3M7NA

Archaeoglobus fulgidus exosome with rna bound to the active site
Total Genus 42
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
42
sequence length
179
structure length
179
Chain Sequence
MRFVMPGDRIGSAEEYVKGEGVYEEGGELFAAVAGKLIIKDRVAKVESISPIPEIVKGDVVLGRVVDLRNSIALIEVSSKKGENRGPSNRGIGILHVSNVDEGYVKEISEAVGYLDILKARVIGDNLRLSTKEEEMGVLRALCSNCKTEMVREGDILKCPECGRVEKRKISTDYGKGEW
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Quantitative analysis of processive RNA degradation by the archaeal RNA exosome
pubmed doi rcsb
source organism Archaeoglobus fulgidus
molecule tags Hydrolase/rna
molecule keywords Putative uncharacterized protein AF_0206
total genus 42
structure length 179
sequence length 179
chains with identical sequence B, C
ec nomenclature
pdb deposition date 2010-03-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF10447 EXOSC1 Exosome component EXOSC1/CSL4
A PF14382 ECR1_N Exosome complex exonuclease RRP4 N-terminal region
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.20.70.10 Mainly Beta Single Sheet Ubiquitin Ligase Nedd4; Chain: W; Ubiquitin Ligase Nedd4; Chain: W; 3m7nA03
2.40.50.100 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 3m7nA01
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 3m7nA02
4POFA 5IYDH 4DPGA 1U0LA 1HNZL 4I7ZC 1ZKOA 4L5QA 2RF4A 1IBML 4RMFA 4LFBQ 2E8GA 1CSQA 2E75C 1YHAA 3QIAA 4GLXA 1K8AC 4LFBL 1E2WA 1SN8A 4G7OC 2MDIA 4UY8C 1PYSB 1H9MA 1BVSA 3OW7A 2KXQA 2JA6H 4DK1A 1GVPA 2RCNA 3T56B 5FLMH 2OTJA 3H3VI 3L4HA 3K7UC 3CCMA 3CC4A 5KNDA 1S3OA 1IXRA 4A4IA 4LNQA 1CUKA 4UP9A 4OX9Q 4P75A 1CI3M 2R7FA 4QIWE 2RHQB 4X65Q 4JI8L 4X64L 1F8AB 3CW2C 4OO1I 1JMCA 2EQSA 1XNRQ 2HIVA 1UE6A 4X64Q 1B8AA 3H15A 4GOPC 3OTOQ 2YSBA 2XP8A 5C0XI 5IP7H 2Q8IB 2DWVA 3PF5A 2MFIA 3BZCA 2EJMA 4DAMA 1XNRL 3AFQA 2CW0C 2JQOA 5JJIA 2BH8A 1MIUA 4H02A 1VQLA 4YWMA 1DXMA 2DMVA 2CWPA 3OTOL 2ZJQA 4JBKA 4DV4L 2IX1A 4JYAL 4JI4L 1V9PA 4X62Q 2OWOA 1LACA 4R4CA 4NXMQ 3M4YA 2IY5B 1VQHA 4JI5Q 4DR7L 2JA8G 4DUZQ 2DGYA 1HNXQ 2ZTCA 3RNUA 2KHJA 1XPOA 3F2BA 4DV5L 4A3DH 3KAGA 4HJ8A 1V1QA 3CCRA 1DGSA 1H9KA 3AYHB 2CCZA 4JI1L 3IFTA 1XNQQ 4OWXB 4NXNL 1L2FA 2BA0A 2YSHA 1NY4A 1DCZA 1HJPA 4OONA 4XIGS 3ZJYC 1YW5A 1OTCA 2NVXH 1X6OA 2UXDL 2B63H 5FJ8G 2N3SA 4AIMA 2VQFL 4HIOA 5LMUQ 1P8LA 3TQYA 1HZCA 1G51A 2C35B 2VUMG 1X54A 1L1OC 2PQAB 3HOXH 4DR2Q 4G7ZC 3I56A 2MO0A 4HIMA 5K36H 2K5HA 4B3SL 3F2DA 1WJJA 2ID0A 1HZAA 5ELNA 3RLNA 1IYVA 2AUKA 4DR3L 3KLWA 2M3OW 4BBSG 1A6XA 2BE5C 1I6VC 4BY1H 4X66Q 4Y52H 2N78A 5IWAL 4RG1A 1GO3E 3I72A 1QJOA 5AHTA 3K8AA 1YBYA 5C4XG 3GTQH 1PH9A 1J5EQ 4JOIC 2N8NA 3LWUA 1LUZA 1TU2B 1UWVA 3S24A 2AWOA 1LYLA 3VR3A 2GVBA 2D5DA 3PO3H 3D4RA 3WH0A 1VF5C 2VY3A 3TS0A 1HZBA 2OQ0A 1W3SA 2A6HC 1WCMG 2PQAA 2M8JA 4YCUA 3U58A 1I6HH 4A3MG 1OXSC 1R9TH 2A69C 3CCEA 2DN8A 1YEZA 3VA7A 2A6EC 2KHIA 4KN4C 1O7IA 2R7DA 2A1AA 1VDZA 2E5LQ 5K36G 4A93G 1NBWA 3CMEA 3G71A 3HOYH 1VQBA 3CPWA 1VQ4A 2B8FA 3UDXA 2JA7H 2Z6KA 2WFWA 4KN7C 5JEAG 2KA7A 4A3BH 4GLVB 1BDOA 3M4OH 4LFAL 4GN5A 3A8JE 1K3RA 4HJ9A 5E7NA 2UUAL 2RHSB 1VQOA 4C3JH 2XP9A 3K81C 1HNWQ 1N32Q 3ICEA 3S16H 3J81i 4JOIA 4A3FH 2I5MX 1SR3A 2BH2A 4KKSA 4QY7A 4JI3L 1N32L 1G291 4J15A 1L1OB 1YJNA 5M3FH 3A0JA 2XGTA 1N36Q 1E2VA 1Y1WH 3L2PA 1SFOH 3HKZE 3CCUA 4IJHA 4KKTA 4YHHQ 2K32A 1TWHH 4HJ7A 3GO5A 1QZHA 1Z9FA 2BDOA 5FLXc 2FXQA 3M9BA 3PUXA 1KHIA 3I4NH 4YHHL 3I55A 2ZR5A 3KDFB 1VQ5A 2A69D 3KF6B 4LF4L 1XMQQ 3S1RH 4DV2Q 4DNTB 3F2CA 1ZYRC 4GOPB 1Q90A 1A0IA 3PIPA 2NZOA 3KOJA 3UDFA 2Z0SA 3I4OA 5M5YH 3CNGA 3TZUA 3GTPH 3LE4A 1CKMA 4AQYQ 1K73C 2ITKA 3DLLA 4JI1Q 4TQUS 5IP9G 3HGBA 3T1YQ 4PZ8A 2R92H 4JI7Q 1L1OA 1SLJA 1C7YA 2AHOB 3FKIH 5IE8A 1SMYC 5H1SE 4A76A 4DV7L 1XMOL 3T53B 2B3GA 1VQ7A 3VR2A 1JJGA 1E3PA 2ZM6Q 3U4ZA 4JV5L 2YSFA 4A3GG 3CCQA 4TVAB 3S1QH 1VF7A 2JA7G 4H44C 4DNRB 1PYBA 3W3AA 1PH2A 2NVTH 2XTIA 5ELOA 2VQEQ 1Q8KA 2OQKA 1E22A 1FJGL 3OYYA 4DR6Q 1TK7A 4DNIA 3B6YA 3UE0A 4A3LG 2UXCQ 1N34L 4R4IA 1TWAH 4A3MH 3F8TA 3F1ZA 3WDNA 3VR6A 2JA5G 4B3TQ 1YZ6A 1E1TA 3KFUA 2KCTA 1PH6A 1GUTA 4PV1C 4YWKA 1JMQA 4DUYL 4GNXB 2A68D 3A8IE 4BBRH 4G7HC 1N9WA 3NELA 4BY7H 1OXXK 5BN4A 3UDIA 4JC0A 2ES2A 3S2DH 4GKJQ 3EIVA 1UE5A 1E1OA 2XPAA 2R6GA 2Q2TA 4PZ6A 2UUAQ 4L5SA 5C0XH 1LABA 1KAWA 1X9NA 4PMWA 1TWCH 3STBC 1TXYA 1GJXA 1KL9A 1WR7A 3RZOH 4LFAQ 3CPFA 1TWFH 1WYDA 1S40A 5GROA 3CC7A 3A7AB 2ZTDA 3HOVG 4JYAQ 3KADA 3L7ZC 5C44H 1HNWL 3CRLC 2F3IA 1LM0A 3FHWA 4DAYB 3CCJA 2A6ED 1Y8NB 2UUCL 4C3HH 4DUZL 5IP9H 4UPAA 2DUDA 3NENA 2GN5A 5LMNL 1MJCA 4BBRG 2OCEA 2WP8J 1NTGA 2D0OA 4AYBE 3H0GH 5LMNQ 1N33L 2D0PA 2I5HA 4JK1C 2ZQUA 4ALPA 3VR5A 3KDFA 2DK1A 1GM5A 2GVAA 1VQCA 1M1KC 1X56A 3G48A 1I94Q 2F4VQ 2E45A 1H95A 4LF7Q 2F1MA 3T1YL 3M7NA 5IYCH 5LMUL 1X55A 4FDBA 1SROA 2IHEA 3ODKA 2YTXA 5JEAH 4OWTB 3VDYA 4DK0A 3Q8DA 1HQMC 1Y8PB 4IFDG 5CQ2A 2UU9Q 4AQYL 1B70B 1IYJB 1Q12A 1QVFA 1HPCA 4JBJA 1PV4A 2HHHL 5C3EG 1XMQL 4A3IG 4IJLA 1Y14B 2UUBQ 1VQPA 3M3YH 2UXBL 4IQZA 4PZ7A 2RE3A 2JK8A 1IBLL 4DV6L 3I4NG 4K0KL 3ND8A 3MXUA 5KNBA 4IOCA 5A35A 1X3FA 4A3JG 1E24A 3KJPA 4XTCS 3A7LA 4A3KG 1Q1BA 1PH4A 3GDEA 1XMOQ 1EG4A 4R4OA 1NMVA 2A19A 4LF6L 4QGUA 2ZM6L 2YU9H 1JJCB 4U86A 1Y1VH 1EQRA 2A8VA 3KAFA 3ULLA 1ASZA 3J80c 2L4JA 3PO2H 1PH7A 3OPOA 2QEXA 3GTJH 3CCLA 4C2MH 4B3MQ 3E9IA 3TCZA 1I5FA 2YTYA 2WAQG 4QIBA 3T51B 1I3QH 3PUYA 2AWNA 1YNNC 1E7ZA 3J7ZC 3M4QA 1KIXA 2V4DA 1VQIA 3RLOA 1RIPA 1EYGA 4JI6Q 1YIJA 1YITA 3GTKH 1FR3A 5GADC 2I5LX 4O2DA 3W1GA 1T9HA 3NEMA 5FJ8H 2JXWA 2V1CC 3HOUG 5GAHC 1DD2A 4JI8Q 2NZHA 1H9RA 2VL6A 4GKJL 1V43A 2HQLA 3FPPA 1QUQB 4A3CH 2PI2A 4JI4Q 1PA6A 1U5KA 4GS3A 2XP6A 4OO1G 1YHQA 4YCVA 4IPGA 4MNOA 2B29A 4A3DG 4JI3Q 4GLAC 1IW7C 4KHPL 1BKBA 3A5ZB 3GTOH 5C0XG 2UUCQ 4MZ9A 5C3EH 3JAMc 4REXA 4BBSH 4OXPA 2BA1A 3HOWH 5IYBG 1N36L 2ASBA 4OO1H 2K33A 1EUJA 1I94L 3GTMH 4EQ5A 2JX8A 2LAJA 1YVCA 3IRBA 1EQQA 1Y69U 4R1JA 1W2BA 3U9SA 5AJ3L 2Q2UA 1IYUA 4KLKA 2WB1E 1VQGA 4JCVE 4DV5Q 4LF5Q 4AH6A 3NTPA 2VUMH 1YJWA 1I50H 1NMGA 1QUQA 1PFSA 3M4PA 2JV4A 4LF5L 2K50A 1SE8A 3HOWG 2WB1G 4LF7L 3BDOA 4NPSA 2HHHQ 2JE6I 3MEFA 5JJLA 1N33Q 4A3EG 4B3SQ 3HOUH 2ZT9C 3RZDH 1HTPA 1VQJA 1HR0W 4BY1G 3J7A5 1EIFA 2O5IC 4JBMA 2ZQTA 2CWAA 1Z7TA 4JI7L 3W1BA 1TWGH 4JG2A 3TS2A 2PCFB 1EOVA 5IYDG 1VQEA 2EZ5W 1K9RA 3JAMi 4A3BG 3ND9A 2K75A 1WCMH 3HOXG 4HIKA 1Z47A 4TKOB 4BA1I 1K0RA 2IHFA 3S15H 5JJKA 3KF8B 2IT1A 2N49A 3T1HQ 2LMCB 3M85A 1GUNA 2JXMB 4O0AA 1Y1VG 1GKHA 2D62A 1CFMA 1PVOA 4GZYC 4JI0Q 4WJ3M 4LW1A 3I4MH 2ZR6A 4LUZA 2F52A 1CSPA 3GQBA 3GD7A 3CMAA 1HH2P 3LGJA 1CKNA 1B9MA 1V8QA 2UXCL 5JEAJ 3LNNA 1SMXA 1B9NA 1TKWB 3HOZG 1PINA 2NN6G 3CQZH 3OOCA 1WFQA 1XJVA 3STBD 3TRZA 4A3KH 3G6EA 1XTDA 5M3MG 1K8MA 3U4VA 3D31A 1IL2A 4YY3Q 4IFDI 3CCVA 4DV0L 1Z6HA 4LUVA 1GD7A 4DK6C 1LTLA 3I7FA 1KRTA 3AB9A 4A3LH 2YSIA 2MO1A 3PV0A 4BXXG 3H0GG 4JI6L 4BA2I 3TC5A 1VQAA 1VCIA 1YI2A 1OXVA 1K9MC 1VQFA 2E2HH 1QVCA 3RN5A 3PCOB 2E2IH 1O7LA 4KHPQ 3H94A 3HKSA 1C0AA 1HR0Q 1JE5A 2F21A 3ER0A 4DV1Q 3NBHB 4DR1L 2VS1A 2JEAI 3BU2A 1EG3A 1HR0L 4IOAA 2KCCA 1YHBA 1S72A 5IP7G 1GHKA 2K5VA 2CKZB 4X62L 2HIXA 2NN6I 3KLRA 3CCSA 4DV3L 2LXJA 1VQ9A 4NXNQ 4DR4Q 3DXJC 2KBNA 4U85A 4JBWA 3BZKA 4A3EH 2PMZE 1NMFA 2ATWA 2JA8H 3AQQA 3MFYA 1VQDA 1GUSA 5EAYA 3D0FA 5AJ3Q 2EJGC 4LF4Q 2YSGA 2ZR4A 1B7YB 3ULJA 2Y0SG 3A5UA 1K9QA 3H3VH 1GUOA 1IBKQ 1O6WA 3ERSX 1UE1A 2ALYB 3CRKC 1PH8A 4KKUA 1AE3A 2NN6H 4A3FG 1IBLQ 1NJIC 1A63A 1KC8C 3S1NH 2UU9L 1VQMA 4B3RL 4KHZA 1IW7D 2QGQA 3U50C 4DV7Q 1WMVA 1YJ9A 1X3GA 4DR2L 1FJGQ 3JC66 4IPCA 4JV5Q 2PI2E 2UUBL 4C3IH 4APVA 4OGQC 2NVYH 1GUGA 3T1HL 2K14A 3P20A 2DNCA 1AE2A 5C4JH 1PH3A 3QJYA 1WI5A 3S17H 5DLQE 4B3TL 3I4MG 1E2ZA 4GNXC 4A3GH 2EIFA 4JI0L 4X66L 4JI2L 1EWHA 3J81j 3N6RA 5IWAQ 4MTNA 3BG3A 3RLFA 4DR6L 2JA6G 4B3ML 1K83H 2Q2HA 2A68C 1J5EL 4HIDA 5BR8L 1UEBA 2EVBA 4LK1C 4LF9Q 1AH9A 4P71A 4A93H 3CAMA 3MXNB 2Q5AA 4DV0Q 2L5TA 2L15A 1XPUA 4OX9L 5LMNW 2ZJRA 1A8VA 5KNCA 5BN5A 2MQHA 4LJZC 1UE7A 3CC2A 3SE0A 1KRSA 1BBWA 5GAGC 2B8GA 2QF7A 4KI0A 1GHJA 4DR5L 4YY3L 5IYBH 1HCZA 2I0QA 2XP3A 1MKHA 5J3BA 1CKOA 2XPBA 4PG3A 3CP0A 1KD1C 1YNJC 2Y0SE 4LUOA 3PO2G 4Y7NH 2EDGA 4DR5Q 4GKKL 4IFDH 2ZQVA 2AUJD 1NE3A 2H5XA 1VQKA 3KJOA 3HOZH 1JT8A 4DR1Q 1P16A 1D8LA 4GKKQ 4HR7B 4A3CG 5M3FG 4JI5L 3L0OA 3KCEA 4P72A 1HNXL 2NVQH 2A6HD 1RL2A 2JEBI 3E9HA 1G6PA 1ONLA 1JJ2A 4GNXA 1FGUA 4LF8L 4DV4Q 4DV1L 1Y8OB 2ZAJA 1X3EA 2D2CC 3GTLH 2OTLA 3FMCA 2PNHA 1CTMA 2LSSA 1QVGA 1FVIA 3DM3A 4L8JA 2K52A 4EX5A 2R7ZH 2KCMA 1JB7A 1FYCA 2R93G 4IPDA 1FL0A 1IBKL 4R4QA 2VQFQ 3IKJA 4LFCL 5FLMG 3ULPA 3SDZA 3HOYG 4UP8A 5IY0A 4HJAA 2PNRC 3PUWA 2ZQSA 2B63G 3TREA 3VR4A 3PIOA 1KXLA 2E74C 2JA5H 4A75A 1H9SB 2R93H 1MJEA 2JA9A 5IT9c 5GAEC 1HZ9A 4DR3Q 4WJ4A 4K0KQ 3PF4A 1O78A 4KMUC 4AYBG 3RN2A 2AKWB 2JMFA 4HJ5A 3KYHC 3PUZA 3J80i 3AEVA 1A62A 2E76C 4ME3A 3SGIA 2UXBQ 4DK3C 1K8OA 1ZCNA 2Q2IA 3OOBA 1HNZQ 2ZTEA 2YYZA 1PH1A 3J81c 1YNXA 4QL5A 4H0LC 2CQOA 5C4XH 3W5OA 3HKZG 3EBEA 4L5TA 2EXDA 4GOPA 1N8RC 3NE5B 1N34Q 2R92G 1I5HW 4JI2Q 2R7ZG 4LF6Q 1H9SA 4IFDJ 4A3JH 3I73A 3I4LA 2HT1A 2XP7A 1EFWA 1M90C 2VQEL 5C0XJ 4YWLA 3PUVA 2EJFC 2CFMA 1EWIA 1OXTA 2XP4A 2KENA 2VW9A 2E5LL 5BR8Q 3KABA 3K0XA 4IPHA 1PMRA 3TDBA 3WWVA 2YV5A 2O5JC 4A3IH 2YTVA 2DJYA 1VS0A 3G4SA 1PH5A 5HGQA 4DKAC 1BBUA 3K7AH 4DUYQ 3PSIA 4P73A 4NB3A 3TEHB 4OWWB 1PHJA 3UE1A 4IO9A 4LF9L 1QZGA 3CD6A 4X65L 3FKIG 3CF5A 2XP5A 1VQNA 5IYCG 3HFZB 2MNAA 3AFPA 2JJQA 1K8GA 4GN3B 1J6QA 4YCWA 3GTGH 2DNEA 1C9OA 4QQBX 4NXML 1VQ6A 3S14H 3K80C 4DR7Q 3S1MH 5GQOA 3RR5A 4H13C 2K7VA 4R4TA 1WOCA 1Q86C 3CXCA 1IZ6A 3KAHA 2K5NA 1Q82C 3A74A 1Q46A 4UP7A 4X6AH 2AMCB 3A8KE 1VQ8A 1XNQL 4LF8Q 2QA4A 2VNUD 5BN3A 1XPRA 4QJFA 2M8IA 4U84A 1L0WA 2DK7A 2IX0A 3HOVH 2PPBC 2BE5D 3BJUA 3UDGA 3QG1A 3FP9A 3KAIA 4L5RC 5C44G 4POGA 4GN4B 4LWCA 1KQSA 1CKNB 3E0EA 3KF6A 4P74A 4BXXH 1Q81C 1EIYB 4LFCQ 4RCNA 1OXUA 5M5XH 1SRUA 4DV3Q 1X65A 1ASYA 5HY6A 4DR4L 1H9JA 2VZAA 4DV2L 2F4VL 2LXKA 4E5RA 3I2ZA 3PGZA 5M5WH 2K4KA 1Q7YC 3EQLC 1D7QA 5M3MH 2WAQE 3S2HH 4B3RQ 1Y1WG 2ZJPA 3PO3G 1T5EA 2UXDQ 1Q1EA 2Z6KC 3EN2A 4BY7G 4DV6Q 3OW2A 2E2JH 1IBMQ
chains in the Genus database with same CATH superfamily
4OL7A 3KUPA 3Q22A 4POFA 4KY7A 5IYDH 4DPGA 4NP5A 1U0LA 1HNZL 4I7ZC 1YNJD 1ZKOA 2I46A 4L5QA 4J8QA 4B9WA 4S3SA 2RF4A 1DOLA 1IBML 4RMFA 4LFBQ 2E8GA 2RQXA 2B2YA 1HFGA 2K05A 1CZGA 1ZEQX 3PIP3 1CSQA 3ONAB 1B4OA 2K04A 2E75C 4GLXA 1YHAA 3QIAA 1K8AC 1U4MA 2E2IB 2QDLA 2F3VA 4LFBL 2Z6BA 1E2WA 1SN8A 4X3TA 2QKIC 4G7OC 1KTKA 3MXPA 2MDIA 2K1BA 5K5PA 1WD0A 2AQ2B 4UY8C 2X6LA 3GP7A 1PYSB 4CHTB 1H9MA 1BVSA 3OW7A 2KXQA 1G2TA 2JA6H 2CQAA 2EYMA 3BYTB 3CKIB 1EY4A 4DK1A 1GVPA 2PZUA 2RCNA 1S5CD 3T56B 3R8BA 5I4DA 5FLMH 2OTJA 3H3VI 1PTOB 3L4HA 3K7UC 4RGMA 1WTXA 5E3FA 3CCMA 4U68A 3EJIA 3CC4A 1JE4A 5KNDA 2NVYB 1S3OA 4P2CB 1IXRA 4A4IA 5CGKA 4LNQA 1CUKA 4UP9A 1S5BD 1DOKA 2LKVA 4OX9Q 2R61A 2R93B 1TWHB 2DY7A 4P75A 5E66A 4A3IB 1CI3M 4UHVA 4WRDA 4RCOA 2R7FA 4QIWE 2RHQB 4X65Q 3NPPA 4JI8L 3MFGA 4X64L 1F8AB 3CW2C 4OO1I 1JMCA 2WB1B 1U9RA 2FJ2A 2EQSA 1XNRQ 1NAPA 2HIVA 1UE6A 3NP8A 2NZ1D 4X64Q 1B8AA 3RZOB 3H15A 4GOPC 1FNVA 3OTOQ 1ICFB 2R7ZB 2YSBA 2XP8A 3TZDA 5C0XI 5IP7H 2Q8IB 2DWVA 3PF5A 2MFIA 3BZCA 2EJMA 4DAMA 1XNRL 4HCEA 3AFQA 1XTCD 2CW0C 2OXPA 2JQOA 5JJIA 2BH8A 5JJZA 3GTGB 1MIUA 3I4MB 4H02A 1VQLA 4YWMA 1DXMA 2DMVA 2CWPA 3PIO3 3OTOL 5JVG3 2ZJQA 4JBKA 4C3JB 4DV4L 2IX1A 4JYAL 2WADA 1V9PA 4X62Q 2KVMA 4JI4L 1CA6A 2OWOA 1LACA 4R4CA 1I4RA 5KYLA 4NXMQ 3M4YA 2IY5B 1VQHA 4JI5Q 4DR7L 3IAYA 2RVLA 5FO8B 2JA8G 4ME5A 4DUZQ 2DGYA 2HDMA 1BXTA 1HNXQ 2KHSA 2ZTCA 4CDCC 4OEMB 3RNUA 2KHJA 4K14A 2QDBA 3GTKB 1S5DD 1XPOA 1NR2A 4A93B 3F2BA 4DV5L 3OSOA 1VMPA 4C3HB 4A3DH 3NTHA 3KAGA 4HJ8A 1V1QA 3S1QB 3CCRA 1DGSA 1H9KA 3AYHB 4F7XA 1RF2D 2CCZA 1TS4A 2L11A 5EKIA 4JI1L 3IFTA 1RJTA 3FEWX 1XNQQ 1D2BA 4E6IA 3P7JA 4OWXB 4K8IA 4NXNL 1L2FA 2BA0A 2YSHA 1NY4A 1DCZA 1HJPA 1I4GA 4FVMA 4L6TB 4OONA 4XIGS 3E6ZX 5E64A 1EY8A 4HAEA 1PFMA 3ZJYC 1YW5A 3PQHA 1OTCA 2NVXH 1X6OA 2UXDL 2B63H 5FJ8G 2TMPA 1PRTD 2N3SA 4AIMA 3HOUB 5CV8A 2VQFL 1D1IA 4HIOA 5LMUQ 1P8LA 3TQYA 2NVQB 4DAPA 1PXUA 3BYYB 1HZCA 1G51A 2C35B 1IL8A 2VUMG 1X54A 3KBGA 1L1OC 2PQAB 3HOXH 4DR2Q 4G7ZC 3I56A 5F2DA 2MO0A 4HIMA 3VYTA 5K36H 4RGNA 2K5HA 4B3SL 1SJED 3F2DA 1WJJA 2ID0A 1HZAA 5ELNA 2TSSA 4EVOA 3MHBA 1JWSD 3RLNA 4K5VA 2SDFA 1IYVA 3TDQA 2AUKA 1EY9A 3MEHA 4DR3L 3KLWA 3DEPA 5KGUA 2M3OW 4BBSG 3FPUB 4FXDA 1A6XA 2BE5C 1I6VC 1F9QA 4BY1H 2X69A 5I6YA 4X66Q 3HEJA 4Y52H 2N78A 1JR0D 5IWAL 4RG1A 2LFNA 1GO3E 2IL8A 3I72A 1QJOA 3O13A 1JORA 5AHTA 2HUGA 1BO0A 1YBYA 3K8AA 2G9HD 4KJOA 5C4XG 5C44B 3QOJA 3GTQH 1PH9A 1J5EQ 4JOIC 1FGBD 2N8NA 3LWUA 1LUZA 5M3FB 1TWAB 1TU2B 2PW7A 1NCVA 1UWVA 3S24A 5J1ZA 4DAYA 1LYLA 2AWOA 3G6JB 3VR3A 2GVBA 3MQHA 4CGYB 2F0LA 2D5DA 3LWEA 3PO3H 1PLFA 5DM63 3D4RA 3WH0A 1VF5C 2VY3A 3TS0A 2MPMA 1HZBA 4QIWB 4RHSA 2OQ0A 3H3VC 1W3SA 2A6HC 1WCMG 3E3XA 2F0DA 2PQAA 3J81L 1HA5A 1TY0A 1AN8A 2M8JA 4YCUA 2L4NA 3U58A 1CA5A 5C4ZA 5FK9C 1I6HH 4A3MG 1OXSC 1R9TH 2A69C 3CCEA 1YEZA 2DN8A 3VA7A 2A6EC 1RTOA 2KHIA 1LTAD 4KN4C 1O7IA 2R7DA 2A1AA 3NBIA 1VDZA 3NHHA 2E5LQ 3K7AB 3MA2B 5K36G 4RGOS 4A93G 1NBWA 4C56C 3G71A 3CMEA 3HOYH 1VQBA 1CQVA 1RD9D 2B2UC 1K3BC 1PFNA 3CPWA 1VQ4A 2XRQD 1J8IA 2B8FA 2FMCA 3UDXA 2Z6KA 2WFWA 2JA7H 4UAIA 4KN7C 5JEAG 2KA7A 3FSCA 3JAML 4BWGB 2F0WA 4A3BH 4K2KA 2JSOA 1QNKA 2FHTA 2Z8LA 4IZ8A 4GLVB 1BDOA 1ET6A 4A3KB 1VMCA 4LFAL 2BOSA 5HGTA 3M4OH 3EFXD 4GN5A 3QR8A 3A8JE 3HP3A 1K3RA 2Y0SB 4IUNA 4HJ9A 1SE4A 5E7NA 1B44D 1BR9A 2UUAL 2ENBA 5IIFA 2RHSB 1BCPD 1VQOA 4J1MA 4C3JH 3H6MA 2XP9A 5A2QE 2JA6B 3K81C 1HNWQ 1N32Q 3ICEA 3S16H 3S15B 3J81i 1LTGD 1TVXA 1TY2A 4JOIA 4A3FH 2I5MX 1SR3A 4FF3A 3C46A 3GV6A 3MQGA 2RSOA 2BH2A 4KKSA 4QY7A 4JI3L 1PTOC 1N32L 2ZXRA 5L37A 1G291 4J15A 1AP0A 2KUMA 1LT5D 1L1OB 1YJNA 5M3FH 5M3MB 4RH6A 1HUNA 3A0JA 5A2QL 2XGTA 1N36Q 1E2VA 1Y1WH 4X3SA 3L2PA 1F9PA 1M8AA 4HEDA 1EZ6A 1SFOH 2C5CA 1BOSA 1Q3LA 3MZ5A 3HKZE 5ELBA 3CCUA 3C1EA 4IJHA 4KKTA 3HOZB 4YHHQ 2KECA 2K32A 1TWHH 4HJ7A 3GO5A 1QZHA 1Z9FA 2LS01 2BDOA 5FLXc 4RKBA 2FXQA 5U47A 3PUXA 3M9BA 1KHIA 3I4NH 4YHHL 3I55A 2ZR5A 3KDFB 1VQ5A 3V05A 1AZPA 2A69D 3DWAA 3FDTA 1EWCA 3KF6B 1XMQQ 4LF4L 3S1RH 1S5ED 4DV2Q 4DNTB 2CW0D 3F2CA 1ZYRC 4GOPB 1Q90A 1A0IA 3PIPA 1CK1A 5I2XA 2NZOA 3KOJA 3UDFA 4KV6A 1TS5A 5EPKA 2EYJA 2Z0SA 3I4OA 1SNCA 5M5YH 3CNGA 1EIGA 3TZUA 3GTPH 3LE4A 1CKMA 4AQYQ 1K73C 2ITKA 3DLLA 4JI1Q 4TQUS 4QCLA 5LL6S 2M9VA 5IP9G 3HGBA 3T1YQ 4PZ8A 3VYSA 3NBHA 2R92H 4JI7Q 1L1OA 5CBEE 1SLJA 5C4HA 4DAVA 2AHOB 1C7YA 3FKIH 5IE8A 1SMYC 3OWFA 3J7YW 5H1SE 2DJGC 2M00A 1PZID 4A76A 4DV7L 1XMOL 4I7AA 3T53B 2B3GA 4KJNA 1VQ7A 3VR2A 1JJGA 1E3PA 3UI2A 2ZM6Q 3U4ZA 4JV5L 2YSFA 4A3GG 1JWUD 1CQFA 3CCQA 4TVAB 3S1QH 4EQNA 1EY7A 1VF7A 2JA7G 3H0GB 4H44C 4DNRB 1PYBA 2ICEC 3W3AA 1PH2A 2NVTH 4B9XA 2VXWA 2XTIA 5ELOA 2F0MA 2VQEQ 1G2SA 1Q8KA 4RA8A 2OQKA 2RKSA 1E22A 1FJGL 3OYYA 1MGSA 2F0HA 2J7ZA 1SYCA 4DR6Q 1PZKD 1TK7A 4DNIA 3B6YA 3UE0A 3M4OB 4A3LG 1KDCA 3SHLA 2DJFC 2UXCQ 3GTPB 1N34L 4R4IA 3NWTA 4OHJA 1ILPA 3J80L 1TWAH 1PFBA 4A3MH 3F8TA 3F1ZA 5D65A 2L12A 3WDNA 3VR6A 2JA5G 4F87A 4B3TQ 4V190 1YZ6A 1E1TA 1Q8IA 1E0BA 2CHBD 3KFUA 2FMMA 2KCTA 2KEDA 1PH6A 1GUTA 4PV1C 4YWKA 1JMQA 4DUYL 2Y8NB 4GNXB 2A68D 3A8IE 4BBRH 1LT6D 4G7HC 4JVZA 1N9WA 3NELA 4BY7H 5I2YA 2PZTA 1OXXK 5BN4A 3UDIA 3MAQA 4JC0A 2ES2A 3S2DH 1KNEA 4GKJQ 1SNQA 3EIVA 1UE5A 1E1OA 2XPAA 3CHBD 2R6GA 1Y1WB 2Q2TA 3PO3B 4NKLA 4PZ6A 1STHA 1F2YA 4A3JB 2G9DA 2UUAQ 4WORA 4L5SA 5C0XH 1LABA 1LT4D 4YIJA 3H91A 1KAWA 4CKEA 1X9NA 4PMWA 3JAME 4ULLA 1BBXC 1X32A 2ICIA 4H7BA 1TWCH 3STBC 1D5ZC 1TXYA 1GJXA 3HKZB 2L0CA 2LY7A 1KL9A 3SK6A 3K5LA 1WR7A 1KAAA 3RZOH 1MI2A 4LFAQ 2EXZA 2Z4HA 3CPFA 1TWFH 1V1PB 1WYDA 2A74C 5E4XA 1DOMA 1S40A 5GROA 4O1NA 3CC7A 3A7AB 2EYFA 2ZTDA 1CT1D 3HOVG 5C3EB 3KADA 3L7ZC 4JYAQ 1WTOA 5C44H 5TSSA 1HNWL 1F9RA 3CRLC 4LMQD 2F3IA 1LM0A 2OF1A 3FHWA 4DAYB 4AYBB 3CCJA 2A6ED 1Y8NB 5EKKA 2UUCL 3GTMB 1SNOA 4C3HH 2CH4W 1LO5D 1K28A 1FNWA 4DUZL 5IP9H 4UPAA 5FO7B 1BCPC 2DUDA 3NENA 2E2JB 5T1IA 4DXGA 4WJWA 2GN5A 5LMNL 3I70A 1MJCA 1IKMA 4BBRG 2OCEA 2WP8J 2QCPX 1NTGA 2D0OA 4K2LA 4TRDA 4AYBE 4ZRZA 2F0GA 3H0GH 2IWHA 5C4XB 5LMNQ 1N33L 2D0PA 2I5HA 3D6CA 4JK1C 2B2WA 3S14B 2ZQUA 2Z4IA 3OHXC 4DU9A 4ALPA 1ICWA 1EEID 3R2IA 2Q8RE 3C2PA 3VR5A 5LL6X 3KDFA 2DK1A 2K5DA 3C1FA 1GM5A 2GVAA 4C3IG 2RDHA 1VQCA 2B2TC 3SR1A 1M1KC 1X56A 3G48A 1I94Q 2L1BA 2E45A 2F4VQ 5IGCA 4PMCA 1H95A 4LF7Q 2YAJB 2F1MA 2GA4B 4FNFA 3T1YL 2F0IA 3M7NA 1G8ZD 2HCIA 5IYCH 5E1FA 3NSWA 5LMUL 1X55A 5FOBB 4FDBA 1JOKA 1SROA 2IHEA 4FP5D 3ODKA 2YTXA 5JEAH 4O42A 4OWTB 1CZWA 1CHQD 3VDYA 4DK0A 3Q8DA 1HQMC 1XX8A 4EGVA 3GTLB 1Y8PB 4IFDG 5CQ2A 1GOZA 2B2VA 3SVMA 4AQYL 2UU9Q 1B70B 2RSNA 1IYJB 1Q12A 4HCSA 1QVFA 1HPCA 4JBJA 1PV4A 5C5LA 3Q23A 1FLCA 3CQZB 2HHHL 5C3EG 4K8JA 3MC0B 1XMQL 3WOFA 4A3IG 3GTQB 4IJLA 2EYPA 2KJXA 1Y14B 2UUBQ 1VQPA 3M3YH 2AQ1B 1ZXTA 2UXBL 4IQZA 4PZ7A 2RE3A 1QWYA 3RD4A 2JK8A 1IBLL 4DV6L 3I4NG 4K0KL 3ND8A 3MXUA 5KNBA 4IOCA 3IL8A 5A35A 4FF4A 1X3FA 2SNSA 4A3JG 1E24A 2JA8B 5DAUA 3KJPA 4XTCS 1TT2A 1WVLA 1A3TA 3A7LA 3N52A 4A3KG 1Q1BA 1PH4A 3NQTA 2F0EA 3GDEA 1XMOQ 1EG4A 4R4OA 1D6EC 1NMVA 2A19A 2D9UA 2A5HA 4LF6L 2ZXPA 4QGUA 2ZM6L 2YU9H 3TBIB 1JJCB 4U86A 1QE6A 1Y1VH 1EQRA 3LKXB 3KAFA 3BVMA 4MHEA 3ULLA 2A8VA 1ASZA 3J80c 2L4JA 2J0TD 3PO2H 5FLXE 1PH7A 1T5XD 2A73B 3OPOA 2QEXA 3GTJH 4IUTA 1EY0A 3CCLA 4C2MH 4B3MQ 3E9IA 2XIWA 1PZJD 3TCZA 1I5FA 2YTYA 2WAQG 4QIBA 1SBBB 3QB3A 1I3QH 3T51B 5D3IB 5CV4A 2PZWA 3PUYA 3DEOA 2AWNA 4R9WA 4C3JG 1YNNC 1V1OA 1E7ZA 3J7ZC 2KOLA 3M4QA 4ZKCB 4KY6A 4A3BB 1KIXA 2V4DA 1ESFA 2NB0A 4I65A 3D4WA 1VQIA 3BVZA 3RLOA 4BY7B 1RIPA 1EYGA 4JI6Q 1BCPB 2VB2X 3AU7A 1YIJA 3F2UA 3C3LA 1YITA 3H09A 1KDAA 1FR3A 4C2MB 3GTKH 4NMZA 2NYZD 5GADC 2I5LX 4O2DA 1ENFA 3URYA 5T1GA 1T9HA 3W1GA 3NEMA 5CMDA 2L55A 5FJ8H 4EQPA 2JXWA 2V1CC 2EY6A 1I3QB 1X3PA 3HOUG 5GAHC 4K6DA 4CDDC 1DD2A 1Y1VB 4KD4A 3RMHA 2QW7A 4JI8Q 2NZHA 3V96A 1H9RA 2VL6A 4QB4A 4GKJL 1V43A 2HQLA 3FPPA 1QUQB 4A3CH 2PI2A 5COYA 4JI4Q 1RHPA 4KHVA 1SMYD 1PA6A 1U5KA 5M9OA 4GS3A 2XP6A 1YHQA 1BNZA 5IT9L 4OO1G 5M5YB 1RTNA 4ZLTF 2EY1A 4YCVA 4IPGA 3D6WA 4MNOA 4RAUC 4C1NK 2B29A 2F0OA 4A3DG 2HDLA 1NUCA 4K5XA 4JI3Q 2JA5B 1U4PA 4GLAC 1IW7C 4KHPL 1BKBA 5EPLA 3A5ZB 3NTIA 3GTOH 1AEXA 1X3QA 2XSCA 5C0XG 3WOEA 2UUCQ 4MZ9A 2OEOA 4ZYSA 2K6AA 1SJHD 2H1EA 5C3EH 3DHQA 3JAMc 4DFAA 1STEA 3SXHA 4REXA 1FNUA 4L63B 2Z1CA 4OXPA 2BA1A 4BBSH 3HOWH 1FD7D 5IYBG 1N36L 4G4KA 2ASBA 5I6WA 4OO1H 2K33A 2WAQB 1EUJA 4CJ2C 1I94L 3GTMH 4EQ5A 2RDFA 4FXKC 2JX8A 2LAJA 1YVCA 3IRBA 3EA6A 5C6AA 1EQQA 1Y69U 3A55A 3S1MB 4R1JA 1EFID 3U9SA 1W2BA 5AJ3L 2Q2UA 1IYUA 4KLKA 2WB1E 1VQGA 1EYDA 3I3CA 4JCVE 3BVGA 4DV5Q 3T16A 4LF5Q 4AH6A 3NTPA 2VUMH 3SK5A 1YJWA 2IPKD 1U4LA 4LAAA 2BCOA 1I50H 1NMGA 1QUQA 1WD1A 1PFSA 1NNXA 3DMUA 3M4PA 2JV4A 5IOCA 1I4PA 4LF5L 2K50A 1ESRA 1SE8A 3HOWG 2O4XA 2WB1G 4LF7L 3BDOA 4DF7A 4NPSA 2HHHQ 1KABA 2JE6I 3PO2B 3MEFA 1HXYD 3S2DB 5JJLA 1SXTA 1N33Q 4A3EG 4B3SQ 3Q6SA 3HOUH 2ZT9C 3RZDH 1HTPA 1VQJA 1HR0W 1F2ZA 4BY1G 3J7A5 1EIFA 3DUZA 4JBMA 2O5IC 2ZQTA 1SYFA 2CWAA 1Z7TA 4JI7L 1XYIA 3W1BA 1F2MA 1TWGH 4QUCA 4JG2A 1UAPA 3NQIA 2R3ZA 3TP8A 3TS2A 2B2WC 5C5MA 4F88A 2K03A 2PCFB 1EOVA 1HFNA 2EYLA 4UDUC 5IYDG 1VQEA 2EZ5W 1BCPF 2NUCA 1K9RA 1QNUA 5KRUA 3JAMi 4A3BG 4Y7NB 3ND9A 3FKIB 2K75A 1WCMH 3HOXG 3W2DA 3K0YA 1NR4A 1QCBD 4HIKA 2K5WA 1Z47A 4TKOB 4RGTA 1MSGA 4N9PA 4BA1I 1K0RA 2IHFA 3NXWA 3S15H 5JJKA 1I4XA 1O7YA 2XVSA 3DWPA 3M3YB 3J80E 4ZAIA 1U4RA 3KF8B 4ZCKA 2MHVA 4C3HG 2IT1A 2N49A 3T1HQ 5DM73 2LMCB 2PYKA 3GTOB 3M85A 1LTTD 1GUNA 5EBCA 2JXMB 4XT1B 4O0AA 3LKXA 1Y1VG 5J22A 1GKHA 4IUUA 2D62A 1CFMA 1PVOA 1C4QA 4GZYC 1I4HA 4JI0Q 4X3KA 5C4JB 4WJ3M 4LW1A 5DEHA 3I4MH 2ZR6A 2HD3A 2F52A 4LUZA 4R8IA 1CSPA 4MTKA 4QUFA 3GQBA 3FSBA 1STYA 3HS0C 3GD7A 4K6LA 3CMAA 1HH2P 5KEEA 3LGJA 4HSPA 1RP5A 5JPMC 3P75A 4R8NA 1CKNA 1B9MA 3K58A 1V8QA 1QB5D 2UXCL 3TP6A 5JEAJ 1B2TA 1STGA 4NDXA 1ET9A 2H4OA 2WIIB 3LNNA 2RA4A 3K5MA 1SMXA 1B9NA 3QWNA 1TKWB 3HOZG 1PINA 2NN6G 3CQZH 2KCNA 2XNAC 5NUCA 3FS8A 4RFBA 3OOCA 1JC7A 2P5ZX 1WFQA 3BZDB 1XJVA 3STBD 3TRZA 4A3KH 4HMIA 3G6EA 3KBXA 1XTDA 5M3MG 1K8MA 3R2TA 3U4VA 3D31A 3NUCA 1IL2A 4CJ1B 3J81E 1YNND 3QO2A 3I4NB 4C3IB 4U673 2SOBA 5JOBA 4YY3Q 3S16B 4IFDI 3CCVA 2B39A 4DV0L 1NSNS 1Z6HA 3OIQA 4LUVA 1GD7A 3D8GA 4DK6C 1PRTF 2BDNA 5IGGA 1LTLA 2Z9HA 5J39A 1PDQA 3I7FA 3DM1A 2JN4A 5EBDA 1KRTA 3AB9A 3HOYB 4A3LH 2YSIA 1B1ZA 1PTOH 2MO1A 4ZK9B 3PV0A 2WKDA 4BXXG 3H0GG 4JI6L 4ID6A 4XQNA 4BA2I 5CV6A 3TC5A 4IURA 1VQAA 1O7ZA 5D14A 1LTSD 1VCIA 1YI2A 1OXVA 4RKLA 3TSSA 1SAPA 1K9MC 4XYQA 2R92B 2AQ3B 1EL0A 1VQFA 2E2HH 4XQQA 1WTRA 1G91A 1QVCA 3RN5A 2B2UA 3PCOB 2E2IH 4ILWA 1O7LA 3MTSA 4A3FB 5IODA 4KHPQ 3H94A 3HKSA 1A3VA 3P1HA 1C0AA 1HR0Q 1WTPA 1JE5A 2CH4A 4TSSA 2F21A 1EEFD 3X3MA 4M1UB 2EPBA 1STNA 3ER0A 1HA6A 4DV1Q 4CKBA 3NBHB 4DR1L 2VS1A 2JEAI 3BU2A 1EG3A 4WFN3 1QILA 1HR0L 2RCFA 4IOAA 2KCCA 1YHBA 1S72A 5IP7G 1HUMA 1GHKA 3U9OA 2K5VA 2PMZB 4DN4M 2CKZB 2NBFA 4X62L 2WAEA 2HIXA 2NN6I 3KLRA 1SDFA 4EQOA 5CYUA 3CCSA 2IX3A 1PRTB 4DV3L 5IT9E 2LXJA 1VQ9A 2YU9B 4NXNQ 2EYOA 2F4IA 4DR4Q 1SYGA 3DXJC 2KBNA 4CKCA 4U85A 4JBWA 1HTLD 3BZKA 1F77A 2EZVA 4A3EH 2IW3A 2PMZE 4XQJA 3FVQA 1NMFA 2ATWA 3TP5A 2JA8H 2JYOA 3AQQA 1VQDA 3MFYA 1GUSA 5EAYA 4FF2A 3D0FA 5AJ3Q 2EJGC 4LF4Q 2YSGA 5M5WB 2ZR4A 1B7YB 4HN7A 3ULJA 3Q0AA 1ILQA 2Y0SG 3A5UA 4ZKBB 1K9QA 1TWCB 1MBYA 1SE2A 2HCCA 3H3VH 1GUOA 3MCBB 1IBKQ 1R9TB 2MP1A 1O6WA 3SK8A 5EQ0A 5EJWA 2N55A 1UNSA 3ERSX 4CDFC 1HQRD 5E5WA 3RZDB 1UE1A 2ALYB 3CRKC 1R4QB 1PH8A 4KKUA 1AE3A 3G7LA 3SEBA 2NN6H 5IGFA 1EY5A 3IFDA 2SEBD 2KEEA 4XXEA 3MXNA 4A3FG 1IBLQ 1NJIC 1A63A 1KC8C 3S1NH 2UU9L 1VQMA 2F0NA 4G57A 4B3RL 4KHZA 1LTRD 1IW7D 2QGQA 3U50C 4CBVA 4DV7Q 1WMVA 2I07B 1B50A 2C9OA 1YJ9A 1X3GA 4DR2L 1FJGQ 3JC66 4J6HA 3TN2A 2NTTA 4IPCA 5IGBA 4DXFA 5CV5A 3E5SA 5IGEA 2MJ8A 2PI2E 4JV5Q 2UUBL 4IALA 4C3IH 4APVA 4DGZA 1C8CA 2QRVA 2F0KA 4HTHA 5HURA 2NVYH 4OGQC 1GUGA 1EQVA 2B2TA 3T1HL 2K14A 4BBRB 3P20A 2DNCA 1AE2A 5C4JH 4K5WA 1PH3A 2WV6D 3QJYA 1WI5A 4IN3A 3S17H 2F0JA 5DLQE 4B3TL 1IHZA 1LLRD 3I4MG 1E2ZA 2PO4A 4GNXC 4A3GH 2EIFA 4KK7A 3EROA 4X66L 4JI0L 4JI2L 1EWHA 1KLUD 2RDGA 1I4QA 3J81j 3N6RA 1B3QA 3A56A 5IWAQ 4MTNA 3BG3A 2MUYA 1TR8A 4HMJA 3RLFA 4DR6L 1XXGA 2NTSA 2JA6G 3V2TA 4B3ML 1K83H 2Q2HA 4KY5A 2A68C 1J5EL 1F9SA 1TWGB 1WTHA 1V1PA 4BY1B 2E2HB 4HIDA 3OIPA 5BR8L 1UEBA 2EVBA 4LK1C 1EU3A 4LF9Q 4PQXA 4PNYA 1AH9A 4P71A 1SYEA 1D5XC 3CAMA 4A93H 3MXNB 1AFPA 2Q5AA 1TIID 2K5QA 4DV0Q 5JPNC 2L5TA 2L15A 1XPUA 4OX9L 5LMNW 2ZJRA 3HRZC 1G6ZA 1RODA 1A8VA 1LV9A 5KNCA 5BN5A 4F8MA 2J4XA 2MQHA 1UE7A 4LJZC 3CC2A 2ZXOA 3R93A 5G3LF 3SE0A 2EY2A 2HQEA 1KRSA 1BBWA 5GAGC 3GTJB 2F0TA 2B8GA 2QF7A 4KI0A 1WTVA 1GHJA 4XT3B 1MHWC 2E2DC 4DR5L 4YY3L 1TS2A 5IYBH 1HCZA 2I0QA 3S17B 2O2LD 2XP3A 2FFKB 2WINB 2JA7B 2B63B 1MKHA 2L9HA 5J3BA 1CKOA 2XPBA 4PG3A 1EIHA 3CP0A 1KD1C 1YNJC 2Y0SE 1CHPD 4LUOA 1S5FD 1W6JA 3K5OA 3PO2G 4Y7NH 2EDGA 2EE1A 4ABNA 4DR5Q 2QEJC 1K83B 3S2HB 4GKKL 4IFDH 2ZQVA 2AUJD 3BDCA 3NK9A 4OELB 1NE3A 2H5XA 1KDBA 4OIKA 2VUMB 4FXGC 1AW7A 1SYDA 1TQOA 3VYRA 1VQKA 2NWGA 3KJOA 2X6GA 3HOZH 1JT8A 2G5DA 5KIXA 4DR1Q 1P16A 1D8LA 4JW0A 4GKKQ 2WKCA 3K6OA 4HR7B 3E0JA 5ELFA 4A3CG 2XWBB 5M3FG 4JI5L 3L0OA 2Q8TA 3ITPA 2VB3X 4Z9CB 4A0UA 3KCEA 4P72A 1EY6A 1HNXL 3VYUA 3ZYYX 5C3WA 1RCVD 2NVQH 1RL2A 2A6HD 2JEBI 2K01A 4QMGA 1LTBD 3A54A 3AMUA 5E62A 3E9HA 1G6PA 1ONLA 4MIUA 1JJ2A 1XWEA 4GNXA 1FGUA 3ERQA 4LF8L 4DV4Q 1SNMA 4DV1L 1Y8OB 3MVVA 1SFOB 1SSOA 1B3AA 3M7GA 3S1NB 1JB3A 5FLXL 2ZAJA 4MN3A 1X3EA 2D2CC 3GTLH 2OTLA 4A3MB 3FMCA 2PNHA 1CTMA 4FO2A 5CV9A 2LSSA 1QVGA 1FVIA 1KLGD 3DM3A 4L8JA 1MSHA 2QILA 2K52A 1DM0B 3TMEA 4HSVA 4EX5A 2KCMA 2R7ZH 2DY8A 4RWSC 4PMBA 1BUVT 1JB7A 1FYCA 2R93G 4IPDA 1FL0A 1S4ZA 4R4QA 5I9OA 1IBKL 2VQFQ 3IKJA 4LFCL 5FLMG 3ULPA 3SDZA 3HOYG 4UP8A 5IY0A 5LHY1 4HJAA 1DYQA 2F3WA 2NVTB 2PNRC 3PUWA 4KTAA 2ZQSA 2B63G 3D3RA 3FRPB 3TREA 3VR4A 3MCBA 3PIOA 3I91A 1KXLA 2E74C 2JA5H 4OIJA 4A75A 1H9SB 2R93H 1MJEA 5I9PA 1DZ1A 3LX0A 1ENAA 5D3DA 2JA9A 5IT9c 5GAEC 4CDEC 1SNDA 1HZ9A 3Q24A 4DR3Q 4FYDA 4K0KQ 3PF4A 3KK7A 1O78A 4WJ4A 1EQTA 3VA5A 4KMUC 5EKLA 3MWYW 4AYBG 3RN2A 1JQYD 2AKWB 5E65A 3HG9A 2JMFA 4A3DB 3EVQA 4HJ5A 3KYHC 4XYOA 3PUZA 1BQQT 3J80i 4RHRA 1JICA 1JOQA 2OT2A 1WTWA 3AEVA 1A62A 2E76C 4Q0FA 2F03A 5M5XB 4ME3A 3SGIA 2UXBQ 4DK3C 1O80A 1K8OA 4FF1A 1ZCNA 5AFWA 2Q2IA 3OOBA 2MGSA 1HNZQ 2ZTEA 2YYZA 1PH1A 3J81c 1YNXA 4QL5A 4H0LC 2CQOA 2RBMA 5C4XH 1B53A 3K59A 4IUVA 1I6HB 3PQIA 5FKAC 1UUPA 1M4VA 3KF8A 3W5OA 3HKZG 3EBEA 1IKLA 1SNPA 4Q5VA 1PTOD 4L5TA 2JP1A 1W6KA 2EXDA 1D5MC 1C48A 4GOPA 1KNAA 4ODGA 3KLSA 1N8RC 3NE5B 1N34Q 2R92G 3BS1A 1PTOF 1I5HW 4JI2Q 3OWEB 5KYIA 1K0SA 2R7ZG 4JPBW 4LF6Q 1H9SA 5IGDA 4IFDJ 1D1KA 1LTID 4A3JH 3I73A 3I4LA 2HT1A 2XP7A 1EFWA 2PQEA 1M90C 4CJ0B 2VQEL 5C0XJ 4YWLA 3PUVA 2IJ0A 2EJFC 2CFMA 1EWIA 1OXTA 3HOWB 1SE3A 2XP4A 2KENA 2VW9A 1BF4A 2E5LL 5BR8Q 3KABA 2B2YC 3K0XA 3D4DA 2B2VC 4BS9A 4A3EB 1QG7A 4IPHA 1PMRA 3TDBA 2EYHA 5EPJA 2YV5A 3WWVA 1EYCA 1TWFB 2O5JC 4A3IH 1MD2D 2YTVA 3CU7A 2DJYA 2F0VA 1VS0A 3G4SA 1PH5A 5HGQA 1PRTC 4DKAC 4DA2A 1L0XB 1A3UA 1BBUA 3TP7A 3K7AH 3OMGA 4DUYQ 1EOTA 3PSIA 4P73A 4NB3A 3K57A 3TEHB 3BDLA 1TR5A 4OWWB 1PHJA 3UE1A 4IO9A 4LF9L 2WACA 2F0QA 1QZGA 3CD6A 1J9OA 4X65L 3FKIG 1QOHA 1EU4A 3HOXB 3CF5A 1WTQA 1JCKB 1OO9B 2XP5A 3T13A 1VQNA 5IYCG 3X3NA 1ZYRD 3HFZB 2MNAA 1JWMD 3AFPA 2JJQA 5CC4A 3S9WA 1SEBD 4N9TA 1PYWD 2F0UA 4QF4A 4GN3B 1J6QA 4YCWA 5ELEA 1K8GA 3GTGH 5CBAE 2DNEA 1C9OA 4QQBX 4NXML 2NVXB 2EOTA 1VQ6A 1TS3A 3K80C 3S14H 4DR7Q 3S1MH 2XWJB 5GQOA 3HZXA 3RR5A 5E4WC 2CVRA 4H13C 1A15A 2K7VA 1WOCA 4R4TA 5DNFA 4B08A 1EYAA 3J7AV 1Q86C 3R3OA 4C1NI 3CXCA 4V0BA 1IZ6A 4ZUIA 1ENCA 2SNMA 1HHVA 3KAHA 3GV3A 2K5NA 1DJRD 2EY5A 1Q82C 3SK4A 1RDPD 2F0PA 4M8AA 2F0FA 3L9AX 4A3GB 3A74A 1Q46A 4UP7A 2AMCB 4X6AH 3A8KE 4A0TA 1VQ8A 1XNQL 2F0SA 2K28A 2N88A 4LF8Q 4XDXA 2QA4A 2VNUD 5BN3A 1XPRA 4NW2A 5C3XA 1A2TA 5ELCA 5CR3A 4QJFA 5ISRA 2M8IA 1II3A 4BBSB 4U84A 1L0WA 1STAA 2DK7A 3OMCA 4ZQ3A 2IX0A 1L0YB 1CM9A 1GUWA 3HOVH 3MXGA 2PPBC 2BE5D 1AZQA 3BJUA 3UDGA 3FP9A 3QG1A 3KAIA 1GXDC 3KLSX 4N8FA 4L5RC 1F2LA 5C44G 3DWQA 4X3UA 4POGA 1I50B 4GN4B 4LWCA 5EGTA 1KQSA 3NTKA 1LT3D 2PW5A 5JAVA 1CKNB 3E0EA 3KF6A 3RUZA 4P74A 4BXXH 1Q81C 5FO9B 1EIYB 4LFCQ 4RCNA 1OXUA 5M5XH 5CV7A 1SRUA 4DV3Q 1UEAB 4KD3A 3QOLA 1X65A 1EZ8A 1ASYA 5HY6A 1STBA 4DR4L 1H9JA 5CORA 4N8X1 1WCMB 3I90A 3K5NA 5JVH3 3T4AC 2VZAA 4DV2L 2F4VL 1HRJA 2LXKA 4E5RA 2XN9C 3I2ZA 1ML0D 2K4KA 3PGZA 4IUPA 5M5WH 1Q7YC 3J7AF 3EQLC 1JOOA 1D7QA 5M3MH 1DONA 3L3OC 3I8ZA 2M2LA 3NWSA 5ELDA 2WAQE 1R4PB 3S2HH 1RKNA 5G3LD 2XRSD 4B3RQ 1Y1WG 1A2UA 2ZJPA 2KQ3A 3PO3G 3S1RB 2FINB 1T5EA 2UXDQ 1Q1EA 2Z6KC 3EN2A 4BY7G 1SYBA 4IUQA 3HOVB 4DV6Q 3PMFA 4ZUJA 3OW2A 2E2JH 1IBMQ
chains in the Genus database with same CATH topology
4OL7A 3KUPA 3Q22A 4POFA 4KY7A 5IYDH 4DPGA 4NP5A 1U0LA 1HNZL 4I7ZC 1YNJD 1ZKOA 2I46A 4L5QA 4J8QA 4B9WA 4S3SA 2RF4A 1DOLA 1IBML 4RMFA 4LFBQ 2E8GA 2RQXA 2B2YA 1HFGA 2K05A 1CZGA 1ZEQX 3PIP3 1CSQA 3ONAB 1B4OA 2K04A 2E75C 4GLXA 3QIAA 1YHAA 1K8AC 1U4MA 2E2IB 2F3VA 4LFBL 1E2WA 1SN8A 4X3TA 2QKIC 4G7OC 1KTKA 3MXPA 2MDIA 2K1BA 5K5PA 1WD0A 2AQ2B 4UY8C 2X6LA 3GP7A 1PYSB 4CHTB 1H9MA 1BVSA 3OW7A 2KXQA 1G2TA 2JA6H 2CQAA 2EYMA 3BYTB 3CKIB 1EY4A 4DK1A 1GVPA 2PZUA 2RCNA 1S5CD 3T56B 3R8BA 5I4DA 5FLMH 2OTJA 3H3VI 1PTOB 3L4HA 3K7UC 4RGMA 1WTXA 5E3FA 3CCMA 4U68A 3EJIA 3CC4A 1JE4A 5KNDA 2NVYB 4P2CB 1S3OA 1IXRA 4A4IA 5CGKA 4LNQA 1CUKA 4UP9A 1S5BD 1DOKA 2LKVA 4OX9Q 2R61A 2R93B 1TWHB 2DY7A 4P75A 5E66A 4A3IB 1CI3M 4WRDA 4RCOA 2R7FA 4QIWE 2RHQB 4X65Q 3NPPA 4JI8L 3MFGA 4X64L 1F8AB 3CW2C 4OO1I 1JMCA 2WB1B 1U9RA 2FJ2A 2EQSA 1XNRQ 1NAPA 2HIVA 3NP8A 1UE6A 2NZ1D 4X64Q 1B8AA 3RZOB 3H15A 4GOPC 1FNVA 3OTOQ 2R7ZB 2YSBA 3TZDA 2XP8A 5C0XI 5IP7H 2Q8IB 2DWVA 3PF5A 2MFIA 3BZCA 2EJMA 4DAMA 1XNRL 4HCEA 3AFQA 1XTCD 2CW0C 2OXPA 2JQOA 5JJIA 2BH8A 5JJZA 3GTGB 3I4MB 1MIUA 4H02A 1VQLA 4YWMA 1DXMA 2DMVA 2CWPA 3PIO3 3OTOL 5JVG3 2ZJQA 4JBKA 4C3JB 2IX1A 4DV4L 4JYAL 2WADA 1V9PA 4X62Q 2KVMA 4JI4L 1CA6A 2OWOA 1LACA 4R4CA 1I4RA 5KYLA 4NXMQ 3M4YA 2IY5B 1VQHA 4JI5Q 4DR7L 3IAYA 2RVLA 5FO8B 2JA8G 4ME5A 4DUZQ 2DGYA 2HDMA 1BXTA 1HNXQ 2KHSA 2ZTCA 3RNUA 4K14A 2KHJA 2QDBA 3GTKB 1S5DD 1XPOA 1NR2A 4A93B 3F2BA 4DV5L 3OSOA 1VMPA 4C3HB 4A3DH 3NTHA 3KAGA 4HJ8A 1V1QA 3S1QB 3CCRA 1DGSA 1H9KA 3AYHB 4F7XA 1RF2D 2CCZA 1TS4A 2L11A 5EKIA 4JI1L 3IFTA 1RJTA 3FEWX 1XNQQ 1D2BA 4E6IA 3P7JA 4OWXB 4K8IA 4NXNL 1L2FA 2BA0A 2YSHA 4FVMA 1DCZA 1I4GA 4L6TB 4XIGS 1HJPA 1NY4A 4OONA 3E6ZX 5E64A 1EY8A 4HAEA 1PFMA 3ZJYC 1YW5A 3PQHA 1OTCA 2NVXH 1X6OA 2UXDL 2B63H 5FJ8G 2TMPA 1PRTD 3HOUB 2N3SA 4AIMA 5CV8A 2VQFL 1D1IA 4HIOA 5LMUQ 1P8LA 3TQYA 2NVQB 4DAPA 1PXUA 3BYYB 1HZCA 1G51A 2C35B 1IL8A 2VUMG 1X54A 3KBGA 1L1OC 2PQAB 3HOXH 4DR2Q 4G7ZC 3I56A 5F2DA 2MO0A 4HIMA 3VYTA 5K36H 4RGNA 2K5HA 4B3SL 1SJED 3F2DA 2ID0A 1WJJA 1HZAA 5ELNA 2TSSA 4EVOA 3MHBA 1JWSD 3RLNA 4K5VA 2SDFA 1IYVA 3TDQA 2AUKA 1EY9A 3MEHA 4DR3L 3KLWA 3DEPA 5KGUA 2M3OW 4BBSG 3FPUB 4FXDA 1A6XA 2BE5C 1I6VC 1F9QA 4BY1H 2X69A 5I6YA 4X66Q 3HEJA 4Y52H 2N78A 1JR0D 5IWAL 4RG1A 2LFNA 2IL8A 1GO3E 3I72A 1QJOA 3O13A 1JORA 5AHTA 2HUGA 1BO0A 4KJOA 1YBYA 2G9HD 3K8AA 5C4XG 5C44B 3QOJA 3GTQH 1PH9A 1J5EQ 4JOIC 1FGBD 2N8NA 3LWUA 5M3FB 1LUZA 1TWAB 1TU2B 2PW7A 1NCVA 1UWVA 3S24A 5J1ZA 4DAYA 2AWOA 1LYLA 3G6JB 3VR3A 2GVBA 3MQHA 4CGYB 2F0LA 2D5DA 3LWEA 3PO3H 1PLFA 5DM63 3D4RA 3WH0A 1VF5C 2VY3A 3TS0A 2MPMA 1HZBA 4QIWB 4RHSA 2OQ0A 3H3VC 1W3SA 2A6HC 1WCMG 2F0DA 3J81L 2PQAA 1HA5A 1TY0A 1AN8A 2M8JA 4YCUA 2L4NA 3U58A 1CA5A 5C4ZA 5FK9C 1I6HH 4A3MG 1OXSC 1R9TH 2A69C 3CCEA 2DN8A 1YEZA 3VA7A 2A6EC 1RTOA 2KHIA 1LTAD 4KN4C 1O7IA 2R7DA 2A1AA 3NBIA 1VDZA 3NHHA 2E5LQ 3K7AB 3MA2B 5K36G 4RGOS 4A93G 1NBWA 4C56C 3G71A 3CMEA 3HOYH 1VQBA 1CQVA 1RD9D 2B2UC 1PFNA 3CPWA 1VQ4A 2XRQD 1J8IA 2B8FA 2FMCA 3UDXA 2Z6KA 2WFWA 2JA7H 4UAIA 4KN7C 5JEAG 2KA7A 3FSCA 3JAML 4BWGB 2F0WA 4A3BH 4K2KA 2JSOA 1QNKA 2FHTA 2Z8LA 4IZ8A 4GLVB 1BDOA 1ET6A 4A3KB 1VMCA 4LFAL 2BOSA 5HGTA 3M4OH 3EFXD 4GN5A 3A8JE 3HP3A 2Y0SB 1K3RA 4IUNA 4HJ9A 1SE4A 5E7NA 1B44D 1BR9A 2UUAL 2ENBA 5IIFA 2RHSB 1BCPD 1VQOA 4J1MA 4C3JH 3H6MA 2XP9A 5A2QE 2JA6B 3K81C 1HNWQ 1N32Q 3ICEA 3S16H 3S15B 3J81i 1LTGD 1TVXA 1TY2A 4JOIA 4A3FH 2I5MX 1SR3A 4FF3A 3C46A 3GV6A 3MQGA 2RSOA 2BH2A 4KKSA 4QY7A 4JI3L 1PTOC 1N32L 2ZXRA 1G291 4J15A 1AP0A 2KUMA 1LT5D 1L1OB 1YJNA 5M3FH 5M3MB 4RH6A 1HUNA 3A0JA 5A2QL 2XGTA 1N36Q 1E2VA 1Y1WH 4X3SA 3L2PA 1F9PA 1M8AA 4HEDA 1EZ6A 1SFOH 2C5CA 1BOSA 1Q3LA 3MZ5A 3HKZE 5ELBA 3CCUA 3C1EA 4IJHA 4KKTA 3HOZB 4YHHQ 2KECA 2K32A 1TWHH 4HJ7A 3GO5A 1QZHA 1Z9FA 2LS01 2BDOA 5FLXc 4RKBA 2FXQA 5U47A 3PUXA 3M9BA 1KHIA 3I4NH 4YHHL 3I55A 2ZR5A 3KDFB 1VQ5A 3V05A 1AZPA 2A69D 3DWAA 3FDTA 1EWCA 3KF6B 1XMQQ 4LF4L 3S1RH 1S5ED 4DV2Q 4DNTB 2CW0D 3F2CA 1ZYRC 4GOPB 1Q90A 1A0IA 3PIPA 1CK1A 5I2XA 2NZOA 3KOJA 3UDFA 4KV6A 1TS5A 5EPKA 2EYJA 2Z0SA 3I4OA 1SNCA 5M5YH 3CNGA 1EIGA 3TZUA 3GTPH 3LE4A 1CKMA 4AQYQ 1K73C 2ITKA 3DLLA 4JI1Q 4TQUS 4QCLA 5LL6S 2M9VA 5IP9G 3HGBA 3T1YQ 3VYSA 4PZ8A 3NBHA 2R92H 4JI7Q 1L1OA 5CBEE 5C4HA 1SLJA 4DAVA 2AHOB 1C7YA 3FKIH 5IE8A 1SMYC 3OWFA 3J7YW 5H1SE 2M00A 1PZID 4A76A 4DV7L 1XMOL 3T53B 2B3GA 4KJNA 1VQ7A 3VR2A 1JJGA 3UI2A 1E3PA 2ZM6Q 3U4ZA 4JV5L 2YSFA 4A3GG 1JWUD 1CQFA 3CCQA 4TVAB 3S1QH 4EQNA 1EY7A 1VF7A 2JA7G 3H0GB 4H44C 4DNRB 1PYBA 2ICEC 3W3AA 1PH2A 2NVTH 4B9XA 2VXWA 2XTIA 5ELOA 2F0MA 2VQEQ 1G2SA 1Q8KA 4RA8A 2OQKA 2RKSA 1E22A 1FJGL 3OYYA 1MGSA 2F0HA 2J7ZA 1SYCA 4DR6Q 1PZKD 1TK7A 4DNIA 3M4OB 3B6YA 3UE0A 4A3LG 3SHLA 1KDCA 2UXCQ 3GTPB 1N34L 4R4IA 3NWTA 4OHJA 1ILPA 3J80L 1TWAH 1PFBA 4A3MH 3F8TA 3F1ZA 5D65A 2L12A 3WDNA 3VR6A 2JA5G 4F87A 4B3TQ 4V190 1YZ6A 1E1TA 1Q8IA 1E0BA 2CHBD 3KFUA 2FMMA 2KCTA 2KEDA 1PH6A 1GUTA 4PV1C 4YWKA 1JMQA 4DUYL 2Y8NB 4GNXB 2A68D 3A8IE 4BBRH 1LT6D 4G7HC 1N9WA 3NELA 4BY7H 5I2YA 2PZTA 1OXXK 5BN4A 3UDIA 3MAQA 4JC0A 2ES2A 3S2DH 1KNEA 4GKJQ 1SNQA 3EIVA 1UE5A 1E1OA 2XPAA 3CHBD 2R6GA 1Y1WB 2Q2TA 3PO3B 4NKLA 4PZ6A 1STHA 1F2YA 4A3JB 2G9DA 2UUAQ 4WORA 4L5SA 5C0XH 1LABA 1LT4D 4YIJA 3H91A 1KAWA 4CKEA 1BBXC 3JAME 4PMWA 4ULLA 1X9NA 1X32A 2ICIA 4H7BA 1TWCH 3STBC 1D5ZC 1TXYA 1GJXA 3HKZB 2L0CA 2LY7A 1KL9A 3SK6A 3K5LA 1WR7A 1KAAA 3RZOH 1MI2A 4LFAQ 2EXZA 2Z4HA 3CPFA 1TWFH 1V1PB 1WYDA 2A74C 5E4XA 1DOMA 1S40A 5GROA 4O1NA 3CC7A 3A7AB 2EYFA 2ZTDA 1CT1D 3HOVG 5C3EB 3KADA 3L7ZC 4JYAQ 1WTOA 5C44H 5TSSA 1HNWL 1F9RA 3CRLC 4LMQD 2F3IA 1LM0A 2OF1A 3FHWA 4DAYB 4AYBB 3CCJA 2A6ED 1Y8NB 5EKKA 2UUCL 3GTMB 1SNOA 4C3HH 1LO5D 1FNWA 4DUZL 5IP9H 4UPAA 5FO7B 1BCPC 2E2JB 2DUDA 3NENA 5T1IA 4DXGA 4WJWA 2GN5A 5LMNL 3I70A 1IKMA 1MJCA 4BBRG 2OCEA 2WP8J 2QCPX 1NTGA 2D0OA 4K2LA 4TRDA 4AYBE 4ZRZA 2F0GA 3H0GH 2IWHA 5C4XB 5LMNQ 1N33L 2D0PA 3D6CA 2I5HA 4JK1C 2B2WA 3S14B 2ZQUA 2Z4IA 3OHXC 4DU9A 4ALPA 1ICWA 1EEID 3R2IA 2Q8RE 3C2PA 3VR5A 5LL6X 3KDFA 2DK1A 2K5DA 3C1FA 1GM5A 2GVAA 4C3IG 2RDHA 3SR1A 2B2TC 1VQCA 1M1KC 1X56A 3G48A 1I94Q 2L1BA 2E45A 2F4VQ 5IGCA 4PMCA 1H95A 4LF7Q 2YAJB 2F1MA 2GA4B 4FNFA 3T1YL 2F0IA 3M7NA 1G8ZD 2HCIA 5IYCH 5E1FA 3NSWA 5LMUL 1X55A 5FOBB 4FDBA 1JOKA 1SROA 2IHEA 4FP5D 3ODKA 2YTXA 5JEAH 4O42A 4OWTB 1CZWA 1CHQD 3VDYA 4DK0A 3Q8DA 1HQMC 1XX8A 4EGVA 3GTLB 1Y8PB 4IFDG 5CQ2A 1GOZA 2B2VA 3SVMA 4AQYL 2UU9Q 2RSNA 1B70B 1IYJB 1Q12A 4HCSA 1QVFA 1HPCA 4JBJA 1PV4A 5C5LA 3Q23A 1FLCA 3CQZB 2HHHL 5C3EG 4K8JA 3MC0B 1XMQL 3WOFA 4A3IG 3GTQB 4IJLA 2EYPA 2KJXA 1Y14B 2UUBQ 1VQPA 3M3YH 2AQ1B 1ZXTA 2UXBL 4IQZA 4PZ7A 2RE3A 1QWYA 3RD4A 2JK8A 1IBLL 4DV6L 3I4NG 4K0KL 3ND8A 3MXUA 5KNBA 4IOCA 3IL8A 5A35A 4FF4A 1X3FA 2SNSA 4A3JG 1E24A 2JA8B 5DAUA 3KJPA 4XTCS 1TT2A 1WVLA 1A3TA 3A7LA 3N52A 4A3KG 1Q1BA 1PH4A 3NQTA 2F0EA 3GDEA 1XMOQ 1EG4A 4R4OA 1D6EC 1NMVA 2A19A 2D9UA 2A5HA 4LF6L 2ZXPA 4QGUA 2ZM6L 2YU9H 3TBIB 1JJCB 4U86A 1QE6A 4MHEA 1EQRA 3LKXB 3KAFA 3BVMA 1Y1VH 3ULLA 2A8VA 1ASZA 3J80c 2L4JA 2J0TD 3PO2H 5FLXE 1PH7A 1T5XD 2A73B 3OPOA 2QEXA 3GTJH 4IUTA 1EY0A 3CCLA 4C2MH 4B3MQ 3E9IA 2XIWA 1PZJD 3TCZA 1I5FA 2YTYA 2WAQG 4QIBA 1SBBB 3QB3A 3T51B 1I3QH 5D3IB 5CV4A 2PZWA 3PUYA 3DEOA 2AWNA 4R9WA 4C3JG 1YNNC 1V1OA 1E7ZA 3J7ZC 2KOLA 4ZKCB 3M4QA 4KY6A 4A3BB 1KIXA 2V4DA 1ESFA 2NB0A 4I65A 3D4WA 1VQIA 3BVZA 3RLOA 4BY7B 1RIPA 1EYGA 4JI6Q 1BCPB 2VB2X 3AU7A 1YIJA 3F2UA 3C3LA 1YITA 3H09A 1KDAA 1FR3A 4C2MB 3GTKH 4NMZA 2NYZD 5GADC 2I5LX 4O2DA 1ENFA 3URYA 5T1GA 1T9HA 3W1GA 3NEMA 5CMDA 2L55A 4EQPA 5FJ8H 2JXWA 2V1CC 2EY6A 1I3QB 1X3PA 3HOUG 5GAHC 4K6DA 1DD2A 1Y1VB 4KD4A 3RMHA 4JI8Q 2NZHA 3V96A 1H9RA 2VL6A 4QB4A 4GKJL 1V43A 2HQLA 3FPPA 1QUQB 4A3CH 2PI2A 5COYA 4JI4Q 1RHPA 4KHVA 1SMYD 1PA6A 5M9OA 1U5KA 4GS3A 2XP6A 1BNZA 4OO1G 5IT9L 5M5YB 1YHQA 4ZLTF 1RTNA 2EY1A 4YCVA 4IPGA 3D6WA 4MNOA 4RAUC 4C1NK 2B29A 2F0OA 4A3DG 2HDLA 1NUCA 4K5XA 4JI3Q 2JA5B 1U4PA 4GLAC 1IW7C 4KHPL 1BKBA 5EPLA 3NTIA 3A5ZB 3GTOH 1AEXA 1X3QA 2XSCA 5C0XG 3WOEA 2UUCQ 4MZ9A 2OEOA 4ZYSA 2K6AA 1SJHD 2H1EA 5C3EH 3DHQA 3JAMc 4DFAA 1STEA 3SXHA 4REXA 1FNUA 4L63B 2Z1CA 4OXPA 2BA1A 4BBSH 3HOWH 1FD7D 5IYBG 1N36L 4G4KA 2ASBA 5I6WA 4OO1H 2K33A 2WAQB 4CJ2C 1EUJA 1I94L 3GTMH 4EQ5A 2RDFA 4FXKC 2JX8A 2LAJA 1YVCA 5C6AA 3EA6A 3S1MB 3IRBA 1Y69U 3A55A 1EQQA 4R1JA 1EFID 3U9SA 1W2BA 5AJ3L 2Q2UA 1IYUA 4KLKA 2WB1E 1VQGA 1EYDA 3I3CA 4JCVE 3BVGA 4DV5Q 3T16A 4LF5Q 4AH6A 3NTPA 2VUMH 3SK5A 1YJWA 2IPKD 1U4LA 4LAAA 2BCOA 1I50H 1NMGA 1QUQA 1WD1A 1PFSA 3DMUA 3M4PA 2JV4A 5IOCA 1I4PA 4LF5L 2K50A 1ESRA 1SE8A 3HOWG 2O4XA 2WB1G 4LF7L 3BDOA 4DF7A 4NPSA 2HHHQ 1KABA 2JE6I 3PO2B 3MEFA 1HXYD 3S2DB 5JJLA 1SXTA 1N33Q 4A3EG 4B3SQ 3Q6SA 3HOUH 2ZT9C 3RZDH 1HTPA 1VQJA 1HR0W 1F2ZA 4BY1G 3J7A5 1EIFA 3DUZA 2O5IC 4JBMA 2ZQTA 1SYFA 2CWAA 1Z7TA 4JI7L 1XYIA 3W1BA 1F2MA 1TWGH 4QUCA 4JG2A 1UAPA 3NQIA 2R3ZA 3TP8A 3TS2A 2B2WC 5C5MA 4F88A 2K03A 2PCFB 1EOVA 1HFNA 2EYLA 4UDUC 5IYDG 1VQEA 2EZ5W 1BCPF 2NUCA 1K9RA 1QNUA 5KRUA 3JAMi 4A3BG 4Y7NB 3ND9A 3FKIB 2K75A 1WCMH 3HOXG 3W2DA 3K0YA 1NR4A 1QCBD 4HIKA 2K5WA 1Z47A 4TKOB 4RGTA 1MSGA 4N9PA 4BA1I 1K0RA 3NXWA 2IHFA 3S15H 5JJKA 1I4XA 1O7YA 2XVSA 3DWPA 3M3YB 3J80E 4ZAIA 1U4RA 3KF8B 2MHVA 4C3HG 2IT1A 2N49A 3T1HQ 5DM73 2LMCB 2PYKA 3GTOB 3M85A 1LTTD 1GUNA 5EBCA 2JXMB 4XT1B 4O0AA 3LKXA 5J22A 1Y1VG 1GKHA 4IUUA 2D62A 1CFMA 1PVOA 1C4QA 4GZYC 1I4HA 4JI0Q 4X3KA 5C4JB 4WJ3M 4LW1A 5DEHA 3I4MH 2ZR6A 4LUZA 4R8IA 2F52A 1CSPA 4QUFA 3GQBA 3FSBA 1STYA 3HS0C 3GD7A 4K6LA 3CMAA 5KEEA 1HH2P 4HSPA 3LGJA 1RP5A 5JPMC 3P75A 4R8NA 1CKNA 1B9MA 3K58A 1V8QA 1QB5D 2UXCL 3TP6A 5JEAJ 1B2TA 1STGA 4NDXA 1ET9A 2H4OA 2WIIB 3LNNA 2RA4A 3K5MA 1SMXA 1B9NA 3QWNA 1TKWB 3HOZG 1PINA 2NN6G 3CQZH 2KCNA 2XNAC 5NUCA 3FS8A 4RFBA 3OOCA 1JC7A 1WFQA 3BZDB 1XJVA 3STBD 3TRZA 4A3KH 4HMIA 3G6EA 3KBXA 1XTDA 5M3MG 1K8MA 3R2TA 3U4VA 3D31A 3NUCA 1IL2A 4CJ1B 3J81E 1YNND 3QO2A 3I4NB 4C3IB 4U673 2SOBA 5JOBA 4YY3Q 3S16B 4IFDI 3CCVA 2B39A 4DV0L 1NSNS 1Z6HA 3OIQA 4LUVA 1GD7A 3D8GA 4DK6C 1PRTF 2BDNA 5IGGA 1LTLA 5J39A 1PDQA 3I7FA 3DM1A 5EBDA 1KRTA 3AB9A 3HOYB 4A3LH 2YSIA 1B1ZA 1PTOH 4ZK9B 2MO1A 3PV0A 2WKDA 4BXXG 3H0GG 4JI6L 4ID6A 4XQNA 4BA2I 5CV6A 3TC5A 4IURA 1VQAA 1O7ZA 5D14A 1LTSD 1VCIA 1YI2A 1OXVA 4RKLA 3TSSA 1SAPA 1K9MC 4XYQA 2R92B 2AQ3B 1EL0A 1VQFA 2E2HH 4XQQA 1WTRA 1G91A 1QVCA 3RN5A 2B2UA 3PCOB 2E2IH 4ILWA 1O7LA 3MTSA 4A3FB 5IODA 4KHPQ 3H94A 3HKSA 1A3VA 3P1HA 1C0AA 1HR0Q 1WTPA 1JE5A 4TSSA 2F21A 1EEFD 3X3MA 4M1UB 2EPBA 1STNA 3ER0A 1HA6A 4DV1Q 4CKBA 3NBHB 4DR1L 2VS1A 2JEAI 3BU2A 1EG3A 4WFN3 1QILA 1HR0L 4IOAA 2KCCA 1YHBA 1S72A 5IP7G 1HUMA 1GHKA 3U9OA 4DN4M 2PMZB 2K5VA 2CKZB 2NBFA 4X62L 2WAEA 2HIXA 2NN6I 3KLRA 1SDFA 4EQOA 5CYUA 3CCSA 2IX3A 1PRTB 5IT9E 4DV3L 2LXJA 2YU9B 1VQ9A 4NXNQ 2EYOA 2F4IA 4DR4Q 1SYGA 4CKCA 3DXJC 2KBNA 4U85A 4JBWA 1HTLD 3BZKA 1F77A 2EZVA 4A3EH 2IW3A 2PMZE 4XQJA 3FVQA 1NMFA 2ATWA 3TP5A 2JA8H 2JYOA 3AQQA 3MFYA 1VQDA 1GUSA 5EAYA 4FF2A 3D0FA 5AJ3Q 2EJGC 4LF4Q 2YSGA 5M5WB 2ZR4A 1B7YB 4HN7A 3ULJA 3Q0AA 1ILQA 2Y0SG 3A5UA 4ZKBB 1K9QA 1TWCB 1MBYA 1SE2A 2HCCA 3H3VH 1GUOA 3MCBB 1IBKQ 1R9TB 2MP1A 1O6WA 3SK8A 5EQ0A 5EJWA 2N55A 1UNSA 3ERSX 1HQRD 5E5WA 3RZDB 1UE1A 2ALYB 3CRKC 1R4QB 1PH8A 4KKUA 1AE3A 3G7LA 3SEBA 2NN6H 5IGFA 1EY5A 3IFDA 2SEBD 2KEEA 4XXEA 3MXNA 4A3FG 1IBLQ 1NJIC 1A63A 1KC8C 3S1NH 2UU9L 1VQMA 2F0NA 4G57A 4B3RL 4KHZA 1LTRD 1IW7D 2QGQA 4CBVA 3U50C 4DV7Q 1WMVA 2I07B 1B50A 2C9OA 1YJ9A 1X3GA 4DR2L 1FJGQ 3JC66 4J6HA 3TN2A 2NTTA 4IPCA 5IGBA 4DXFA 5CV5A 3E5SA 5IGEA 2MJ8A 2PI2E 4JV5Q 2UUBL 4IALA 4C3IH 4APVA 4DGZA 1C8CA 2QRVA 2F0KA 4HTHA 5HURA 4OGQC 2NVYH 1GUGA 1EQVA 2B2TA 3T1HL 2K14A 4BBRB 3P20A 2DNCA 1AE2A 5C4JH 4K5WA 1PH3A 2WV6D 3QJYA 1WI5A 4IN3A 3S17H 2F0JA 5DLQE 4B3TL 1IHZA 1LLRD 3I4MG 1E2ZA 2PO4A 4GNXC 4A3GH 2EIFA 4KK7A 3EROA 4X66L 4JI0L 4JI2L 1EWHA 1KLUD 2RDGA 1I4QA 3J81j 3N6RA 5IWAQ 3A56A 4MTNA 3BG3A 2MUYA 1TR8A 4HMJA 3RLFA 4DR6L 1XXGA 2NTSA 2JA6G 3V2TA 4B3ML 1K83H 2Q2HA 4KY5A 2A68C 1J5EL 1F9SA 1TWGB 1V1PA 4BY1B 2E2HB 4HIDA 3OIPA 5BR8L 1UEBA 2EVBA 4LK1C 1EU3A 4LF9Q 4PQXA 4PNYA 1AH9A 4P71A 1SYEA 1D5XC 1AFPA 3CAMA 3MXNB 4A93H 2Q5AA 1TIID 2K5QA 4DV0Q 5JPNC 2L5TA 2L15A 1XPUA 4OX9L 5LMNW 2ZJRA 3HRZC 1G6ZA 1RODA 1LV9A 5KNCA 1A8VA 5BN5A 4F8MA 2J4XA 2MQHA 4LJZC 1UE7A 3CC2A 2ZXOA 3R93A 5G3LF 3SE0A 2EY2A 2HQEA 1KRSA 1BBWA 5GAGC 3GTJB 2F0TA 2B8GA 2QF7A 4KI0A 1WTVA 1GHJA 4XT3B 2E2DC 4DR5L 4YY3L 1TS2A 5IYBH 1HCZA 2I0QA 3S17B 2O2LD 2XP3A 2FFKB 2WINB 2JA7B 2B63B 1MKHA 2L9HA 1EIHA 1CKOA 2XPBA 4PG3A 5J3BA 3CP0A 1KD1C 1YNJC 2Y0SE 1CHPD 4LUOA 1S5FD 1W6JA 3K5OA 3PO2G 4Y7NH 2EDGA 2EE1A 4ABNA 4DR5Q 2QEJC 1K83B 3S2HB 4GKKL 4IFDH 2ZQVA 2AUJD 3BDCA 3NK9A 1NE3A 2H5XA 1KDBA 4OIKA 2VUMB 4FXGC 1AW7A 1SYDA 1TQOA 3VYRA 1VQKA 2NWGA 3KJOA 2X6GA 3HOZH 1JT8A 5KIXA 4DR1Q 1P16A 1D8LA 4GKKQ 2WKCA 3K6OA 4HR7B 3E0JA 5ELFA 4A3CG 2XWBB 5M3FG 4JI5L 3L0OA 2Q8TA 3ITPA 2VB3X 4Z9CB 4A0UA 3KCEA 4P72A 1EY6A 1HNXL 3VYUA 3ZYYX 5C3WA 1RCVD 2NVQH 2A6HD 1RL2A 2JEBI 2K01A 4QMGA 1LTBD 3A54A 3AMUA 5E62A 3E9HA 1G6PA 1ONLA 4MIUA 1JJ2A 1XWEA 4GNXA 1FGUA 3ERQA 4LF8L 4DV4Q 1SNMA 4DV1L 1Y8OB 3MVVA 1SFOB 1SSOA 1B3AA 3M7GA 3S1NB 1JB3A 5FLXL 2ZAJA 4MN3A 1X3EA 2D2CC 3GTLH 2OTLA 4A3MB 3FMCA 2PNHA 1CTMA 4FO2A 5CV9A 2LSSA 1QVGA 1FVIA 1KLGD 3DM3A 4L8JA 1MSHA 2QILA 2K52A 1DM0B 3TMEA 4HSVA 4EX5A 2KCMA 2R7ZH 2DY8A 4RWSC 4PMBA 1BUVT 1JB7A 1FYCA 2R93G 4IPDA 1S4ZA 5I9OA 1FL0A 4R4QA 1IBKL 2VQFQ 3IKJA 4LFCL 5FLMG 3ULPA 3SDZA 3HOYG 4UP8A 5IY0A 5LHY1 4HJAA 1DYQA 2F3WA 2NVTB 2PNRC 3PUWA 4KTAA 2ZQSA 2B63G 3D3RA 3FRPB 3TREA 3VR4A 3MCBA 3PIOA 3I91A 1KXLA 2E74C 2JA5H 4OIJA 4A75A 1H9SB 2R93H 1MJEA 5I9PA 1DZ1A 3LX0A 1ENAA 5D3DA 2JA9A 5IT9c 5GAEC 1SNDA 1HZ9A 3Q24A 4DR3Q 4FYDA 4K0KQ 3PF4A 3KK7A 1O78A 4WJ4A 1EQTA 3VA5A 4KMUC 5EKLA 3MWYW 4AYBG 3RN2A 1JQYD 2AKWB 5E65A 3HG9A 2JMFA 4A3DB 3EVQA 4HJ5A 3KYHC 4XYOA 3PUZA 1BQQT 3J80i 4RHRA 1JICA 1JOQA 2OT2A 1WTWA 3AEVA 1A62A 2E76C 4Q0FA 2F03A 5M5XB 4ME3A 3SGIA 2UXBQ 4DK3C 1O80A 1K8OA 4FF1A 1ZCNA 5AFWA 2Q2IA 3OOBA 2MGSA 1HNZQ 2ZTEA 2YYZA 1PH1A 3J81c 1YNXA 4QL5A 4H0LC 2CQOA 2RBMA 5C4XH 1B53A 3K59A 4IUVA 1I6HB 5FKAC 1UUPA 1M4VA 3KF8A 3W5OA 3HKZG 3EBEA 1IKLA 1SNPA 4Q5VA 1PTOD 4L5TA 2JP1A 1W6KA 2EXDA 1D5MC 1C48A 4GOPA 1KNAA 4ODGA 3KLSA 1N8RC 3NE5B 1N34Q 2R92G 3BS1A 1PTOF 1I5HW 4JI2Q 3OWEB 5KYIA 2R7ZG 4IFDJ 1H9SA 5IGDA 4LF6Q 1D1KA 1LTID 4A3JH 3I73A 3I4LA 2HT1A 2XP7A 1EFWA 2PQEA 1M90C 4CJ0B 2VQEL 5C0XJ 4YWLA 3PUVA 2IJ0A 2EJFC 2CFMA 1EWIA 1OXTA 3HOWB 1SE3A 2XP4A 1BF4A 2KENA 2VW9A 2E5LL 5BR8Q 3KABA 2B2YC 3K0XA 3D4DA 2B2VC 4BS9A 4A3EB 1QG7A 4IPHA 1PMRA 3TDBA 2EYHA 5EPJA 2YV5A 3WWVA 1EYCA 1TWFB 2O5JC 4A3IH 1MD2D 2YTVA 3CU7A 2DJYA 2F0VA 1VS0A 3G4SA 1PH5A 5HGQA 1PRTC 4DKAC 4DA2A 1L0XB 1A3UA 1BBUA 3TP7A 3K7AH 3OMGA 4DUYQ 1EOTA 3PSIA 4P73A 4NB3A 3K57A 3TEHB 3BDLA 1TR5A 4OWWB 1PHJA 3UE1A 4IO9A