWUD 5E5WA 1HTLD 2HQLA 5JEAJ 1ILQA 1VQDA 2AHOB 5IT9L 3VDYA 4A93G 3SXHA 2YU9H 3KAIA 1PTOC 4YCUA 4AYBB 4NXML 4DV7L 2E5LL 3C46A 5IT9c 3STBC 2BH2A 4FF1A 3ODKA 2WAEA 1QE6A 1U4PA 3KF6A 4RWSC 1HZAA 4QIBA 2BE5D 4JBWA 3SK5A 4JI2L 4A3BG 5C0XG 1YNJC 1WR7A 4LF4L 1XPRA 2D9UA 1TS5A 5TSSA 3T1HQ 3PO3B 5FJ8G 2YYZA 2A6EC 2VUMH 2WV6D 1YEZA 1VQPA 1S40A 1QZGA 1G6ZA 5HY6A 3K7UC 5HGTA 1N36Q 4B9XA 1EYAA 2M3OW 3HG9A 1N34Q 4GOPB 1XMQQ 4DR7L 2F21A 4JI7Q 2XP5A 5J1ZA 1J8IA 2B63G 2ZR5A 2QILA 1VQJA 5J22A 3GDEA 4MHEA 3CD6A 4FDBA 1SN8A 4PV1C 5FO8B 2VQFL 3T1YL 2KUMA 1HCZA 2GN5A 2JE6I 4GOPA 2KCCA 2SDFA 1PFNA 3OYYA 3JAMc 1N32Q 2CVRA 3NHHA 5JEAH 2RBMA 3I56A 1K0RA 1XPOA 1BDOA 3MEFA 1STBA 2ZTDA 4A3IG 4TRDA 5FO7B 3NK9A 2NVQB 2XN9C 3HRZC 4N9TA 1Y1WG 1PH7A 2RDFA 2BCOA 1LO5D 3SGIA 4LF7Q 1EY5A 2ALYB 1S5BD 3R2TA 4DNIA 3M9BA 1TKWB 2L1BA 5M3MG 1RIPA 4RG1A 3CRKC 4A3IB 2YTXA 1PH3A 4X64Q 3W2DA 4DK0A 1LTBD 1B9MA 2JA6G 3VR2A 4OONA 4DAPA 1QJOA 4A3LG 3NTKA 3KYHC 1D5MC 4TSSA 1RTOA 3NBHA 5IGCA 5COYA 5JAVA 4RHRA 2JV4A 4KHZA 1EY9A 4H7BA 1HJPA 2ICEC 2WAQG 1A2UA 2N88A 4WJ4A 4GKKL 4IUQA 3SK4A 4DV7Q 2HIXA 1LTID 4JI3Q 1PHJA 2A6HC 2K50A 4HIMA 4YWLA 1TS2A 3JAME 2HUGA 1LV9A 1H9JA 1OTCA 3BVMA 3X3MA 1F2LA 2Z4HA 4ZKBB 1RL2A 2LXJA 3EA6A 4E5RA 4CJ0B 2B39A 3S1QH 3Q23A 1K9RA 3E5SA 1SJED 5FLXE 1U0LA 2OEOA 1UNSA 1AE3A 4LFAQ 4A3DB 5M3FH 1UAPA 3ZYYX 3Q8DA 3QB3A 1I3QH 1F2MA 1HNXQ 3NPPA 2X69A 1AFPA 1FGBD 1JOKA 5M5WH 1EG3A 2OXPA 4EQPA 4N9PA 3I4MH 4HIDA 4B08A 4F87A 4ZLTF 1JMQA 2ES2A 1HNWL 2KHJA 4Y7NH 5IODA 3MXPA 5EBDA 1SEBD 1TIID 3CPFA 3PO2G 2F0DA 1CHPD 2EYHA 1Y14B 4EQOA 5EPKA 4KHVA 1FD7D 5EPLA 1WTQA 1L0WA 4KKSA 2AQ1B 1O7ZA 1SYGA 1KNEA 2ZXRA 2MNAA 3N52A 4HEDA 5IE8A 4FXKC 4TVAB 4LNQA 4K0KQ 2UXCL 4K14A 1CUKA 5JJLA 3FKIH 4DF7A 1LM0A 1HH2P 1YVCA 2J4XA 2OCEA 4GLAC 2LSSA 5E4WC 2NVXH 1SNQA 3SR1A 2RA4A 1WCMB 3LGJA 4XXEA 3OTOL 1V1PA 1JB7A 4JK1C 5LMUL 2IW3A 2L5TA 3CCJA 2ZR4A 1KDAA 1SNCA 3RZOH 2DNCA 1Y1VB 2XPBA 1MSGA 2BDNA 2F0IA 2PQAB 3J80c 3CF5A 3OSOA 5CORA 1XPUA 1G2TA 3ND9A 4RHSA 4LF9Q 2WB1B 1HNZQ 1LT5D 3PUVA 1G6PA 3TS0A 1ESFA 2DY8A 2ZJQA 3S1NH 4DK6C 4JOIC 3OTOQ 5KGUA 3J7AV 1S5DD 2JA5H 1PH1A 4DR5L 3BDOA 4IUVA 2RDGA 4K8IA 1CSPA 2R3ZA 2K6AA 5CBAE 1A6XA 2WB1E 3CMEA 3TCZA 3I7FA 1EQTA 4M1UB 5FLMH 1DCZA 4J15A 4B9WA 4C3HG 2WP8J 3AB9A 3WH0A 5DM63 1VQOA 5GROA 2MFIA 2A69C 3DWPA 4LFBQ 4G7HC 4K5XA 4C3JH 2B3GA 4OO1I 3UDXA 1WTVA 3GTMB 3S1RH 2R7ZH 1EFID 3T56B 3NEMA 1X3GA 3RLNA 4IJHA 4LF6L 2LKVA 4B3TL 2E74C 3M3YH 2WKDA 1AEXA 1EY0A 1WD0A 1W3SA 2E75C 4REXA 3J81E 3FHWA 1K9MC 1EIFA 1DYQA 1HUMA 4DV4L 2JA6B 1F2YA 3GTQB 4HIOA 3HOZH 2H1EA 1WTWA 5E66A 1UEBA 2B2UA 1S5CD 4OXPA 2MJ8A 4HN7A 2NZ1D 4A3EH 1SROA 3ICEA 3CW2C 1SE4A 1TQOA 3O13A 4RKLA 2R7DA 2RSOA 3HFZB 4JG2A 4IFDG 1FL0A 3PIPA 2CWAA 4JI8L 4A3KH 1R4QB 3PO2H 4XT3B 3AFQA 3L7ZC 3MXNA 3AYHB 5GAEC 4A3FG 2SEBD 2Q2HA 2K03A 1DONA 1STNA 1EYGA 3NENA 2QKIC 1A2TA 4HIKA 1PH5A 3H6MA 1EZ8A 4RFBA 1E2ZA 1BF4A 5EJWA 3VYUA 2RDHA 1HA5A 5D65A 3I4NG 5G3LD 2K01A 1LTLA 2PW5A 3M4QA 2KEDA 1I5FA 3MFYA 1VQMA 2R7FA 5D14A 1IZ6A 3EBEA 4X6AH 2WAQE 1N34L 2R6GA 1SR3A 4A3DG 1QVFA 4GNXA 1ASZA 4Z9CB 1Q81C 3L4HA 3TZUA 4P72A 4IPHA 4A0TA 1VDZA 3BYYB 5CR3A 5KNCA 2GVBA 3CCSA 3TP7A 1QZHA 5C3EG 2ENBA 1QNKA 4LF6Q 4K6LA 2HCIA 2KOLA 1D6EC 2IHFA 1KD1C 4IUTA 5KYIA 3KLWA 1DOKA 1SMYC 4DPGA 4DR3Q 3KCEA 3C1FA 3NE5B 3Q6SA 4DXFA 2OT2A 3H91A 1HZBA 3VA5A 5K36G 3I72A 2E5LQ 4HMJA 2JSOA 4GN5A 4IPDA 2VW9A 1NAPA 4DR6Q 2KEEA 4ODGA 1EY6A 2B29A 5CYUA 1D5ZC 2PNHA 4X3UA 1B53A 5ELNA 2JA6H 1V9PA 4IALA 3MTSA 2PNRC 1S5FD 3S14B 4X66L 1ZKOA 4R8NA 1IL8A 3CP0A 1TVXA 1L1OA 3KDFA 3MHBA 4KD3A 1C8CA 5DNFA 1D5XC 3J7A5 1ZYRD 2WFWA 1GM5A 1CFMA 3PO3H 2Q2TA 2QRVA 1Y1WH 2L15A 4MTNA 4JI6Q 1C0AA 4JI6L 1EWHA 1R9TH 2Q8RE 4LF8Q 1EG4A 1MBYA 2R7ZG 4JV5L 3BU2A 3W5OA 1NJIC 2O5JC 5C0XH 1SSOA 2DJYA 2XP6A 3T1HL 1Y1VG 4NB3A 3M4OH 1CHQD 1AE2A 1SE8A 1BCPD 3OW7A 2H5XA 3RR5A 2VQEL 2VUMG 3K0YA 5GADC 2OTLA 4IUUA 5CV9A 4GNXC 2M9VA 3A74A 4M8AA 1E24A 4UY8C 1FNVA 2KCTA 5BN4A 3RMHA 5IGFA 1HR0L 3GV6A 3KBXA 3LWUA 1RJTA 1D2BA 1G2SA 3GQBA 1KHIA 1T9HA 4LUZA 1SYBA 1U4LA 2VS1A 2XRQD 4E6IA 2IX1A 1EY8A 1II3A 3HKZG 2NVQH 3K5NA 2PQAA 1MIUA 4K5WA 1IBKQ 2ZR6A 2YSHA 2EOTA 1X9NA 1SE3A 1T5EA 4GLXA 1BCPF 1D1KA 4FYDA 2F0SA 2ITKA 1W2BA 2F0UA 2HQEA 4JCVE 5M3FG 4LF8L 2Z1CA 1B70B 1YIJA 3W3AA 1PINA 4JI4Q 1J9OA 4JBMA 1QVCA 3ER0A 1YJWA 2ID0A 3QWNA 1N33L 1BQQT 4KY6A 3F2CA 1HNXL 2K5DA 1MKHA 1JQYD 3J81j 3BVGA 1A62A 1TWCH 1CQVA 1X32A 1XMQL 4DR7Q 1EU3A 2QCPX 1B7YB 4BBSB 2F03A 2F0WA 1DOMA 1SFOB 1GUOA 5EAYA 3QJYA 1X6OA 4A3MB 5C4HA 4FNFA 4BY7G 4ZUJA 3W1BA 4DA2A 1H9MA 4EGVA 2EYJA 1EEID 1N33Q 1TS3A 2HDLA 4Y52H 1Q8IA 1Q82C 2XGTA 4OHJA 1YI2A 2R92H 4PZ6A 3HP3A 1VF7A 4A3JH 1YNND 2M8JA 3CHBD 4YWMA 4ULLA 1PRTC 1OXVA 2JA5G 2K33A 3D31A 2CFMA 2VZAA 1Q7YC 4LW1A 1GUWA 4RA8A 2I07B 4HSVA 1PH9A 4UAIA 3A56A 1SLJA 3FVQA 2PZWA 1BUVT 3ZJYC 2IHEA 3CCEA 1UE1A 3R8BA 1XNQL 1HTPA 4QL5A 1L2FA 1PXUA 1SNDA 4R9WA 1G291 2ZQTA 3DM3A 2B2TC 3PO3G 1PRTF 1VS0A 2RQXA 1NBWA 1EWCA 5BR8L 2XTIA 1VCIA 3GTKB 4RGNA 1JE5A 1KRTA 4R4TA 1E0BA 3CQZH 2QA4A 4CJ2C 3NSWA 2EJFC 3BZDB 5CQ2A 3CU7A 4DUYQ 1IBMQ 4DV0Q 1FJGQ 2EIFA 3FDTA 3VYRA 5E1FA 3D4DA 4OIJA 4KN4C 3STBD 4IN3A 3HZXA 1E3PA 4JV5Q 1EEFD 1CM9A 1CTMA 2PI2A 1CA6A 1Z7TA 4DR2L 2HHHL 4DAYA 5E7NA 4FXDA 1MJEA 2J7ZA 4YHHL 5KEEA 4BBSH 2JA7H 3RLOA 4KHPL 3UDFA 1LT4D 1Q8KA 3NQIA 1WFQA 3BZKA 4C2MH 5I2XA 4JI7L 3S15H 3T51B 1LTAD 4POFA 1H95A 3TSSA 1WD1A 3A8IE 1VQIA 2K1BA 5NUCA 1RTNA 1X3QA 2WIIB 2K52A 1YHAA 5LMUQ 1CQFA 3MA2B 4YWKA 3P7JA 2SNMA 3QG1A 2F0NA 3M85A 5IYBG 3D8GA 3J81L 4HSPA 4LUOA 2B2YC 4OWXB 3F2DA 3RN5A 2JQOA 2KA7A 4KY7A 3HOZG 2E2DC 2KCNA 1F2ZA 2TMPA 1KRSA 1TWAH 3DEPA 1IXRA 1FLCA 4FXGC 5I4DA 2B2YA 2IY5B 1LT3D 1TY2A 2BA1A 3PSIA 1N32L 4LWCA 1EQRA 4A3KG 3TMEA 1JB3A 5C4JB 3OWEB 4X62L 4C3JB 1KTKA 1MGSA 4BA2I 2X6GA 2FMCA 2A69D 2ZXOA 4IUNA 3NWSA 1D8LA 3EN2A 2K5WA 3AMUA 3L2PA 5IYCG 3DWAA 3L3OC 5FO9B 5K5PA 1L1OB 3KDFB 3R93A 3I4NH 3E9IA 3R3OA 2DK1A 4B3SQ 2EVBA 1HFGA 2KECA 2YAJB 3K81C 3W1GA 3H3VI 2JXMB 3HOXB 1TY0A 2RKSA 3GV3A 3HOVB 2D62A 3BDLA 5J39A 3HOWH 5EKKA 3MVVA 4NMZA 2ZJRA 1A63A 1PTOB 1IKMA 1PH4A 5I9OA 1JJ2A 3BG3A 3D6WA 3NTIA 2LS01 1K8GA 1HHVA 2JA7B 3OIQA 1W6KA 1JT8A 2UU9Q 2Z8LA 3M7NA 1MI2A 4H02A 4YY3L 3K80C 5ELFA 1LUZA 4PNYA 3JAMi 1PVOA 1AP0A 3VYSA 3WOEA 1GKHA 4ID6A 1VMPA 2EQSA 1H9SA 3GTOH 1EIGA 4JI5Q 3S2DH 2OQ0A 4XQJA 2KHIA 3ULLA 3LE4A 3HOUH 2OTJA 3KFUA 2I0QA 4IFDH 5IWAQ 4ILWA 5ISRA 1HFNA 5U47A 3TC5A 4DNTB 5D3DA 1KNAA 4BY7B 1D7QA 4OO1G 4C3IG 3X3NA 3I4MB 4LF5Q 4L5QA 4LMQD 3QOLA 1TWAB 2EYPA 1UE6A 3A7AB 4TQUS 4DV5L 2YTVA 5FK9C 5IY0A 2FINB 2E45A 2KJXA 3FSBA 3VR3A 1DD2A 2F0TA 1Q86C 2F3WA 5EGTA 4BBRH 3KJOA 5IYDG 1ET9A 3CKIB 1I94L 5I9PA 3F2BA 5DLQE 3A54A 2O4XA 4QMGA 4XTCS 2MPMA 4JI4L 1O7YA 2QF7A 5KIXA 1RDPD 1VQ6A 3K5MA 3BYTB 4ZRZA 3E0JA 2KENA 3F8TA 3DM1A 2F0GA 2ATWA 2V1CC 2NWGA 1X3EA 4QUFA 1I4RA 1RHPA 1SYFA 2WAQB 1M1KC 1EZ6A 1WTXA 2ZQVA 1STYA 3FKIB 1WJJA 3KJPA 1X3FA 4DUZQ 4QCLA 4AQYL 3E6ZX 4JI1Q 1KAWA 3IKJA 1JORA 3OW2A 1KL9A 1WCMH 1EUJA 1X65A 2AKWB 1XNRQ 2F3VA 2EJGC 3EQLC 4EQ5A 2QDBA 2OWOA 2XP8A 4BY1H 5CMDA 2CCZA 1UE7A 2XNAC 1TWFB 4L5RC 4DV3Q 3A55A 2B63B 3MCBA 1HQMC 4IO9A 2RF4A 4A3GG 4IPGA 4HAEA 1NY4A 1CKMA 3S16B 2HIVA 5KNDA 5IWAL 2E2JH 2LXKA 5IYCH 1HR0W 1K83B 3H0GH 3CC4A 3K58A 2AUJD 1VQLA 2NB0A 1OXSC 5C3EB 2XWBB 1ET6A 3VR5A 1PH6A 4R4QA 1KDCA 4MN3A 1QUQB 3BJUA 1QVGA 2ZTEA 1X56A 3OOBA 2N8NA 4HJ5A 3OWFA 4WRDA 3IFTA 3HS0C 1BNZA 4OGQC 2FFKB 1WMVA 3J81c 5IOCA 1LACA 3MFGA 2R93G 2L11A 3UDGA 4KLKA 1NMFA 2JJQA 1C4QA 3GTMH 5KRUA 4DV2Q 1YHQA 3S1RB 4RCOA 2R7ZB 4QQBX 1Y8OB 1BR9A 3Q24A 2PCFB 2B2UC 4PMCA 1V1PB 4XQQA 4ZAIA 1WVLA 3ND8A 3CCRA 5A2QL 4L5TA 1QNUA 1LTSD 4A3BH 2ICIA 1C48A 4RGTA 3A8JE 4QGUA 4IQZA 4OWWB 3U4VA 3TDQA 4DAMA 4C3JG 5T1IA 1L0YB 2F0KA 1WOCA 4OO1H 1EOVA 4XYOA 4BS9A 1NR4A 5IP9H 5E4XA 1L1OC 4DN4M 2XP3A 5I6YA 5DEHA 1EQVA 2A6HD 1JR0D 4DR5Q 1YW5A 4BY1B 3K0XA 4UP9A 3J7YW 4A3KB 4XIGS 3JC66 5JOBA 3TEHB 2B63H 1DXMA 2CQAA 1U5KA 3T4AC 1X3PA 2M00A 4AYBE 1SYDA 2J0TD 4X3SA 2DK7A 3D6CA 3JAML 1UEAB 1ESRA 3GTGB 2EXZA 1PRTB 1OXTA 5FJ8H 1Q90A 1U4RA 4PZ7A 2PYKA 4A4IA 4JOIA 1RODA 4DV3L 3P75A 2UUBQ 5E64A 4IUPA 2DN8A 4CKEA 3OMCA 1A3UA 4CHTB 3VYTA 4DR3L 3IAYA 2HCCA 2F0MA 2EYOA 2R92G 4EQNA 3KLRA 3CMAA 3KABA 2F0EA 3ULPA 4C56C 3MQGA 1EY4A 1CZGA 3K5OA 2JP1A 3PUWA 3H15A 4DV4Q 2KCMA 5M5XB 1CSQA 2IL8A 2AWOA 1SMYD 1M4VA 1ENFA 4RGMA 3GTPH 2YSIA 1FJGL 1U4MA 2UUCQ 2EZ5W 2JXWA 1S72A 4B3ML 4P71A 1IW7C 4G4KA 3FPPA 1IL2A 4EX5A 4A3IH 3PIO3 3MEHA 3MXUA 1NE3A 3FKIG 1BBXC 1Q1BA 1SNPA 3S14H 3HKZB 2F52A 2UUAL 2JMFA 2EJMA 1SJHD 2XSCA 2F0HA 4WFN3 4S3SA 3G4SA 1ICWA 4K2KA 1KXLA 3GTLB 3K59A 4DK1A 2C5CA 4FP5D 1YNXA 2A1AA 4BWGB 2YSBA 2UXBL 2KHSA 3K8AA 2LMCB 2ZJPA 1NUCA 5G3LF 5A35A 3CPWA 5E62A 4CKCA 3GTGH 2BE5C 1P16A 2HHHQ 1MSHA 1BO0A 3KBGA 1JCKB 3CC7A 1JOOA 1B1ZA 4C3HB 2JA8G 1WYDA 5D3IB 1F9QA 1LABA 1QCBD 4NKLA 5M3FB 4HJ9A 1YBYA 5EKIA 4U86A 2Y0SG 4P75A 4GNXB 4NP5A 4WJ3M 4V190 2VB2X 1R4PB 3NTHA 2ZM6L 2DMVA 4HJ7A 4DR4L 2PPBC 4Y7NB 3FSCA 3FPUB 1BBUA 5IYBH 1O6WA 1C9OA 4LFCQ 1BXTA 4A93H 1HNWQ 4PMBA 4LAAA 2OF1A 3N6RA 5C4XB 2IJ0A 5ELCA 3T13A 4U68A 5I2YA 1VQEA 5C4JH 1CT1D 3MQHA 4YCVA 1YITA 4LF7L 5AJ3Q 1PDQA 3ERQA 4FO2A 3F1ZA 1VQAA 1RCVD 2A68D 4BXXG 5IGEA 3K5LA 4DAYB 2HT1A 2NZHA 1AZPA 4PMWA 3H3VC 1CI3M 2A5HA 2AQ2B 4WJWA 2CHBD 1VQ7A 1E2WA 1HZ9A 2NVXB 2BA0A 5AHTA 1RKNA 5T1GA 5C3XA 2B2TA 2EYMA 1I5HW 4C1NK 2R61A 5LL6X 3IRBA 2M2LA 3V96A 2B8GA 3AFPA 3RLFA 3RNUA 5CV8A 1TR5A 4XT1B 1QG7A 3WWVA 4DR2Q 1JWMD 3J7AF 1W6JA 1ENCA 2I5LX 3AU7A 1ZCNA 4HMIA 2N49A 1AH9A 2IX0A 2VQEQ 3PF5A 2L4JA 1NCVA 5ELEA 2LAJA 4C3HH 2RVLA 4DR6L 3HOXG 3S2DB 3S1NB 2F0FA 3HOUB 3M7GA 3ULJA 3G6EA 4TKOB 2LY7A 3T16A 1J5EL 1AN8A 4HR7B 5IGGA 4H13C 3QOJA 2AUKA 4QIWB 5JJIA 3A5UA 1HZCA 5LHY1 3VR4A 1H9KA 1CKNB 1VQBA 1EYCA 2F0JA 2KXQA 5E65A 1IBKL 3E9HA 4R8IA 1Z9FA 5FLXc 5CBEE 5JPMC 1Y8NB 4A3GH 5C3WA 2VQFQ 4KY5A 3T1YQ 4OIKA 1ONLA 5FLXL 4QIWE 1PV4A 4ZKCB 3RUZA 1WTPA 1G51A 1XJVA 1FGUA 5LMNL 3OIPA 1ML0D 5EPJA 5IT9E 3RZDH 3H0GG 3I70A 1SRUA 4MNOA 3K7AH 2PZUA 1A3VA 3UDIA 1F9PA 3A0JA 2F4VL 4O2DA 4AYBG 1FNUA 1CA5A 3KADA 2CW0D 2HDMA 1HRJA 2WB1G 5M5YH 1ZXTA 4IFDJ 5CV6A 1FNWA 1XMOQ 1B9NA 3U4ZA 3FS8A 1I50H 1GUGA 2LFNA 4O0AA 4QY7A 4YIJA 3MAQA 4C3IB 4LK1C 3SDZA 3D0FA 1STEA 2NBFA 1TWFH 1SYCA 4OX9L 3OOCA 4QUCA 1BCPC 2A6ED 3E0EA 5A2QE 3PUYA 4AH6A 3KAHA 3PIP3 1V1QA 2UUAQ 3J7ZC 4A3DH 4BA1I 1C7YA 3G6JB 4ZUIA 4BY1G 1XTCD 4X66Q 5M5WB 1E1TA 3HOYH 5C3EH 2IPKD 1HPCA 1I6VC 3A7LA 2F0VA 4NXNL 2L9HA 5C44G 1TWGB 3Q22A 2SNSA 2EYFA 2VL6A 2EY6A 4ALPA 3TS2A 1BKBA 1XNRL 1VQFA 1VQ5A 3GTJB 4L6TB 3BZCA 4A3GB 5I6WA 1IKLA 2VXWA 2D0PA 2A73B 4A3MG 2PMZE 5M3MH 3RZDB 2N55A 1G91A 1EOTA 3CCQA 2XP9A 2NTSA 3P20A 1X54A 3SHLA 1GVPA 2I5MX 2MQHA 1NSNS 1I4XA 2K04A 3HOXH 1G8ZD 4DUYL 1IBML 1STAA 2FHTA 3KF8A 3HOWB 2KVMA 2G9HD 4MIUA 2RHQB 2EY2A 1LT6D 2PMZB 3S9WA 2K5NA 2GVAA 1T5XD 4HJ8A 4DV6L 2UUBL 1KQSA 2OQKA 4U673 3LNNA 3UE0A 3TBIB 4ABNA 1Y1VH 4LFCL 1XYIA 4RCNA 1Q1EA 2EPBA 4DAVA 3P1HA 1Q46A 3ONAB 1O7LA 2O2LD 2UU9L 5ELBA 2PZTA 4KJNA 3C3LA 5LMNW 4LF5L 1R9TB 2VNUD 1KIXA 2UXBQ 1KLGD 4GKJQ 1YHBA 3PIOA 1JICA 4NW2A 1EQQA 1ILPA 3SEBA 1O78A 2B2VA 3A8KE 1QOHA 4JI1L 2DGYA 3HOYB 4DR1Q 1JC7A 2QEJC 1TU2B 4IJLA 5F2DA 2BH8A 2YTYA 1JE4A 1IHZA 5FOBB 4ZYSA 4IURA 1NTGA 4DR4Q 1I4QA 2F4IA 3VA7A 5JPNC 2E2JB 5BN3A 4DK3C 1STHA 3NBHB 3GTJH 3U58A 2NYZD 5GQOA 1VQ8A 3I4LA 3HOVG 1I6HH 2RE3A 3KAFA 1I4HA 2DWVA 2Y0SB 1F77A 4ME3A 4DV1L 4LUVA 5CGKA 4A3EG 1VQGA 1RP5A 1SDFA 2B8FA 2K28A 4A76A 2L4NA 3BVZA 1JMCA 4BBRG 4QB4A 3EFXD 1GJXA 2R93B 1IYVA 1TWHH 2CKZB 1L0XB 1XNQQ 2B2WA 1S5ED 4I65A 4KD4A 1FVIA 2AMCB 4NPSA 1TXYA 2JA9A 3SVMA 2Y0SE 1K8OA 1WTRA 1PZID 4L8JA 1SNOA 3KF8B 4JI5L 2N78A 4RH6A 4DU9A 3KF6B 1YNJD 4DR1L 3NTPA 1NMGA 3CXCA 5C44H 3FMCA 3GTLH 4CJ1B 1TWCB 2EY5A 4KMUC 4BBSG 2I5HA 4HCSA 3R2IA 2VUMB 5GAGC 1HR0Q 1EL0A 4EVOA 4GN4B 1SFOH 4IFDI 1SMXA 4A3MH 5JJZA 1JJCB 5C5MA 5GAHC 1UUPA 3CRLC 1MD2D 1BOSA 3NQTA 2NN6G 4P73A 1FYCA 3K57A 4UDUC 1VMCA 3NWTA 2CQOA 1NMVA 3V2TA 4DV6Q 1PA6A 1V1OA 2F0QA 4K0KL 4G7OC 2UXCQ 4X65L 3I3CA 2BOSA 1QILA 4ZQ3A 1J5EQ 5J3BA 2M8IA 1XXGA 5DAUA 1E2VA 3TRZA 4DUZL 1S4ZA 2IX3A 1SBBB 1ASYA 2B2VC 1K8AC 4F8MA 1B4OA 3SK8A 3NELA 3D4RA 3MWYW 4ZK9B 3OMGA 3KAGA 3BS1A 1LTRD 1EWIA 4Q0FA 1A15A 1K9QA 4J6HA 2WKCA 4A3BB 3GTKH 4X64L 2ZT9C 1TWHB 2R93H 1Q3LA 2F0LA 3L9AX 1TT2A 3ITPA 2NUCA 4AIMA 1H9RA 3VR6A 1GUNA 3G48A 2YV5A 2KBNA 1N36L 1RD9D 5C44B 2PI2E 2JEAI 2NVYB 1E22A 4XQNA 3PV0A 5IP7G 4X3TA 2Z6KA 5C0XJ 4GN3B 2VY3A 3QO2A 3NBIA 5IP9G 5KNBA 4JI3L 2N3SA 2F4VQ 2BDOA 3CCUA 3I2ZA 1A0IA 1CKNA 3BDCA 2WACA 4YY3Q 2XP7A 3M4OB 2VB3X 1HQRD 1PH2A 3J80E 3I91A 1WTOA 2E2HH 5CV4A 1XMOL 1LTGD 4DV2L 1I3QB 2V4DA 1GUTA 1SNMA 4A3CG 3I8ZA 3HOYG 3I90A 1EIYB 2WINB 3CCVA 2C35B 4B3RL 2CWPA 1JWSD 2EYLA 1Y8PB 2MO0A 2XVSA 2L0CA 3NXWA 2JYOA 1EIHA 2MP1A 1LLRD 3DLLA 4HTHA 4XDXA 1SAPA 3EVQA 3IL8A 4JBKA 1CKOA 3PCOB 4U85A 2E2IB 3U50C 5EKLA 3PQHA 1BVSA 1D1IA 4R1JA 2NN6I 3J80i 1PTOD 3LKXA 5C5LA 1M90C 1VQKA 4JYAQ 2DNEA 1AZQA 3CCLA 2FXQA 4F88A 3CC2A 1Y69U 1K8MA 4GZYC 2MDIA 3PUZA 1TS4A 3TP6A 3H09A 4O1NA 2ZXPA 1N8RC 2ZM6Q 2JK8A 1DGSA 3LX0A 5CV5A 3OPOA 5M5YB 1PTOH 1MJCA 3AQQA 1ENAA 2CW0C 3RZOB 3MXGA 2A19A 1PTOF 1QWYA 3TREA 4C3IH 4YCWA 3KOJA 3HOWG 3H3VH 1M8AA 4GKJL 2XWJB 4GOPC 2ASBA 3DUZA 5JEAG 1I4PA 5EBCA 4ME5A 1A3TA 4GLVB 2E2HB 3GTOB 3ERSX 2GA4B 3PF4A 4CKBA 2JA5B 3FP9A 2DUDA 4BY7H 4GS3A 4LF9L 4P2CB 2TSSA 3V05A 5ELDA 1IBLL 1I4GA 2XIWA 2F1MA 1CK1A 3GP7A 3G7LA 1TWGH 5C4XH 2Z6KC 4PQXA 1VQCA 3S17H 2XRSD 4A3LH 2E2IH 3HEJA 1PZJD 3B6YA 3NP8A 2NVTH 1H9SB 3LWEA 1B2TA 1GD7A 1PFSA 3CQZB 1WI5A 1B8AA 4A0UA 3SK6A 1WCMG 4UPAA 1PH8A 1EYDA 1JOQA 3S2HH 3J81i 1KC8C 3Q0AA 4CGYB 2JEBI 1Z47A 3MZ5A 1VQHA 4KKUA 1V8QA 1GHKA 2UXDL 2ZQSA 2K14A 4G57A 4XYQA 1XX8A 3EROA 4DGZA 3D3RA 4UP8A 4J1MA 5DM73 4K5VA 1GO3E 1QUQA 1VQNA 2MUYA 4QF4A 1OO9B 4A3EB 4BXXH 4B3RQ 3OHXC 1Z6HA 3D4WA 2EY1A 5IIFA 1IYJB 2YSFA 1KAAA 1DZ1A 4C2MB 4F7XA 3S15B 4JI8Q 3PO2B 4B3SL 2Y8NB 3RN2A 1PFBA 5C4ZA 1AW7A 1O7IA 2QGQA 2RCNA 3S1QB 4R4CA 3S16H 2SOBA 5C0XI 2QEXA 4A3JG 3C1EA 4KJOA 3LKXB 1F9SA 5CC4A 3H0GB 1NR2A 1K83H 1E1OA 2NZOA 2NN6H 3DWQA 4P74A 1DOLA 4KI0A 3F2UA 4QJFA 2RHSB 3KLSX 1STGA 5JJKA 5LL6S 1YNNC 3TQYA 1PRTD 4JYAL 1IYUA 1JJGA 4LF4Q 1DJRD 4RGOS 1GOZA 4A75A 4KHPQ 1VF5C 2K05A 5K36H 3S17B 3WDNA 5H1SE 2K7VA 2E76C 1PZKD 4APVA 5CV7A 4DKAC 4L5SA 5AJ3L 1YJNA 1I94Q 1PYWD 1I6HB 2NVTB 3RD4A 2Q8IB 1S3OA 5E3FA 1OXUA 1XWEA 4R4IA 3DMUA 2MO1A 5LMNQ 3G71A 4HCEA 2L55A 3DXJC 1VQ9A 4KTAA 5M9OA 1KABA 4JC0A 3K7AB 3I4NB