3M7NA

Archaeoglobus fulgidus exosome with rna bound to the active site
Total Genus 42
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
42
sequence length
179
structure length
179
Chain Sequence
MRFVMPGDRIGSAEEYVKGEGVYEEGGELFAAVAGKLIIKDRVAKVESISPIPEIVKGDVVLGRVVDLRNSIALIEVSSKKGENRGPSNRGIGILHVSNVDEGYVKEISEAVGYLDILKARVIGDNLRLSTKEEEMGVLRALCSNCKTEMVREGDILKCPECGRVEKRKISTDYGKGEW
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase/rna
molecule keywords Putative uncharacterized protein AF_0206
publication title Quantitative analysis of processive RNA degradation by the archaeal RNA exosome
pubmed doi rcsb
source organism Archaeoglobus fulgidus
total genus 42
structure length 179
sequence length 179
chains with identical sequence B, C
ec nomenclature
pdb deposition date 2010-03-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF10447 EXOSC1 Exosome component EXOSC1/CSL4
A PF14382 ECR1_N Exosome complex exonuclease RRP4 N-terminal region
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.20.70.10 Mainly Beta Single Sheet Ubiquitin Ligase Nedd4; Chain: W; Ubiquitin Ligase Nedd4; Chain: W; 3m7nA03
2.40.50.100 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 3m7nA01
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 3m7nA02
4LF6L 1PH2A 4AIMA 3PIOA 2AWOA 3HFZB 2KHIA 2I0QA 4B3SL 2OQKA 3KAHA 1E7ZA 1DD2A 3PSIA 3G71A 3S1RH 3PF4A 4L5SA 1MJCA 2PPBC 1XNRL 3DM3A 2UU9Q 2VW9A 4DUYQ 4GKKL 2I5HA 4IPHA 4DAMA 1L1OC 2LMCB 1K9QA 5IYBH 1TWCH 5C44G 1VQGA 3LE4A 4OWXB 4G7ZC 4DUZQ 5BR8L 4QIWE 4A3FH 4KN4C 2MFIA 3RLFA 2E8GA 2UXBQ 3G4SA 3PUYA 3NEMA 4YCVA 4LF9L 1X3FA 3S15H 2F1MA 2DNEA 2JMFA 1N33L 2Q2HA 1A6XA 4HIKA 3GO5A 1U0LA 3HOVH 5IT9c 2VQFQ 3UE0A 2ASBA 5H1SE 2WB1G 3HOYH 4NXMQ 4DR1L 1C9OA 3BG3A 2O5JC 1X6OA 1O6WA 2KBNA 4BY7H 1K0RA 1ASZA 4GNXB 1JJ2A 1J5EL 4LF5Q 1XMOL 3F1ZA 2E5LQ 4JBWA 3I4OA 3ULPA 4O2DA 4JBKA 3BJUA 5LMUL 1EQQA 4APVA 1X3GA 2HHHL 1YJNA 3CP0A 3CCVA 3RN5A 1NE3A 2YTYA 1I6HH 4JI8L 3J7A5 5M5YH 3S2HH 4GN4B 3HOWG 4DPGA 5LMNL 2ATWA 1KRTA 1UE5A 1WI5A 1IW7C 5M5XH 4AH6A 4QJFA 1CI3M 2E76C 1IYJB 4OX9Q 1V1QA 1O78A 3MXNB 4R4CA 1HTPA 2K5NA 4NPSA 1E24A 1UEBA 3U4VA 1I3QH 2CW0C 3VDYA 3FP9A 3KDFB 4UP9A 4LFCL 1TWHH 2PMZE 4UY8C 4KHPL 2ZTCA 1SMYC 2I5LX 4IFDH 4JG2A 4DR3Q 4FDBA 3KDFA 4NXNL 2DJYA 2DN8A 2WB1E 1P16A 3RZOH 3RR5A 3U4ZA 4U85A 1TWFH 5JEAG 3J80c 2CFMA 1KRSA 4QY7A 2XTIA 1YHBA 4C3JH 4EQ5A 4A3IG 3F2BA 2UUBQ 3KLWA 3NENA 2YSBA 2IT1A 3J81c 5M3FG 3BU2A 3CCQA 2DMVA 4P75A 1NBWA 2EJGC 4BBRH 1V8QA 2L4JA 4BA2I 2ZR5A 4ME3A 1O7LA 4BY1G 3JAMc 3KJOA 1WR7A 2QGQA 4LJZC 4L5RC 3FMCA 4YWMA 2Q2UA 5AJ3Q 1HZ9A 3PO3G 4QIBA 2YSGA 1SR3A 1Y1VG 2A68D 3GTJH 2JA7G 4QGUA 4RG1A 2NVXH 1VQ4A 2LSSA 1MKHA 4IPGA 1NMGA 2MNAA 4JI2L 3OW7A 5JJLA 4RCNA 1PH6A 5C0XI 1E2ZA 3UE1A 2CWPA 4JI1L 3PO2H 1BKBA 4YHHL 4PMWA 4X66L 1KHIA 1OTCA 4GKJQ 2A69D 4Y52H 4P74A 2DK7A 1YNXA 3T1HQ 1HNZQ 1DCZA 1PV4A 4DR2Q 3M85A 3CQZH 3RZDH 3HKZG 4A93G 3CC2A 2IHEA 2AKWB 2E2JH 1K9MC 2UUAQ 1PH7A 4XIGS 4DNIA 5C0XJ 3GTQH 3TREA 1EYGA 5K36H 1RL2A 2A8VA 1BBUA 1CSQA 1X3EA 3L4HA 4YWKA 3PIPA 5M3FH 4HIOA 2VUMG 4A4IA 1YIJA 3G6EA 1Y8OB 4DUYL 2XP7A 4BXXG 1JMQA 3RN2A 1GHJA 2E75C 1A62A 1SRUA 2F21A 4A3KH 4LWCA 4DUZL 2YTVA 2UXBL 3JC66 3QIAA 3M4QA 4GOPB 1YBYA 3CRLC 4QQBX 1HZAA 3BZKA 4OONA 2YYZA 1X65A 1AE3A 3KABA 4YCUA 3KCEA 5IWAQ 1HNXQ 1HQMC 5GADC 1G6PA 2VQFL 4GOPA 3VA7A 2K7VA 1SMXA 4DV1Q 4P71A 3E9HA 2A6HD 1JE5A 3MFYA 2ZM6Q 3IKJA 3K7AH 3UDFA 1NTGA 1WJJA 4DR7Q 2DK1A 5BN5A 3A74A 3S17H 3WH0A 4LF5L 1XMQQ 2E5LL 2E45A 2K33A 3HKZE 4R4QA 4DV6Q 5ELNA 5IE8A 4HIMA 4H0LC 4JYAQ 2B63H 4JOIC 3H0GH 1Y1WG 3OTOQ 1GD7A 1Y14B 1I50H 5IYCH 2A6ED 5C0XG 2ZQUA 2JXWA 1YI2A 4LF7Q 2HIXA 2YSIA 1VF5C 4DNRB 4DR4Q 2DNCA 1CTMA 4GZYC 3A5ZB 3UDXA 4OX9L 2K52A 2OWOA 1B7YB 3CCUA 5HY6A 1GJXA 3WDNA 1OXUA 2LAJA 2PCFB 1H9SB 2QF7A 1JJCB 3J81j 3L2PA 2JA5G 3NELA 4DR3L 3PGZA 2WP8J 4BBSH 1S72A 3OW2A 2XPAA 3VR6A 1K8AC 1WCMG 1H9SA 4L5QA 1Z47A 4DAYB 2UUCQ 1EOVA 4H02A 4JV5Q 2E74C 2R92G 5C3EH 2CKZB 2ZQTA 1Y8NB 4DV3Q 4UP8A 1B70B 5KNDA 1NMVA 1WMVA 4R4TA 2XP4A 2NZHA 3QG1A 5AHTA 1QVFA 1AH9A 2B29A 2B8GA 2R7ZH 3CNGA 4DV2L 1PYSB 3U58A 1FYCA 5J3BA 3D31A 1KL9A 3RNUA 4JI5Q 1VQIA 1N36Q 2PI2A 4JI4Q 5C0XH 3H3VI 1XJVA 1GUGA 5AJ3L 4YY3L 1IYUA 2CWAA 1ZCNA 1ASYA 2OCEA 1LACA 1YW5A 1Q86C 2D5DA 4B3ML 3S1NH 1JB7A 2ZAJA 1LABA 2OTJA 5GQOA 4A3JH 2N78A 2EJMA 3ULLA 3GTKH 1FR3A 1E1OA 2NVQH 4JI0Q 1HR0Q 4A3CG 5FLMH 3IRBA 1G51A 2VQEL 3T1HL 1S40A 1H9MA 1OXSC 3AB9A 3VR4A 5JEAJ 3F2CA 2KXQA 2QA4A 3CD6A 2UUAL 1VQ9A 3VR3A 3CRKC 1HNWL 3EBEA 3S1QH 3LWUA 3OPOA 2YU9H 3STBC 1IZ6A 5C4XG 1PH3A 2BE5C 3AYHB 4X6AH 4KMUC 4AYBG 2ZJRA 4JI7Q 1L1OB 1J6QA 4I7ZC 5M3MG 4A3GG 3D4RA 1NMFA 3GQBA 2IHFA 1N34Q 2JA8G 3KF6B 1GO3E 5FLXc 1LTLA 1EWIA 5BN4A 2AWNA 3CW2C 2ZTDA 1XNQL 1L1OA 1QZHA 3GTGH 3KF6A 2F4VQ 3CMAA 2ZQVA 1VQHA 2KCTA 1L0WA 4KLKA 2R93G 2AUKA 1LM0A 3SDZA 5C44H 2K5VA 4IOAA 5JJKA 5IWAL 1Q90A 4X62Q 3DLLA 1HNXL 2AHOB 4DKAC 4EX5A 4X65Q 4DR6Q 4DV1L 1EWHA 1Q1BA 1PFSA 4DV0Q 4Y7NH 1FJGQ 3A7AB 3GTPH 2ZM6L 1C7YA 1JT8A 1GUTA 1TWAH 3CCJA 4YCWA 3TRZA 4DR7L 1EQRA 4G7HC 1W2BA 5GAGC 4DV7L 1XMQL 3U50C 3TDBA 2EXDA 5JJIA 2C35B 2N49A 2UXCL 1YEZA 4GLAC 1VQKA 4HJ9A 1B8AA 4DV6L 2O5IC 4OO1G 1PH9A 2PQAB 1FL0A 4JYAL 4IJHA 5C4XH 1M90C 3I55A 1IL2A 1H9KA 2NZOA 1D7QA 3TQYA 3ULJA 4B3RQ 1Q1EA 2AUJD 2Q2IA 5M3MH 1IBKL 4DR5Q 3KAIA 3I72A 2VL6A 3CCSA 2JA8H 2PQAA 4LF4Q 4B3TQ 3VR5A 1VQ5A 2WAQG 2Z6KC 1B9MA 3N6RA 3K80C 3T56B 3HGBA 3UDIA 3HOWH 1Q82C 3L7ZC 1E22A 4A3DG 3KAFA 1SFOH 3A8KE 1Y8PB 3HOUG 2R7FA 4HJ5A 1IW7D 2R93H 3TZUA 1EIFA 4LFAQ 1MIUA 4HR7B 2WFWA 1BBWA 3ER0A 1V43A 1UWVA 3KFUA 1I94L 1VQBA 2EIFA 1WOCA 1Q8KA 3KYHC 3Q8DA 4JC0A 4E5RA 4C3HH 3F2DA 4DV5L 1VQ7A 2A1AA 2XPBA 3EIVA 4LUZA 3FKIG 3IFTA 3KADA 1PH5A 3H3VH 2UUCL 1K73C 3T1YL 4JV5L 1T5EA 3HOXG 1X54A 4DV3L 4DV4Q 2DUDA 1MJEA 1VQMA 2JQOA 5BR8Q 4JI6Q 4LK1C 1E3PA 1ZKOA 5JEAH 4LW1A 1PINA 5FJ8G 1ONLA 4JI5L 1TXYA 3K81C 4WJ3M 1N33Q 1JMCA 4JI4L 3S24A 4A3IH 1F8AB 3TCZA 2R6GA 4NB3A 1UE7A 1VQLA 4A3EG 2QEXA 2GN5A 2ID0A 2WAQE 4DR1Q 2UU9L 3H15A 4BY1H 4IPCA 1ZYRC 1IYVA 4KKSA 1J5EQ 1TKWB 1KXLA 4HIDA 3PO3H 1B9NA 2I5MX 3AFPA 1Y1VH 1XMOQ 2JA7H 1FVIA 2PI2E 1L2FA 5ELOA 1TK7A 3ODKA 3CC7A 3E9IA 1SN8A 3I7FA 2D2CC 4JI0L 1FGUA 1HR0L 2V4DA 4DK6C 2M3OW 4DK1A 3LNNA 5C4JH 2HQLA 2D62A 4OWTB 3CPWA 3LGJA 3M7NA 4KHZA 4LFBQ 5LMNQ 3FKIH 1QVCA 3EQLC 5KNCA 2YTXA 4NXML 2KCCA 3I4MG 3I4NG 1YNJC 4O0AA 1JJGA 4A93H 3ND9A 5DLQE 4P73A 1TWGH 3CCMA 3GTLH 1NY4A 1N34L 1HJPA 4L5TA 5IP7G 5IYDG 5GAEC 4A3EH 1YITA 5M5WH 3M3YH 2VUMH 1VQDA 1KAWA 1PYBA 1BVSA 2GVBA 1Y69U 2JEBI 3ICEA 2F4VL 3AEVA 4L8JA 1EUJA 4BXXH 2CQOA 2OQ0A 2YSHA 2GVAA 4MTNA 1N32Q 2NN6G 3H94A 1E1TA 4X62L 4WJ4A 1PMRA 1K9RA 1TU2B 1PHJA 1UE1A 1HR0W 1K8MA 4U84A 3TEHB 4PZ6A 4DR6L 2JJQA 3CCLA 4IFDI 3F8TA 2RE3A 1Z7TA 3I4LA 4DV0L 4LUVA 1FJGL 1HZBA 1OXTA 4DK3C 1DGSA 1HPCA 3E0EA 5GROA 2K50A 2ZTEA 5HGQA 1CUKA 3K0XA 3CXCA 5IYBG 1HCZA 3I4NH 4A3FG 2K14A 2LXJA 4IFDJ 2EVBA 2Q5AA 1N9WA 1SROA 2M8JA 2IX1A 2JK8A 1VCIA 1GUSA 2VNUD 2K32A 4JOIA 4B3RL 2XP6A 4LF8Q 2NVTH 4DR5L 1IBMQ 4LF4L 4B3TL 2UUBL 2VY3A 5IP7H 1S3OA 4IOCA 4UPAA 3SE0A 5IY0A 1Y1WH 3HOYG 4R1JA 5IP9G 4BY7G 3D0FA 3PF5A 1QVGA 1OXVA 2XGTA 2NVYH 4LFAL 3K7UC 1RIPA 4OWWB 4H13C 4OO1I 2MO1A 3FPPA 3W1GA 1K3RA 2ALYB 1UE6A 4HJ7A 3S14H 4PZ7A 1BDOA 4K0KQ 3NBHB 4JI3Q 4A76A 4GNXC 3I73A 4JBMA 4GKJL 2BDOA 3CCEA 2JA5H 3MXUA 1R9TH 2UXDQ 1YNNC 2Q8IB 1HNZL 4DV4L 1VQNA 3KF8B 2DGYA 4DR2L 2EZ5W 3VR2A 2XP3A 1WCMH 4KI0A 4JI6L 2RCNA 4YWLA 2BH2A 1VQCA 2R92H 1Q12A 1KQSA 3W5OA 1N8RC 3G48A 2PNRC 1GM5A 4X64Q 3CAMA 1PA6A 4IFDG 1QUQB 1Z6HA 4KKTA 4G7OC 5IP9H 1YVCA 3A8IE 2EJFC 2F52A 3A5UA 1QUQA 2EQSA 2ZR6A 2YV5A 4A3LG 3RLNA 1O7IA 3FHWA 4GNXA 5E7NA 1PH8A 1P8LA 3M4YA 1CKMA 1PH4A 1X56A 1HH2P 1WYDA 2DWVA 2F3IA 4BBRG 4A3MG 2Y0SG 4TQUS 4LFBL 3P20A 4PZ8A 4A3CH 3S2DH 3AQQA 1VQOA 2A68C 3TC5A 1KD1C 1IBLQ 4GN3B 3BDOA 2EDGA 1YJ9A 2K4KA 1GUOA 2B8FA 2E2IH 1V9PA 4OGQC 1PVOA 4PG3A 1A63A 2MQHA 5GAHC 2ZT9C 2JV4A 3STBD 3PO2G 1SE8A 1X55A 3GTMH 2BE5D 4REXA 2A69C 5CQ2A 3OTOL 1X9NA 4PV1C 2JEAI 1CKNB 3S16H 3OOCA 1XTDA 4A3GH 1IXRA 1I6VC 4AYBE 4AQYQ 3W3AA 4LF7L 1Z9FA 1N32L 2RHSB 3TS2A 4DR4L 2RHQB 3NE5B 3CCRA 1QJOA 1CKNA 4A3LH 3A8JE 3HOZG 1H9RA 4OXPA 5BN3A 5K36G 4MZ9A 3PCOB 3S1MH 1DXMA 3HKSA 3ND8A 3PUVA 4C2MH 3KJPA 1XPOA 4A3MH 1T9HA 4DV2Q 2H5XA 5LMNW 1CKOA 1GUNA 4LF6Q 1G291 4HJAA 2K75A 2R7DA 3WWVA 4B3SQ 1E2WA 2FXQA 1VQ8A 4U86A 1VQAA 2Y0SE 1CSPA 1H95A 3CPFA 3QJYA 1VQFA 3GDEA 4YY3Q 3ZJYC 2ZJPA 2D0OA 4A3KG 1XNRQ 3M9BA 1AE2A 2VZAA 4POGA 1A0IA 3T53B 3TS0A 2HIVA 4GKKQ 2NN6I 4B3MQ 3KOJA 4RMFA 1XPRA 2OTLA 4LF8L 1E2VA 2LXKA 1IBML 3BZCA 4OO1H 4GS3A 1YHAA 4XTCS 1VS0A 1W3SA 1WFQA 2BA1A 2A6HC 2Z6KA 2VQEQ 4LF9Q 2XP5A 2Z0SA 3M4PA 1VDZA 2ITKA 1N36L 3K8AA 1KIXA 4GOPC 1M1KC 4IQZA 2JE6I 4A75A 1K8GA 3HOZH 4A3DH 1D8LA 1HNWQ 2XP8A 4LUOA 2BH8A 3HOUH 2B63G 1YJWA 1QZGA 3H0GG 1VQPA 4K0KL 4JI3L 4TVAB 4J15A 1A8VA 4JCVE 3CF5A 5IYCG 1Q81C 2N3SA 2A6EC 1LYLA 3DXJC 5LMUQ 1Q46A 2HHHQ 1I5HW 3PV0A 2UXDL 4JI8Q 2E2HH 4R4IA 3U9SA 1XNQQ 1HZCA 2N8NA 3CMEA 4JBJA 1SLJA 1NJIC 1C0AA 3ERSX 1PH1A 3HOXH 3KLRA 4H44C 1GKHA 1VF7A 4ALPA 2B3GA 1YZ6A 2D0PA 2ZQSA 4X64L 3PUWA 3SGIA 2KHJA 3RLOA 2HT1A 4JI7L 5FJ8H 4BA1I 1EFWA 4BBSG 4GN5A 2KA7A 4LFCQ 4QL5A 1GVPA 3UDGA 1GHKA 1H9JA 4KHPQ 1Q7YC 4DV7Q 2JX8A 1XPUA 2IY5B 2BA0A 4JK1C 2L5TA 1K8OA 2UXCQ 5C3EG 4A3BG 4C3IH 4NXNQ 3J7ZC 3T51B 2JA6G 3PUZA 2VS1A 1KC8C 3M4OH 3OOBA 1K83H 2ZJQA 1EG3A 4R4OA 4MNOA 4TKOB 3J80i 2R7ZG 4DNTB 2V1CC 3L0OA 2KCMA 4IPDA 3CC4A 3OYYA 1IBKQ 2AMCB 4X65L 2K5HA 1EG4A 3J81i 2JA9A 3NTPA 5EAYA 4LNQA 4P72A 1EIYB 2M8IA 2IX0A 1IBLL 1VQEA 3JAMi 4GLXA 4GLVB 2PNHA 1YHQA 4DK0A 4HJ8A 3PUXA 1VQ6A 3W1BA 3I4MH 4A3JG 2Q2TA 1VQJA 3AFQA 4IJLA 1U5KA 1I94Q 5FLMG 2ES2A 1I5FA 4JI2Q 1LUZA 4UP7A 2MO0A 4KN7C 5A35A 3MEFA 1CFMA 2RF4A 4IO9A 3I56A 4DV5Q 4AQYL 2YSFA 4JI1Q 3A7LA 3GTOH 5IYDH 5KNBA 4YHHQ 2A19A 4X66Q 3HOVG 3EN2A 4KKUA 2MDIA 3T1YQ 2ZR4A 3KAGA 2KENA 4A3BH 3GD7A 2JA6H 4POFA 2CCZA 2NN6H 3B6YA 2L15A 2JXMB 2XP9A 1OXXK 3A0JA 3I2ZA
chains in the Genus database with same CATH superfamily
4LF6L 1PH2A 4AIMA 3PIOA 3HZXA 2AWOA 3HFZB 1SNDA 2KHIA 2I0QA 4B3SL 5A2QE 1HXYD 2OQKA 3KAHA 2RVLA 1SYEA 1E7ZA 1DD2A 3PSIA 3G71A 2K1BA 3S1RH 2F0TA 3L3OC 2NTSA 2G9HD 3PF4A 1T5XD 4L5SA 1MJCA 4WORA 2PPBC 1MD2D 2F0MA 1XNRL 3DM3A 2UU9Q 2VW9A 2L11A 1FNVA 4DUYQ 4GKKL 5CV8A 2I5HA 3HEJA 4IPHA 4DAMA 1L1OC 4DGZA 2LMCB 1K9QA 5IYBH 3FRPB 2ICIA 1TWCH 5C44G 3HKZB 1VQGA 3LE4A 4OWXB 4A93B 4G7ZC 3OHXC 4DUZQ 5BR8L 3S17B 4QIWE 4A3FH 2MFIA 4KN4C 2XRQD 5IGBA 3QWNA 2KEDA 1U4RA 3RLFA 1TWGB 3HG9A 2E8GA 5FKAC 2UXBQ 3G4SA 3GTLB 3PUYA 4F7XA 3NEMA 2PO4A 4CJ1B 4YCVA 4LF9L 4R8NA 1X3FA 3S15H 1MBYA 2F1MA 2DNEA 2JMFA 1N33L 2Q2HA 2OXPA 1A6XA 2WINB 4QF4A 4HIKA 5M5WB 3M3YB 2F3VA 2VUMB 5C5MA 3GO5A 2HUGA 1U0LA 4M8AA 5IT9c 4OIKA 3HOVH 2VQFQ 3UE0A 2ASBA 3E6ZX 1JWUD 1I50B 1PZID 4OHJA 5H1SE 2WB1G 3HOYH 1FD7D 2NWGA 4NXMQ 1NR4A 4DR1L 1C9OA 1X6OA 3BG3A 2F0OA 2O5JC 1O6WA 2KBNA 4BY7H 3NHHA 1I4HA 1K0RA 2WKCA 4GNXB 1ASZA 1JJ2A 3NQIA 3EVQA 2QILA 1J5EL 5M9OA 1STEA 2C5CA 4LF5Q 1XMOL 2EY2A 3F1ZA 2E5LQ 1HRJA 4JBWA 3I4OA 3ULPA 1PZKD 4O2DA 1RDPD 1JOOA 2HDMA 1SE4A 1SXTA 2DY8A 1O7YA 3C46A 1VMCA 4JBKA 3BJUA 2LKVA 5LMUL 2CH4A 1EQQA 4APVA 1X3GA 2HHHL 1YJNA 3CP0A 4EGVA 1D2BA 5IGFA 3CCVA 1U4LA 3RN5A 1NE3A 2YTYA 1I6HH 4JI8L 3J7A5 5M5YH 3S2HH 2K04A 1EEFD 4GN4B 1EZ8A 3HOWG 4DPGA 4ULLA 1D6EC 5LMNL 1EY0A 3NSWA 1EFID 2IX3A 2ATWA 1KRTA 2IWHA 1IKMA 1UE5A 4PMBA 1WI5A 1IW7C 5M5XH 5CBAE 4AH6A 2ZXRA 1D5ZC 4KTAA 1YNND 4QJFA 4FXDA 1CI3M 2E76C 5EGTA 4QUFA 2HCCA 2DY7A 4ZYSA 3FSBA 1IYJB 4OX9Q 1BCPF 3GP7A 1V1QA 5FOBB 1O78A 1ENFA 3MXNB 2RDGA 4R4CA 4CGYB 2KVMA 2NVTB 1HTPA 2K5NA 1JWSD 4NPSA 1E24A 1UEBA 1SDFA 5E64A 3U4VA 1I3QH 2CW0C 1B4OA 1RD9D 4C3HG 1JORA 3VDYA 2CVRA 4KY6A 3FP9A 3KDFB 4UP9A 4K5WA 4LFCL 1WVLA 1LTBD 2F0QA 4IUVA 5IOCA 1TWHH 2K5DA 2PMZE 3MQGA 1Y1WB 2L1BA 5CV4A 4UY8C 5DNFA 4KHPL 3MXNA 5CR3A 2ZTCA 1SMYC 1UNSA 1AN8A 2I5LX 4IFDH 4JG2A 4DR3Q 4FDBA 4KJOA 1ICFB 4ILWA 1CA5A 3KDFA 4NXNL 2DJYA 2DN8A 2WB1E 1PRTB 2FMCA 2NVYB 1P16A 3EROA 2B2VC 3RZOH 3RR5A 3U4ZA 5T1IA 4U85A 1TWFH 3BDLA 5JEAG 1DOMA 3J80c 2CFMA 1KRSA 4QY7A 2XTIA 1FGBD 1F9RA 4XQNA 1WTOA 3S14B 2L9HA 1YHBA 3H09A 4C3JH 3T4AC 2DJFC 1X32A 4EQ5A 4A3IG 3F2BA 2UUBQ 3KLWA 1SYCA 3SK4A 3NENA 2YSBA 2IT1A 3K5MA 4ZKBB 3J81c 5F2DA 5M3FG 3BU2A 3CCQA 2DMVA 4P75A 1NBWA 2EJGC 4FXKC 3EFXD 4BBRH 1V8QA 1PRTD 2L4JA 4BA2I 2ZR5A 4ME3A 1O7LA 3FPUB 2QKIC 4BY1G 3JAMc 3KJOA 1WR7A 2QGQA 2JA5B 1R9TB 1SJHD 4LJZC 4L5RC 3FMCA 4XQQA 3NQTA 4NKLA 4YWMA 2Q2UA 5AJ3Q 1HZ9A 3PO3G 4QIBA 2YSGA 1SYDA 1SR3A 1Y1VG 3OWEB 1WCMB 2A68D 5KGUA 3GTJH 2JA7G 1SEBD 4QGUA 2J7ZA 2TMPA 2FFKB 4CDEC 3R8BA 4RG1A 2AQ3B 2NVXH 3H91A 1F2LA 4RWSC 5DEHA 4DXGA 4F88A 2LSSA 1VQ4A 2R92B 2ENBA 2OEOA 2WAEA 2K28A 2PW5A 1MKHA 4IPGA 1NMGA 2MNAA 4JI2L 3OW7A 1ESFA 3S1QB 2Y8NB 5TSSA 5JJLA 4RCNA 4ZAIA 1PH6A 5C0XI 1E2ZA 3NPPA 3UE1A 1E0BA 4UAIA 1EY4A 2CWPA 4JI1L 3PO2H 1BKBA 1HTLD 2EYFA 4YHHL 4PMWA 4X66L 2B2WC 1KHIA 1OTCA 1DM0B 5DAUA 1XXGA 4GKJQ 2A69D 4DU9A 1AP0A 4Y52H 4P74A 1XTCD 2DK7A 1NUCA 2X69A 1CZWA 1YNXA 3T1HQ 1HNZQ 1DCZA 1MI2A 3MXGA 3J7AV 1PV4A 4DR2Q 3M85A 3CQZH 3RZDH 2NB0A 3A56A 3HKZG 4A93G 3CC2A 2IHEA 2MGSA 2AKWB 2E2JH 4IUQA 1K9MC 2UUAQ 4S3SA 3EA6A 1Q3LA 1F2ZA 1PH7A 4XIGS 4DNIA 5C0XJ 3GTQH 3TREA 2MJ8A 1EYGA 5K36H 1RL2A 2A8VA 5FO8B 2FHTA 4IZ8A 1BBUA 1CSQA 1X3EA 3L4HA 4YWKA 4KY7A 3PIPA 3Q22A 5M3FH 1A3UA 4HIOA 2KHSA 1A15A 5T1GA 2VUMG 4A4IA 1F9PA 4BS9A 4QCLA 1YIJA 2G9DA 4KJNA 3G6EA 1Y8OB 1LTGD 5D3DA 2K5QA 3S2DB 3MEHA 4DUYL 2XP7A 3VYTA 4Z9CB 4BXXG 2WV6D 2F0GA 1JMQA 3P1HA 3RN2A 1GHJA 3HS0C 2E75C 1A62A 1SRUA 4FP5D 2F21A 4A3KH 4LWCA 4DUZL 2E2IB 2YTVA 1TS4A 5ELFA 1K0SA 1DJRD 1ZEQX 2UXBL 3JC66 3QIAA 5ELBA 3M4QA 4GOPB 1STBA 5EKLA 1YBYA 1KNAA 3HP3A 3CRLC 5E3FA 1LTTD 4QQBX 1HZAA 2Z4HA 3BZKA 1B1ZA 4OONA 2YYZA 1X65A 1AE3A 3KABA 4YCUA 5C4XB 3KCEA 5IWAQ 1HNXQ 2JYOA 4ZCKA 1HQMC 5GADC 1V1PB 2HDLA 3GTMB 2B2TC 4RHRA 4AYBB 1G6PA 5IT9L 2VQFL 4GOPA 3VA7A 2K7VA 1SMXA 3DWAA 4DV1Q 1WD1A 3KBXA 4P71A 4A3GB 3E9HA 3C2PA 2A6HD 4RA8A 2JA8B 1JE5A 1R4PB 1I4QA 4JW0A 3MFYA 2ZM6Q 1MGSA 3IKJA 1V1PA 3TDQA 3SXHA 1PTOB 3K7AH 2WKDA 3UDFA 3VA5A 4DXFA 4X3UA 1NTGA 1WJJA 4DR7Q 2DK1A 5BN5A 1O7ZA 1S5DD 3A74A 3WH0A 3S17H 1AZPA 4LF5L 1XMQQ 2E5LL 1QILA 2E45A 2K33A 3HKZE 4R4QA 2XNAC 2M9VA 2TSSA 4L6TB 2F0HA 3S1MB 4DV6Q 5ELNA 5IE8A 4HIMA 4H0LC 4C2MB 4JYAQ 1LTSD 3TP7A 2B63H 4JOIC 5G3LD 3H0GH 3ITPA 2NTTA 3Q6SA 4UHVA 1Y1WG 4A0UA 2WACA 3OTOQ 5IGEA 1GD7A 1Y14B 1PTOD 1I50H 5IYCH 2QDBA 3DUZA 1HUNA 2A6ED 5C0XG 3E0JA 2ZQUA 2Z8LA 1BF4A 4DF7A 2JXWA 1YI2A 4LF7Q 2OT2A 2HIXA 4Q5VA 2YSIA 1VF5C 4DNRB 4DR4Q 2DNCA 1CTMA 1C48A 3A5ZB 4GZYC 3K6OA 3UDXA 4OX9L 1PRTF 2OWOA 2K52A 3BZDB 2RBMA 1B7YB 5IT9E 2Z4IA 3KLSX 3CCUA 5HY6A 1GJXA 2XWJB 4WFN3 3WDNA 1OXUA 2LAJA 5E62A 1YNJD 1EWCA 2PCFB 5DM63 1H9SB 3I90A 2L12A 2QF7A 1JJCB 3U9OA 2M00A 2B2YA 3J81j 3L2PA 2JA5G 4PQXA 3NELA 4DR3L 5HGTA 5CV9A 1FNWA 3PGZA 2WP8J 5I9OA 1B3AA 2EYOA 2QW7A 4BBSH 1S72A 2WAQB 3OW2A 2XPAA 3VR6A 3OIQA 1K8AC 1HHVA 1EZ6A 1WCMG 1H9SA 4L5QA 4U68A 1KDAA 1Z47A 4NP5A 4DAYB 2RDFA 1KDBA 3N52A 2EY1A 2UUCQ 1EOVA 1D1KA 4H02A 3J80L 4A3DB 4JV5Q 2E74C 2EE1A 4RFBA 2R92G 4JVZA 5C3EH 2CKZB 2ZQTA 1Y8NB 4DV3Q 4UP8A 3HOUB 2SNMA 5E5WA 1B2TA 1B70B 4XT1B 1BOSA 3G6JB 5KNDA 1NMVA 1WMVA 5JJZA 4R4TA 4XT3B 2XP4A 3J81L 1SNQA 2NZHA 4MTKA 1WTXA 3QG1A 5AHTA 1QVFA 1AH9A 2B29A 4DAYA 1NR2A 4ZKCB 2B8GA 3DM1A 2R7ZH 3CNGA 4DV2L 1PYSB 3U58A 1FYCA 5J3BA 3JAML 3D31A 1KL9A 3RNUA 4JI5Q 1EIHA 1VQIA 1N36Q 1BQQT 2PI2A 4JI4Q 5C0XH 1EL0A 3H3VI 1XJVA 2CHBD 5C4JB 2E2HB 3KLSA 1GUGA 5AJ3L 4YY3L 1IYUA 2CWAA 1ZCNA 1ASYA 2OCEA 5JOBA 4K5VA 3FKIB 3KBGA 3SEBA 2NUCA 1LACA 4ZLTF 3C1FA 1YW5A 1Q86C 3TSSA 2B39A 2D5DA 3HOXB 4B3ML 2RSNA 3WOEA 3S1NH 4CKEA 1JB7A 3X3NA 2ZAJA 1LABA 2OTJA 3MTSA 5GQOA 4RGNA 4A3JH 1BUVT 3K59A 2FJ2A 2N78A 2EJMA 2XRSD 3RUZA 3ULLA 3GTKH 1FR3A 1E1OA 2D9UA 3VYSA 3MC0B 2NVQH 4JI0Q 1HR0Q 2B2UA 1TS3A 4A3CG 2HD3A 5FLMH 1IL8A 3IRBA 1G51A 1A2UA 2VQEL 3T1HL 1S40A 3VYRA 1H9MA 1QWYA 1WTHA 1OXSC 3AB9A 3VR4A 4A3EB 5JEAJ 1L0XB 2L4NA 3F2CA 3J81E 1RP5A 2N55A 2KXQA 5E65A 2QA4A 2OF1A 4C3IB 2UUAL 3CD6A 1VQ9A 3VR3A 3M4OB 1V1OA 3CRKC 1HNWL 3EBEA 3BVZA 3S1QH 1K83B 2F0KA 1R4QB 3LWUA 3OPOA 2YU9H 3STBC 1IZ6A 3MVVA 5C4XG 1X3PA 1PH3A 1AW7A 2BE5C 3AYHB 4X6AH 3QO2A 3UI2A 4KMUC 4AYBG 1F77A 2Q8TA 5NUCA 2ZJRA 4JI7Q 1CT1D 1BO0A 4LAAA 1L1OB 2WIIB 1J6QA 1STYA 3FDTA 4I7ZC 5M3MG 4A3GG 1NMFA 3D4RA 3GQBA 2IHFA 1N34Q 1GOZA 2JA8G 3KF6B 1GO3E 2BCOA 2F0IA 3FVQA 5FLXc 3IL8A 1LTLA 1EWIA 4ME5A 2AWNA 5BN4A 4FF4A 3CW2C 5G3LF 2ZTDA 4CBVA 4XYOA 3V2TA 1XNQL 1RCVD 1L1OA 1IHZA 5K5PA 1QZHA 3GTGH 1PTOF 2E2DC 2LS01 1LT6D 4CHTB 3KF6A 3IAYA 1PFNA 1SAPA 3QB3A 2SEBD 2ZQVA 3CMAA 2F4VQ 1VQHA 2KCTA 3I4MB 1L0WA 2RSOA 4KLKA 2R93G 2AUKA 3I4NB 1LM0A 2QCPX 1RHPA 3SDZA 1SBBB 5C44H 2K5VA 3ONAB 4IOAA 1B3QA 2RCFA 5IWAL 1Q90A 4X62Q 3DLLA 1HNXL 3AU7A 5JJKA 3X3MA 1EIGA 1PLFA 2LY7A 5L37A 2AHOB 4O42A 4DKAC 1II3A 1L0YB 1QCBD 4EX5A 4X65Q 4DR6Q 2F0LA 4B9WA 4RAUC 3TZDA 4DV1L 1ESRA 5ELCA 1CM9A 5AFWA 1EWHA 4TRDA 2AQ1B 1Q1BA 5KYIA 5DM73 1PFSA 3OMCA 4DV0Q 1ET6A 4Y7NH 1FJGQ 3A7AB 3GTPH 5ELEA 2ZM6L 3GTOB 1C7YA 4BWGB 1EU4A 2F0UA 5E4XA 1JT8A 1HFGA 4NDXA 1GUTA 1TWAH 3CCJA 4YCWA 3TRZA 4DR7L 3I70A 1EQRA 4G7HC 1BR9A 1W2BA 5GAGC 4DV7L 4IUTA 3G7LA 1XMQL 1TY2A 3U50C 3TDBA 2EXDA 5LHY1 5JJIA 2C35B 2JA6B 2JSOA 1EYAA 2N49A 2UXCL 1YEZA 4GLAC 1VQKA 4HJ9A 1B8AA 3D6WA 4DV6L 2O5IC 1F2YA 1PH9A 4OO1G 1JWMD 2PQAB 2L55A 1EU3A 1FL0A 3P75A 3SK8A 5LL6S 4JYAL 4IJHA 5C4XH 1M90C 1BBXC 3I55A 1IL2A 5HURA 1H9KA 2NZOA 1D7QA 3TQYA 1RF2D 3T13A 3ULJA 3PQHA 4B3RQ 2XSCA 1HQRD 1Q1EA 2AUJD 2Q2IA 5M3MH 1IBKL 4DR5Q 3KAIA 3I72A 2VL6A 3S1RB 3CCSA 2Z1CA 2PQAA 4LF4Q 2JA8H 1JOQA 4B3TQ 1BXTA 3VR5A 4OELB 1VQ5A 2WAQG 2Z6KC 1B9MA 3N6RA 5EPJA 3OWFA 3NWTA 2MUYA 3VYUA 3K80C 4IUNA 3T56B 1ET9A 3HGBA 2Z6BA 3UDIA 3HOWH 1TQOA 1Q82C 3L7ZC 1E22A 3D6CA 4A3DG 3KAFA 1SFOH 3A8KE 1D1IA 4XQJA 1Y8PB 5IGDA 4HTHA 3CKIB 3HOUG 2R7FA 2ZXOA 2H4OA 4HJ5A 2FMMA 1IW7D 3QOJA 2R93H 2QDLA 4K8IA 2A5HA 3TZUA 4A3FB 3LWEA 1EIFA 4LFAQ 1TS5A 1MIUA 4HR7B 2WFWA 1BBWA 3TBIB 4ZUIA 3ER0A 5J22A 1CHQD 1V43A 2QEJC 2F0JA 1UWVA 3KFUA 1I94L 1VQBA 2EIFA 1WOCA 3S15B 1Q8KA 3KYHC 3Q8DA 4JC0A 4E5RA 5E1FA 2KEEA 2EY6A 4C3HH 2CW0D 3V96A 3Q24A 1TIID 3F2DA 4DV5L 4FXGC 1VQ7A 2PYKA 3HOVB 2A1AA 4CDFC 2XPBA 3EIVA 4PMCA 3HOYB 4MN3A 1B50A 3FKIG 4LUZA 3K57A 3IFTA 1SMYD 3KADA 1PH5A 3H3VH 2UUCL 4YIJA 4F8MA 1K73C 3T1YL 2B2VA 4BY7B 4JV5L 2MP1A 1T5EA 3HOXG 1B53A 1X54A 5D65A 4DV3L 4DV4Q 2DUDA 1MJEA 1J8IA 1VQMA 1XYIA 2JQOA 5BR8Q 2PZTA 4JI6Q 4LK1C 2EY5A 1E3PA 1M8AA 1ZKOA 1BNZA 5JEAH 4LW1A 5C3XA 1PINA 2FINB 5FJ8G 4DAVA 1ONLA 4JI5L 1TXYA 3K81C 4WJ3M 4KK7A 1N33Q 1JMCA 4NMZA 4JI4L 4K6LA 1RODA 3S24A 4A3IH 1NCVA 1F8AB 1I6HB 2SOBA 3NXWA 5IODA 3TCZA 3F2UA 1EEID 1STGA 2R6GA 5M5YB 3S2HB 4NB3A 2F03A 1LT3D 1UE7A 1VQLA 5CV5A 3D3RA 4A3EG 1C4QA 1PFBA 2QEXA 2GN5A 3BYYB 2ID0A 1ML0D 3C1EA 1JB3A 2WAQE 4DR1Q 2UU9L 3H15A 4BY1H 3NK9A 4O1NA 4C3IG 1JR0D 4IPCA 5M5XB 2GA4B 4FF3A 3BYTB 2F0SA 1ZYRC 1IYVA 4KKSA 1J5EQ 1TKWB 1KXLA 4HIDA 1CHPD 3I91A 1KLGD 3T16A 1B9NA 2I5MX 3AFPA 3PO3H 1Y1VH 1XMOQ 1G91A 5CMDA 2JA7H 4KD3A 4TSSA 2SNSA 1FVIA 2PI2E 1L2FA 5ELOA 1TK7A 3ODKA 3CC7A 3E9IA 1SN8A 4HSVA 3I7FA 2YAJB 1EY5A 2D2CC 4JI0L 1FGUA 1HR0L 2V4DA 4DK6C 1ILPA 1I3QB 2M3OW 2NYZD 2A73B 4DK1A 3LNNA 5KRUA 2WADA 1WTVA 4KD4A 2B2WA 1TWHB 5FO9B 5C4JH 1G2TA 1DONA 2HQLA 2D62A 1K3BC 5JVH3 1BCPC 4OWTB 3CPWA 3LGJA 1TR8A 2VXWA 3M7NA 2O4XA 4KHZA 1I4PA 4N8FA 3K5NA 4LFBQ 5LMNQ 3FKIH 1LTRD 3S16B 1QVCA 3EQLC 5KNCA 2YTXA 4HAEA 4NXML 2XVSA 2F0DA 5JPMC 2KCCA 3I4MG 3RZOB 2JP1A 3MQHA 2HCIA 3BDCA 3I4NG 1YNJC 1TWFB 4FF2A 1ILQA 2ZXPA 4O0AA 1JJGA 4A93H 1I4XA 3ND9A 5DLQE 5EPLA 4G57A 2BDNA 4P73A 1ENAA 1TWGH 3NUCA 5CYUA 1EY7A 4RGOS 3CCMA 2RKSA 1CA6A 4C3JB 5IIFA 3GTLH 2R3ZA 1PXUA 1MSHA 3SHLA 4OEMB 1NY4A 1N34L 2ICEC 1HJPA 1DZ1A 4L5TA 5FLXL 2KCNA 3RD4A 5IP7G 5IYDG 4HMJA 4BBRB 4A3MB 1HA6A 2Y0SB 5GAEC 4KY5A 3D8GA 4A3EH 5M5WH 1YITA 3M3YH 2VUMH 1VQDA 1KAWA 1PYBA 1BVSA 2GVBA 2XWBB 3KUPA 3E3XA 1EY9A 5IGCA 4JPBW 1Y69U 2JEBI 3ICEA 1IKLA 2F4VL 3AEVA 3FSCA 1EUJA 4L8JA 4BXXH 5C5LA 2CQOA 2OQ0A 2YSHA 2GVAA 3WOFA 4MTNA 1C8CA 3GTJB 1N32Q 2NN6G 3H94A 1E1TA 3IFDA 1WTRA 4X62L 2F0PA 2G5DA 4WJ4A 1PMRA 1K9RA 1TU2B 1PHJA 1AFPA 1UE1A 1SNPA 1HR0W 4X3SA 1CZGA 5EBDA 1K8MA 4U84A 2KECA 5D3IB 3TEHB 3A55A 3ZYYX 3ERQA 5C4HA 3LX0A 4PZ6A 4DR6L 2JJQA 3CCLA 4IFDI 3F8TA 1B44D 1STAA 2B2TA 2RE3A 2IPKD 1Z7TA 3I4LA 4DV0L 4LUVA 1LTID 1FJGL 1HZBA 3PO2B 1SNCA 4RH6A 1OXTA 4DK3C 1DGSA 1KNEA 1HPCA 2RDHA 3E0EA 1LTAD 1VMPA 2NZ1D 5GROA 1NNXA 3SR1A 5C6AA 2K50A 2ZTEA 5HGQA 1A2TA 1CUKA 2DJGC 3Q23A 3K0XA 1PZJD 3CXCA 3CQZB 5IYBG 3RZDB 2J4XA 3FS8A 5ISRA 4F87A 1HCZA 3I4NH 2F4IA 2X6GA 4A3FG 2K14A 2E2JB 2J0TD 5FLXE 2LXJA 4IFDJ 2EVBA 1HA5A 2Q5AA 1QNKA 2EYMA 2MPMA 1N9WA 1SROA 2M8JA 2IX1A 2JK8A 1VCIA 1GUSA 3HOZB 2K5WA 2VNUD 2K32A 4JOIA 3GTQB 4B3RL 2XP6A 2PZWA 4LF8Q 4V0BA 5I6YA 2NVTH 1UUPA 4DR5L 1GXDC 1IBMQ 4LF4L 5M3FB 1QNUA 4B3TL 3MA2B 2VY3A 2UUBL 5IP7H 1S3OA 4IOCA 4XXEA 4UPAA 3SE0A 5IY0A 2NBFA 1Y1WH 4DFAA 1SYGA 3HOYG 4ZQ3A 4X3KA 4C56C 4HCEA 3Q0AA 4R1JA 3MHBA 4XYQA 5IP9G 4L63B 4BY7G 2IJ0A 3HRZC 4DAPA 1MSGA 1UAPA 2KJXA 3D0FA 3OIPA 3PF5A 1QVGA 1OXVA 4CKCA 2XGTA 2BOSA 4A3KB 2F0EA 2NVYH 1QOHA 4QUCA 3K7UC 4LFAL 1RIPA 4CDDC 4OWWB 4MHEA 1JE4A 4H13C 4IUPA 4OO1I 1SE3A 2MO1A 4HN7A 3FPPA 3W1GA 1K3RA 1EY8A 2ALYB 4I7AA 4C1NK 1UE6A 4HJ7A 3S14H 2I07B 4PZ7A 1BDOA 1ENCA 1AEXA 4K0KQ 3NBHB 4KHVA 4JI3Q 4A76A 4GNXC 2SDFA 3I73A 4E6IA 4EVOA 3M7GA 5E4WC 4JBMA 1NAPA 1A3TA 1JICA 4CJ0B 4GKJL 4UDUC 2BDOA 3CCEA 2JA5H 3MXUA 1R9TH 3J80E 3NBHA 2UXDQ 1YNNC 2Q8IB 3K7AB 1HNZL 4DV4L 1VQNA 2EYPA 3KF8B 2DGYA 4Q0FA 5KYLA 4DR2L 3DHQA 2KQ3A 5C4ZA 2EZ5W 3NWSA 3VR2A 2XP3A 1WCMH 4N9TA 4KI0A 4JI6L 2PW7A 2RCNA 4YWLA 1JQYD 1I4RA 5CV7A 2BH2A 1VQCA 1KLUD 1CK1A 2R92H 1Q12A 4MIUA 1KQSA 3W5OA 3JAME 3KF8A 2B63B 1LO5D 1N8RC 1LT5D 3H0GB 1JOKA 3G48A 4J1MA 2PNRC 1GM5A 1PYWD 4DN4M 4X64Q 1WTWA 1TVXA 3CAMA 1PA6A 4ZK9B 4IFDG 1CQFA 1QUQB 5U47A 1MHWC 1Z6HA 4KKTA 1EYCA 4G7OC 5IP9H 4ZRZA 1YVCA 1G2SA 3R2IA 1S5ED 4WJWA 4B08A 3A8IE 3TP5A 2EJFC 2F52A 1SE2A 3NTKA 3A5UA 3PQIA 1SYBA 5JAVA 1LV9A 3PIP3 1QUQA 1DYQA 2EQSA 4ABNA 2ZR6A 1AZQA 2YV5A 3C3LA 4A3LG 3RLNA 5I2XA 1O7IA 2XIWA 3FHWA 5E7NA 4GNXA 4C3JG 1PH8A 1P8LA 1CKMA 3M4YA 2RQXA 1PH4A 3J7AF 2KOLA 1LT4D 1X56A 3TP6A 1HH2P 1WYDA 4G4KA 2DWVA 1LLRD 1TT2A 1J9OA 2VB3X 4J6HA 1PRTC 2F3IA 4BBRG 4A3MG 2Y0SG 4OIJA 2RA4A 1KTKA 3MCBB 3RMHA 4TQUS 4LFBL 1S4ZA 3OMGA 1XWEA 3LKXB 3P20A 4PZ8A 5EJWA 4A3CH 4BBSB 3E5SA 2F3WA 3S2DH 1PFMA 5KEEA 3AQQA 3DWPA 1VQOA 1F2MA 1KAAA 5C3WA 2A68C 3TC5A 1KD1C 3KK7A 1IBLQ 4GN3B 2F0VA 3MCBA 1W6JA 3BDOA 1HFNA 2EDGA 1YJ9A 2K4KA 2X6LA 3LKXA 1GUOA 2B8FA 2E2IH 1V9PA 1RTNA 2KUMA 5C3EB 4A3BB 5I2YA 4HMIA 4OGQC 3DEOA 4HSPA 4IURA 4FVMA 1PVOA 4HEDA 4PG3A 1A63A 2MQHA 4EQPA 5GAHC 4PNYA 2ZT9C 1PDQA 2JV4A 3STBD 3PO2G 2N88A 1SE8A 5JPNC 1X55A 2R7ZB 3GTMH 2BE5D 2QRVA 1OO9B 4REXA 2A69C 1DOLA 5CQ2A 4FNFA 3OTOL 2HQEA 3MWYW 1X9NA 4PV1C 2JEAI 1CKNB 3S16H 3OOCA 4FF1A 2K6AA 1XTDA 4A3GH 1IXRA 1W6KA 1I6VC 4AYBE 4AQYQ 1XX8A 3W3AA 5CBEE 4LF7L 1Z9FA 1PTOH 5I6WA 1N32L 2RHSB 3TS2A 4DR4L 2RHQB 3NE5B 5CC4A 4ODGA 3CCRA 1QJOA 1CKNA 1STNA 4A3LH 3A8JE 5JVG3 3HOZG 1H9RA 3S1NB 4OXPA 4H7BA 2EZVA 4QIWB 1ZXTA 3NTHA 5BN3A 5K36G 4MZ9A 3PCOB 1WD0A 3S9WA 1TWCB 3S1MH 2EYJA 1RTOA 2LFNA 4A3JB 3GV3A 1DXMA 1G6ZA 1UEAB 3HKSA 3ND8A 3PUVA 1GUWA 4C2MH 3GTKB 3KJPA 4FO2A 1XPOA 2XN9C 4A3MH 1T9HA 4DV2Q 2H5XA 5LMNW 1CKOA 1GUNA 4LF6Q 1G291 2NVQB 4IALA 4HJAA 2K75A 2R7DA 2R61A 3WWVA 3K0YA 3BS1A 4B3SQ 1U4PA 1E2WA 3QOLA 2FXQA 5CORA 1VQ8A 3W2DA 4U86A 1VQAA 2Y0SE 1CSPA 1H95A 1QG7A 4X3TA 3CPFA 3QJYA 5LL6X 1VQFA 3GDEA 4YY3Q 3ZJYC 2ZJPA 4LMQD 1JCKB 2D0OA 4A3KG 1XNRQ 3M9BA 1WTPA 1AE2A 2VZAA 4POGA 1A0IA 3T53B 1G8ZD 2PZUA 3TS0A 2HIVA 4GKKQ 2NN6I 3D4WA 4B3MQ 5J39A 3KOJA 4RMFA 5I4DA 1XPRA 2OTLA 1A3VA 4LF8L 2YU9B 1E2VA 2LXKA 4CKBA 4K2KA 2MHVA 1IBML 3BZCA 2H1EA 4OO1H 4GS3A 4HCSA 2PQEA 3D4DA 3AMUA 1YHAA 4XTCS 1VS0A 1W3SA 1WFQA 2L0CA 1TS2A 2O2LD 2BA1A 1K28A 1S5FD 4K6DA 3I3CA 3NP8A 2A6HC 2Z6KA 1D5MC 2I46A 2VQEQ 4LF9Q 3A54A 2XP5A 2Z0SA 3M4PA 1VDZA 2ITKA 4RHSA 1N36L 3K8AA 1KIXA 4GOPC 4NW2A 1M1KC 4IQZA 5ELDA 5FO7B 1U9RA 2JE6I 5I9PA 3GTGB 3QR8A 4DA2A 4A75A 2C9OA 1K8GA 3MXPA 3HOZH 4A3DH 1D8LA 1HNWQ 2Q8RE 2XP8A 4LUOA 3PIO3 4N9PA 1FNUA 2BH8A 3HOUH 2VB2X 3TP8A 5C44B 2B63G 2CQAA 1YJWA 1QZGA 4RKLA 3H0GG 1VQPA 1SYFA 4K0KL 3PMFA 4JI3L 4TVAB 1CQVA 4J15A 1A8VA 3OSOA 2P5ZX 3GV6A 4JCVE 3CF5A 1PTOC 4FYDA 5IYCG 1Q81C 1NSNS 2N3SA 4KV6A 2A6EC 1LYLA 3DXJC 5LMUQ 2PMZB 1Q46A 2HHHQ 4Y7NB 3GTPB 1I5HW 2IL8A 4V190 2EYLA 3PV0A 2UXDL 5EBCA 1U4MA 4K14A 1TWAB 4JI8Q 3P7JA 4C1NI 3J7YW 2E2HH 4R4IA 1ICWA 1SSOA 3U9SA 1FLCA 1XNQQ 1HZCA 2WB1B 3K5OA 1F9QA 1TY0A 4OL7A 2N8NA 3CMEA 4JBJA 4R9WA 1SLJA 1NJIC 1C0AA 3ERSX 1PH1A 3HOXH 5CGKA 3KLRA 1GKHA 4H44C 4ZUJA 1VF7A 4EQOA 4ALPA 1EYDA 2B3GA 4QB4A 1M4VA 5J1ZA 1YZ6A 2D0PA 2IW3A 2ZQSA 4X64L 3BVGA 3PUWA 4XDXA 3SGIA 4ID6A 2KHJA 3RLOA 2F0NA 3H6MA 4RGMA 2HT1A 5EQ0A 3DMUA 5M3MB 4JI7L 1S5CD 5FJ8H 4BA1I 1EFWA 4CJ2C 3H3VC 2F0FA 1EY6A 4BBSG 4GN5A 2KA7A 4LFCQ 4QL5A 1GVPA 1TR5A 3UDGA 1F9SA 3R93A 1EQTA 3MFGA 2B2YC 4RCOA 4RKBA 2EPBA 3SK5A 1GHKA 1H9JA 4KHPQ 1Q7YC 4DV7Q 2K01A 3HOWB 5CV6A 2JX8A 1XPUA 5E66A 1SFOB 2IY5B 1SNMA 5EKIA 2BA0A 4QMGA 4JK1C 2M2LA 2L5TA 2UXCQ 1K8OA 5C3EG 4A3BG 3V05A 4C3IH 4NXNQ 3J7ZC 3T51B 2JA6G 2VS1A 1BCPB 3PUZA 1KC8C 2R93B 3CHBD 3NTIA 3M4OH 4K8JA 1O80A 3OOBA 1ZYRD 5KIXA 1K83H 4U673 3CU7A 2AQ2B 2ZJQA 1EG3A 4R4OA 2EXZA 4MNOA 4TKOB 3J80i 3O13A 2R7ZG 4DNTB 2V1CC 1STHA 3L0OA 2NVXB 2KCMA 4IPDA 1Q8IA 3CC4A 2EOTA 3OYYA 2K03A 3BVMA 3R3OA 1IBKQ 1I4GA 1HUMA 2AMCB 1D5XC 3R2TA 3FEWX 4X65L 2K5HA 1EG4A 4M1UB 1KABA 4C3HB 3J81i 2JA9A 5EKKA 3NTPA 5EAYA 4LNQA 4P72A 4EQNA 1EIYB 2M8IA 2IX0A 1IBLL 1BCPD 1VQEA 3JAMi 1DOKA 4GLXA 3TMEA 4GLVB 3DEPA 2PNHA 5A2QL 1YHQA 4IUUA 4DK0A 1RKNA 4HJ8A 1KDCA 1QE6A 4WRDA 3MAQA 5FK9C 2EYHA 3PUXA 4P2CB 2CH4W 4A0TA 1VQ6A 3W1BA 2F0WA 1EOTA 4A3JG 3I4MH 2Q2TA 1VQJA 3AFQA 4IN3A 1JC7A 1EQVA 4IJLA 3L9AX 1U5KA 3NBIA 1I94Q 5FLMG 4B9XA 2ES2A 4J8QA 1I5FA 4JI2Q 1LUZA 4UP7A 2MO0A 3I8ZA 1SNOA 1QB5D 4A3IB 1X3QA 4KN7C 5A35A 3EJIA 3MEFA 1CFMA 2RF4A 5COYA 4CDCC 3I56A 4IO9A 4DV5Q 3SK6A 1RJTA 2B2UC 4AQYL 2YSFA 3SVMA 4JI1Q 3A7LA 3GTOH 5IYDH 5KNBA 2JN4A 4YHHQ 2A19A 4X66Q 3HOVG 3EN2A 4KKUA 5D14A 4BY1B 2MDIA 3K58A 2Z9HA 1SJED 3T1YQ 2ZR4A 3KAGA 4RGTA 2KENA 4A3BH 4K2LA 3TN2A 1S5BD 3GD7A 2JA6H 4K5XA 3K5LA 5IGGA 1WTQA 4I65A 3PO3B 4R8IA 4POFA 1Y1VB 3MZ5A 2JA7B 2CCZA 2NN6H 2K05A 2A74C 3B6YA 5EPKA 2L15A 2JXMB 3DWQA 2XP9A 4N8X1 3URYA 1OXXK 3A0JA 3I2ZA
chains in the Genus database with same CATH topology
4LF6L 1PH2A 4AIMA 3PIOA 3HZXA 2AWOA 3HFZB 1SNDA 2KHIA 2I0QA 4B3SL 5A2QE 1HXYD 2OQKA 3KAHA 2RVLA 1SYEA 1E7ZA 1DD2A 3PSIA 3G71A 2K1BA 3S1RH 2F0TA 3L3OC 2NTSA 2G9HD 3PF4A 1T5XD 4L5SA 1MJCA 4WORA 2PPBC 1MD2D 2F0MA 1XNRL 3DM3A 2UU9Q 2VW9A 2L11A 1FNVA 4DUYQ 4GKKL 5CV8A 2I5HA 3HEJA 4IPHA 4DAMA 1L1OC 4DGZA 2LMCB 1K9QA 5IYBH 3FRPB 2ICIA 1TWCH 5C44G 3HKZB 1VQGA 3LE4A 4OWXB 4A93B 4G7ZC 3OHXC 4DUZQ 5BR8L 3S17B 4QIWE 4A3FH 4KN4C 2MFIA 2XRQD 5IGBA 3QWNA 2KEDA 1U4RA 3RLFA 1TWGB 3HG9A 2E8GA 5FKAC 2UXBQ 3GTLB 3G4SA 3PUYA 4F7XA 3NEMA 2PO4A 4CJ1B 4YCVA 4LF9L 4R8NA 1X3FA 3S15H 1MBYA 2F1MA 2DNEA 2JMFA 1N33L 2Q2HA 2OXPA 1A6XA 2WINB 4QF4A 4HIKA 5M5WB 3M3YB 2F3VA 2VUMB 5C5MA 3GO5A 2HUGA 4M8AA 1U0LA 5IT9c 4OIKA 3HOVH 2VQFQ 3UE0A 2ASBA 1JWUD 1I50B 1PZID 3E6ZX 4OHJA 5H1SE 2WB1G 3HOYH 1FD7D 2NWGA 4NXMQ 1NR4A 4DR1L 1C9OA 3BG3A 2O5JC 2F0OA 1X6OA 1O6WA 2KBNA 4BY7H 3NHHA 1I4HA 2WKCA 1K0RA 4GNXB 1ASZA 1JJ2A 3NQIA 3EVQA 2QILA 1J5EL 5M9OA 1STEA 2C5CA 4LF5Q 1XMOL 2EY2A 1HRJA 3F1ZA 2E5LQ 4JBWA 3I4OA 3ULPA 1PZKD 4O2DA 1RDPD 1JOOA 2HDMA 1SE4A 1SXTA 2DY8A 1O7YA 3C46A 1VMCA 4JBKA 3BJUA 2LKVA 5LMUL 1EQQA 4APVA 1X3GA 2HHHL 1YJNA 3CP0A 4EGVA 1D2BA 5IGFA 3CCVA 1U4LA 3RN5A 1NE3A 2YTYA 1I6HH 4JI8L 3J7A5 5M5YH 3S2HH 2K04A 1EEFD 4GN4B 1EZ8A 3HOWG 4DPGA 4ULLA 1D6EC 5LMNL 1EY0A 3NSWA 1EFID 2IX3A 2ATWA 2IWHA 1IKMA 1KRTA 1UE5A 4PMBA 1WI5A 1IW7C 5M5XH 5CBAE 4AH6A 2ZXRA 1D5ZC 4KTAA 1YNND 4QJFA 4FXDA 1CI3M 2E76C 5EGTA 4QUFA 2HCCA 2DY7A 4ZYSA 3FSBA 1IYJB 4OX9Q 1BCPF 3GP7A 1V1QA 5FOBB 1O78A 1ENFA 3MXNB 2RDGA 4R4CA 4CGYB 2KVMA 2NVTB 1HTPA 2K5NA 1JWSD 4NPSA 1E24A 1UEBA 1SDFA 5E64A 3U4VA 1I3QH 2CW0C 1B4OA 1RD9D 4C3HG 1JORA 3VDYA 2CVRA 4KY6A 3FP9A 3KDFB 4UP9A 4K5WA 4LFCL 1WVLA 1LTBD 2F0QA 4IUVA 5IOCA 1TWHH 2K5DA 2PMZE 3MQGA 1Y1WB 2L1BA 5CV4A 4UY8C 5DNFA 4KHPL 3MXNA 5CR3A 2ZTCA 1SMYC 1UNSA 1AN8A 2I5LX 4IFDH 4JG2A 4DR3Q 4FDBA 4KJOA 4ILWA 1CA5A 3KDFA 4NXNL 2DJYA 2DN8A 2WB1E 1PRTB 2FMCA 2NVYB 1P16A 3EROA 2B2VC 3RZOH 3RR5A 3U4ZA 5T1IA 4U85A 3BDLA 5JEAG 1TWFH 1DOMA 3J80c 2CFMA 1KRSA 4QY7A 2XTIA 1FGBD 1F9RA 4XQNA 1WTOA 3S14B 2L9HA 1YHBA 3H09A 4C3JH 3T4AC 4EQ5A 1X32A 4A3IG 3F2BA 2UUBQ 3KLWA 1SYCA 3SK4A 3NENA 2YSBA 2IT1A 3K5MA 4ZKBB 3J81c 5F2DA 5M3FG 3BU2A 3CCQA 2DMVA 4P75A 4FXKC 2EJGC 1NBWA 3EFXD 4BBRH 1V8QA 1PRTD 2L4JA 4BA2I 2ZR5A 4ME3A 1O7LA 3FPUB 2QKIC 4BY1G 3JAMc 3KJOA 1WR7A 2QGQA 2JA5B 1R9TB 1SJHD 4LJZC 4L5RC 3FMCA 4XQQA 3NQTA 4NKLA 4YWMA 2Q2UA 5AJ3Q 1HZ9A 3PO3G 4QIBA 2YSGA 1SYDA 1SR3A 1Y1VG 3OWEB 1WCMB 2A68D 5KGUA 3GTJH 2JA7G 1SEBD 4QGUA 2J7ZA 2TMPA 2FFKB 3R8BA 4RG1A 2AQ3B 2NVXH 3H91A 1F2LA 4RWSC 5DEHA 4DXGA 4F88A 2R92B 2LSSA 1VQ4A 2ENBA 2OEOA 2WAEA 2K28A 2PW5A 1MKHA 4IPGA 1NMGA 2MNAA 4JI2L 3OW7A 1ESFA 3S1QB 2Y8NB 5TSSA 5JJLA 4RCNA 4ZAIA 1PH6A 5C0XI 1E2ZA 3NPPA 3UE1A 1E0BA 4UAIA 1EY4A 2CWPA 4JI1L 3PO2H 1BKBA 1HTLD 2EYFA 4YHHL 4PMWA 4X66L 2B2WC 1KHIA 1OTCA 1DM0B 5DAUA 1XXGA 4GKJQ 2A69D 4DU9A 1AP0A 4Y52H 4P74A 1XTCD 2DK7A 1NUCA 2X69A 1CZWA 1YNXA 3T1HQ 1HNZQ 1DCZA 1MI2A 3MXGA 3J7AV 1PV4A 4DR2Q 3M85A 3CQZH 3RZDH 2NB0A 3A56A 3HKZG 4A93G 3CC2A 2MGSA 2IHEA 2AKWB 2E2JH 4IUQA 1K9MC 2UUAQ 4S3SA 3EA6A 1Q3LA 1F2ZA 1PH7A 4XIGS 5C0XJ 4DNIA 3GTQH 3TREA 2MJ8A 1EYGA 5K36H 1RL2A 2A8VA 5FO8B 2FHTA 4IZ8A 1WTQA 1BBUA 1CSQA 3L4HA 1X3EA 4KY7A 4YWKA 3Q22A 3PIPA 5M3FH 1A3UA 4HIOA 2KHSA 1A15A 5T1GA 2VUMG 4A4IA 1F9PA 4BS9A 4QCLA 1YIJA 2G9DA 4KJNA 3G6EA 1Y8OB 1LTGD 5D3DA 2K5QA 3S2DB 3MEHA 4DUYL 2XP7A 3VYTA 4Z9CB 4BXXG 2WV6D 2F0GA 1JMQA 3P1HA 3RN2A 1GHJA 3HS0C 2E75C 1A62A 4FP5D 1SRUA 2F21A 4A3KH 4LWCA 4DUZL 2E2IB 2YTVA 1TS4A 5ELFA 1DJRD 1ZEQX 2UXBL 3JC66 3QIAA 5ELBA 3M4QA 4GOPB 1STBA 5EKLA 1YBYA 1KNAA 3HP3A 3CRLC 5E3FA 1LTTD 4QQBX 1HZAA 2Z4HA 3BZKA 1B1ZA 4OONA 2YYZA 1X65A 1AE3A 3KABA 4YCUA 5C4XB 3KCEA 5IWAQ 1HNXQ 2JYOA 1HQMC 5GADC 1V1PB 2HDLA 3GTMB 2B2TC 4RHRA 4AYBB 1G6PA 5IT9L 2VQFL 4GOPA 3VA7A 2K7VA 3DWAA 1WD1A 1SMXA 4DV1Q 3KBXA 4P71A 4A3GB 3E9HA 3C2PA 2A6HD 4RA8A 2JA8B 1R4PB 1JE5A 1I4QA 3MFYA 2ZM6Q 1MGSA 3IKJA 1V1PA 3TDQA 3SXHA 1PTOB 3K7AH 2WKDA 3UDFA 3VA5A 4DXFA 4X3UA 1NTGA 1WJJA 4DR7Q 2DK1A 5BN5A 1O7ZA 1S5DD 3A74A 3WH0A 3S17H 1AZPA 4LF5L 1XMQQ 2E5LL 1QILA 2E45A 2K33A 3HKZE 4R4QA 2XNAC 2M9VA 2TSSA 4L6TB 2F0HA 3S1MB 4DV6Q 5ELNA 5IE8A 4HIMA 4H0LC 4C2MB 4JYAQ 1LTSD 3TP7A 2B63H 4JOIC 5G3LD 3H0GH 3ITPA 2NTTA 3Q6SA 1Y1WG 4A0UA 2WACA 3OTOQ 5IGEA 1GD7A 1Y14B 1PTOD 1I50H 5IYCH 2QDBA 3DUZA 1HUNA 2A6ED 5C0XG 3E0JA 2ZQUA 2Z8LA 1BF4A 4DF7A 2JXWA 1YI2A 4LF7Q 2OT2A 2HIXA 4Q5VA 2YSIA 1VF5C 4DNRB 4DR4Q 2DNCA 1CTMA 1C48A 4GZYC 3A5ZB 3K6OA 3UDXA 4OX9L 1PRTF 2OWOA 2K52A 3BZDB 2RBMA 5IT9E 1B7YB 2Z4IA 3KLSX 3CCUA 5HY6A 1GJXA 2XWJB 4WFN3 3WDNA 1OXUA 2LAJA 5E62A 1YNJD 1EWCA 2PCFB 5DM63 1H9SB 3I90A 2L12A 2QF7A 1JJCB 3U9OA 2M00A 2B2YA 3J81j 3L2PA 2JA5G 4PQXA 3NELA 4DR3L 5HGTA 5CV9A 1FNWA 3PGZA 2WP8J 5I9OA 1B3AA 2EYOA 4BBSH 1S72A 2WAQB 3OW2A 2XPAA 3VR6A 3OIQA 1K8AC 1HHVA 1EZ6A 1WCMG 1H9SA 4L5QA 4U68A 1KDAA 1Z47A 4NP5A 4DAYB 2RDFA 1KDBA 3N52A 2EY1A 2UUCQ 1EOVA 1D1KA 4H02A 3J80L 4A3DB 4JV5Q 2E74C 2EE1A 4RFBA 2R92G 5C3EH 2CKZB 2ZQTA 1Y8NB 4DV3Q 4UP8A 3HOUB 2SNMA 5E5WA 1B2TA 1B70B 4XT1B 1BOSA 3G6JB 5KNDA 1NMVA 1WMVA 5JJZA 4R4TA 4XT3B 2XP4A 3J81L 1SNQA 2NZHA 1WTXA 3QG1A 5AHTA 1QVFA 1AH9A 2B29A 4DAYA 1NR2A 4ZKCB 2B8GA 3DM1A 2R7ZH 3CNGA 4DV2L 1PYSB 3U58A 1FYCA 5J3BA 3JAML 3D31A 1KL9A 3RNUA 4JI5Q 1EIHA 1VQIA 1N36Q 1BQQT 2PI2A 4JI4Q 5C0XH 1EL0A 3H3VI 1XJVA 2CHBD 5C4JB 2E2HB 3KLSA 1GUGA 5AJ3L 4YY3L 1IYUA 2CWAA 1ZCNA 1ASYA 2OCEA 5JOBA 4K5VA 3FKIB 3KBGA 3SEBA 2NUCA 1LACA 4ZLTF 3C1FA 1YW5A 1Q86C 3TSSA 2B39A 2D5DA 3HOXB 4B3ML 2RSNA 3WOEA 3S1NH 4CKEA 1JB7A 3X3NA 2ZAJA 1LABA 2OTJA 3MTSA 5GQOA 4RGNA 4A3JH 1BUVT 3K59A 2FJ2A 2N78A 2EJMA 2XRSD 3RUZA 3ULLA 3GTKH 1FR3A 2D9UA 1E1OA 3VYSA 3MC0B 2NVQH 4JI0Q 1HR0Q 2B2UA 1TS3A 4A3CG 5FLMH 1IL8A 3IRBA 1G51A 1A2UA 2VQEL 3T1HL 1S40A 3VYRA 1H9MA 1QWYA 1OXSC 3AB9A 3VR4A 4A3EB 5JEAJ 1L0XB 2L4NA 3F2CA 3J81E 1RP5A 2N55A 2KXQA 5E65A 2QA4A 2OF1A 4C3IB 2UUAL 3CD6A 1VQ9A 3VR3A 3M4OB 1V1OA 3CRKC 1HNWL 3EBEA 3BVZA 3S1QH 1K83B 2F0KA 1R4QB 3LWUA 3OPOA 2YU9H 3STBC 1IZ6A 3MVVA 5C4XG 1X3PA 1PH3A 1AW7A 2BE5C 3AYHB 4X6AH 3QO2A 3UI2A 4KMUC 4AYBG 1F77A 2Q8TA 5NUCA 2ZJRA 4JI7Q 1CT1D 1BO0A 4LAAA 1L1OB 2WIIB 1J6QA 1STYA 3FDTA 4I7ZC 5M3MG 4A3GG 3D4RA 1NMFA 3GQBA 2IHFA 1N34Q 1GOZA 2JA8G 3KF6B 2F0IA 2BCOA 1GO3E 3FVQA 5FLXc 3IL8A 4ME5A 1EWIA 1LTLA 2AWNA 5BN4A 4FF4A 5G3LF 3CW2C 2ZTDA 4CBVA 4XYOA 3V2TA 1XNQL 1RCVD 1L1OA 1IHZA 5K5PA 1QZHA 3GTGH 1PTOF 2E2DC 2LS01 1LT6D 4CHTB 3IAYA 3KF6A 1PFNA 1SAPA 3QB3A 2SEBD 2ZQVA 3CMAA 2F4VQ 1VQHA 2KCTA 3I4MB 1L0WA 2RSOA 4KLKA 2R93G 2AUKA 3I4NB 1LM0A 2QCPX 1RHPA 3SDZA 1SBBB 5C44H 2K5VA 3ONAB 4IOAA 5JJKA 5IWAL 1Q90A 4X62Q 3DLLA 1HNXL 3AU7A 3X3MA 1EIGA 1PLFA 2LY7A 2AHOB 4O42A 4DKAC 1II3A 1L0YB 1QCBD 4EX5A 4X65Q 4DR6Q 2F0LA 4B9WA 4RAUC 3TZDA 4DV1L 1ESRA 5ELCA 1CM9A 5AFWA 1EWHA 4TRDA 2AQ1B 1Q1BA 5KYIA 5DM73 3OMCA 1PFSA 4DV0Q 1ET6A 4Y7NH 1FJGQ 3A7AB 3GTPH 5ELEA 2ZM6L 3GTOB 1C7YA 4BWGB 1EU4A 2F0UA 5E4XA 1JT8A 1HFGA 4NDXA 1GUTA 1TWAH 3CCJA 4YCWA 3TRZA 4DR7L 3I70A 1EQRA 4G7HC 1BR9A 1W2BA 5GAGC 4DV7L 4IUTA 3G7LA 1XMQL 1TY2A 3U50C 3TDBA 2EXDA 5LHY1 5JJIA 2C35B 2JA6B 2JSOA 1EYAA 2N49A 2UXCL 1YEZA 4GLAC 1VQKA 4HJ9A 1B8AA 3D6WA 4DV6L 2O5IC 1F2YA 4OO1G 1PH9A 1JWMD 2PQAB 2L55A 1EU3A 3P75A 1FL0A 3SK8A 5LL6S 4JYAL 4IJHA 5C4XH 1M90C 1BBXC 3I55A 1IL2A 5HURA 1H9KA 2NZOA 1D7QA 3TQYA 1RF2D 3T13A 3ULJA 3PQHA 4B3RQ 2XSCA 1HQRD 1Q1EA 2AUJD 2Q2IA 5M3MH 1IBKL 4DR5Q 3KAIA 3I72A 2VL6A 3S1RB 1JOQA 2Z1CA 2PQAA 3CCSA 4LF4Q 2JA8H 4B3TQ 1BXTA 3VR5A 1VQ5A 2WAQG 2Z6KC 1B9MA 3N6RA 5EPJA 3OWFA 3NWTA 2MUYA 3VYUA 3K80C 4IUNA 3T56B 1ET9A 3HGBA 3UDIA 3HOWH 1TQOA 1Q82C 3L7ZC 1E22A 3D6CA 4A3DG 3KAFA 1SFOH 3A8KE 1D1IA 4XQJA 1Y8PB 5IGDA 4HTHA 3CKIB 3HOUG 2ZXOA 2R7FA 2H4OA 4HJ5A 2FMMA 1IW7D 3QOJA 2R93H 4K8IA 2A5HA 3TZUA 4A3FB 3LWEA 1EIFA 4LFAQ 1TS5A 1MIUA 4HR7B 2WFWA 1BBWA 3TBIB 4ZUIA 3ER0A 5J22A 1CHQD 1V43A 2QEJC 2F0JA 1UWVA 3KFUA 1I94L 1VQBA 2EIFA 1WOCA 3S15B 1Q8KA 3KYHC 3Q8DA 4JC0A 4E5RA 5E1FA 2KEEA 2EY6A 4C3HH 2CW0D 3V96A 3Q24A 1TIID 3F2DA 4DV5L 4FXGC 1VQ7A 2PYKA 3HOVB 2A1AA 2XPBA 3EIVA 4PMCA 3HOYB 4MN3A 1B50A 3FKIG 4LUZA 3K57A 3IFTA 1SMYD 3KADA 1PH5A 3H3VH 2UUCL 4YIJA 4F8MA 1K73C 3T1YL 2B2VA 4BY7B 4JV5L 2MP1A 1T5EA 3HOXG 1B53A 1X54A 5D65A 4DV3L 4DV4Q 2DUDA 1J8IA 1MJEA 1VQMA 1XYIA 2JQOA 5BR8Q 2PZTA 4JI6Q 4LK1C 2EY5A 1E3PA 1M8AA 1ZKOA 1BNZA 5JEAH 4LW1A 5C3XA 1PINA 2FINB 5FJ8G 4DAVA 1ONLA 4JI5L 1TXYA 3K81C 4WJ3M 4KK7A 1N33Q 1JMCA 4NMZA 4JI4L 4K6LA 1RODA 3S24A 4A3IH 1NCVA 1F8AB 1I6HB 2SOBA 3NXWA 5IODA 3TCZA 3F2UA 1EEID 1STGA 2R6GA 5M5YB 3S2HB 4NB3A 2F03A 1LT3D 1UE7A 1VQLA 5CV5A 3D3RA 4A3EG 1C4QA 1PFBA 2QEXA 2GN5A 2ID0A 3BYYB 1ML0D 3C1EA 1JB3A 2WAQE 4DR1Q 2UU9L 3H15A 4BY1H 3NK9A 4O1NA 4C3IG 1JR0D 4IPCA 5M5XB 2GA4B 4FF3A 3BYTB 2F0SA 1ZYRC 1IYVA 4KKSA 1J5EQ 1TKWB 1KXLA 4HIDA 1CHPD 3I91A 1KLGD 3T16A 1B9NA 2I5MX 3AFPA 3PO3H 1Y1VH 1XMOQ 1G91A 5CMDA 2JA7H 4KD3A 4TSSA 2SNSA 1FVIA 2PI2E 1L2FA 5ELOA 1TK7A 3ODKA 3CC7A 3E9IA 4HSVA 1SN8A 3I7FA 2YAJB 1EY5A 2D2CC 4JI0L 1FGUA 1HR0L 2V4DA 4DK6C 1ILPA 1I3QB 2M3OW 2NYZD 2A73B 4DK1A 3LNNA 5KRUA 2WADA 1WTVA 4KD4A 2B2WA 1TWHB 5FO9B 1G2TA 5C4JH 1DONA 2HQLA 2D62A 5JVH3 1BCPC 4OWTB 3CPWA 3LGJA 1TR8A 2VXWA 3M7NA 2O4XA 4KHZA 1I4PA 3K5NA 4LFBQ 5LMNQ 3FKIH 1LTRD 3S16B 1QVCA 3EQLC 5KNCA 2YTXA 4HAEA 4NXML 2XVSA 2F0DA 5JPMC 2KCCA 3I4MG 3RZOB 2JP1A 3MQHA 2HCIA 3BDCA 3I4NG 1YNJC 1TWFB 4FF2A 1ILQA 2ZXPA 4O0AA 1JJGA 4A93H 1I4XA 3ND9A 5DLQE 5EPLA 4G57A 2BDNA 4P73A 1ENAA 5CYUA 3NUCA 1TWGH 1EY7A 4RGOS 3CCMA 2RKSA 1CA6A 4C3JB 5IIFA 3GTLH 2R3ZA 1PXUA 1MSHA 3SHLA 1NY4A 1N34L 2ICEC 1HJPA 1DZ1A 4L5TA 5FLXL 2KCNA 3RD4A 5IP7G 5IYDG 4HMJA 4BBRB 4A3MB 1HA6A 2Y0SB 5GAEC 4KY5A 3D8GA 4A3EH 5M5WH 1YITA 3M3YH 2VUMH 1VQDA 1KAWA 1PYBA 1BVSA 2GVBA 2XWBB 3KUPA 1EY9A 5IGCA 1Y69U 2JEBI 3ICEA 1IKLA 2F4VL 3AEVA 3FSCA 4L8JA 1EUJA 4BXXH 5C5LA 2CQOA 2OQ0A 2YSHA 2GVAA 3WOFA 4MTNA 1C8CA 3GTJB 1N32Q 2NN6G 3H94A 1E1TA 3IFDA 1WTRA 4X62L 2F0PA 4WJ4A 1PMRA 1K9RA 1TU2B 1PHJA 1AFPA 1UE1A 1SNPA 1HR0W 4X3SA 1CZGA 5EBDA 1K8MA 4U84A 2KECA 5D3IB 3TEHB 3A55A 3ZYYX 3ERQA 5C4HA 3LX0A 4PZ6A 4DR6L 4IFDI 2JJQA 3CCLA 3F8TA 1B44D 1STAA 2B2TA 2RE3A 2IPKD 1Z7TA 3I4LA 4DV0L 4LUVA 1LTID 1FJGL 3PO2B 1HZBA 1SNCA 4RH6A 1OXTA 4DK3C 1DGSA 1KNEA 1HPCA 2RDHA 3E0EA 1LTAD 1VMPA 2NZ1D 5GROA 3SR1A 5C6AA 2K50A 2ZTEA 5HGQA 1A2TA 1CUKA 3Q23A 3K0XA 1PZJD 3CXCA 3CQZB 5IYBG 3RZDB 2J4XA 3FS8A 5ISRA 4F87A 1HCZA 3I4NH 2F4IA 2X6GA 4A3FG 2E2JB 2K14A 2J0TD 5FLXE 4IFDJ 2LXJA 2EVBA 1HA5A 2Q5AA 1QNKA 2EYMA 2MPMA 1N9WA 1SROA 2M8JA 2IX1A 2JK8A 1VCIA 1GUSA 3HOZB 2K5WA 2VNUD 2K32A 4JOIA 3GTQB 4B3RL 2XP6A 2PZWA 4LF8Q 4V0BA 5I6YA 2NVTH 1UUPA 4DR5L 1GXDC 1IBMQ 4LF4L 5M3FB 1QNUA 4B3TL 3MA2B 2VY3A 2UUBL 5IP7H 1S3OA 4IOCA 4XXEA 4UPAA 3SE0A 5IY0A 2NBFA 1Y1WH 4DFAA 1SYGA 3HOYG 4ZQ3A 4X3KA 4C56C 4HCEA 3Q0AA 4R1JA 3MHBA 4XYQA 5IP9G 4L63B 4BY7G 2IJ0A 3HRZC 4DAPA 1MSGA 1UAPA 2KJXA 3D0FA 3OIPA 3PF5A 1QVGA 1OXVA 4CKCA 2XGTA 2BOSA 4A3KB 2F0EA 2NVYH 1QOHA 4QUCA 3K7UC 4LFAL 1RIPA 4OWWB 4MHEA 1JE4A 4H13C 4IUPA 4OO1I 1SE3A 2MO1A 4HN7A 3FPPA 3W1GA 1K3RA 1EY8A 2ALYB 4C1NK 1UE6A 4HJ7A 3S14H 2I07B 4PZ7A 1BDOA 1ENCA 1AEXA 4K0KQ 3NBHB 4KHVA 4JI3Q 4A76A 4GNXC 2SDFA 3I73A 4E6IA 4EVOA 3M7GA 5E4WC 4JBMA 1NAPA 1A3TA 1JICA 4CJ0B 4GKJL 4UDUC 2BDOA 3CCEA 2JA5H 3MXUA 1R9TH 3J80E 3NBHA 2UXDQ 1YNNC 2Q8IB 3K7AB 1HNZL 4DV4L 1VQNA 2EYPA 3KF8B 4Q0FA 2DGYA 5KYLA 4DR2L 3DHQA 2KQ3A 5C4ZA 2EZ5W 3NWSA 3VR2A 2XP3A 1WCMH 4N9TA 4KI0A 4JI6L 2PW7A 2RCNA 4YWLA 1JQYD 1I4RA 5CV7A 2BH2A 1VQCA 1KLUD 1CK1A 2R92H 1Q12A 4MIUA 1KQSA 3JAME 3W5OA 3KF8A 2B63B 1LO5D 1N8RC 1LT5D 3H0GB 1JOKA 4J1MA 3G48A 2PNRC 1GM5A 1PYWD 4DN4M 4X64Q 1WTWA 1TVXA 3CAMA 1PA6A 4ZK9B 4IFDG 1CQFA 1QUQB 5U47A 1Z6HA 4KKTA 1EYCA 4G7OC 5IP9H 4ZRZA 1YVCA 1G2SA 3R2IA 1S5ED 4WJWA 4B08A 3A8IE 3TP5A 2EJFC 2F52A 1SE2A 3NTKA 3A5UA 1SYBA 5JAVA 1LV9A 3PIP3 1QUQA 1DYQA 2EQSA 4ABNA 2ZR6A 1AZQA 3C3LA 2YV5A 4A3LG 3RLNA 5I2XA 1O7IA 2XIWA 3FHWA 5E7NA 4GNXA 4C3JG 1PH8A 1P8LA 3M4YA 1CKMA 2RQXA 1PH4A 3J7AF 2KOLA 1LT4D 1X56A 3TP6A 1HH2P 4G4KA 1WYDA 2DWVA 1LLRD 1TT2A 1J9OA 2VB3X 4J6HA 1PRTC 2F3IA 4BBRG 4A3MG 2Y0SG 4OIJA 2RA4A 1KTKA 3MCBB 3RMHA 4TQUS 4LFBL 1S4ZA 3OMGA 1XWEA 3LKXB 3P20A 4PZ8A 5EJWA 4A3CH 4BBSB 3E5SA 2F3WA 3S2DH 1PFMA 5KEEA 3AQQA 3DWPA 1VQOA 1F2MA 1KAAA 5C3WA 2A68C 3TC5A 1KD1C 3KK7A 1IBLQ 4GN3B 2F0VA 3MCBA 1W6JA 3BDOA 1HFNA 2EDGA 1YJ9A 2K4KA 2X6LA 3LKXA 1GUOA 2B8FA 2E2IH 1V9PA 1RTNA 2KUMA 5C3EB 4A3BB 5I2YA 4HMIA 4OGQC 3DEOA 4HSPA 4IURA 4FVMA 1PVOA 4HEDA 4PG3A 1A63A 4EQPA 2MQHA 5GAHC 4PNYA 2ZT9C 1PDQA 2JV4A 3STBD 3PO2G 2N88A 5JPNC 1SE8A 1X55A 2R7ZB 3GTMH 2BE5D 2QRVA 1OO9B 4REXA 2A69C 1DOLA 5CQ2A 4FNFA 3OTOL 2HQEA 3MWYW 1X9NA 4PV1C 2JEAI 1CKNB 3S16H 3OOCA 4FF1A 2K6AA 1XTDA 4A3GH 1IXRA 1W6KA 1I6VC 4AYBE 4AQYQ 1XX8A 3W3AA 5CBEE 4LF7L 1Z9FA 1PTOH 5I6WA 1N32L 2RHSB 3TS2A 4DR4L 5CC4A 3NE5B 2RHQB 4ODGA 3CCRA 1QJOA 1CKNA 1STNA 4A3LH 3A8JE 5JVG3 3HOZG 1H9RA 3S1NB 4OXPA 4H7BA 2EZVA 4QIWB 1ZXTA 3NTHA 5BN3A 5K36G 4MZ9A 1WD0A 3PCOB 3S9WA 1TWCB 3S1MH 2EYJA 1RTOA 2LFNA 4A3JB 3GV3A 1DXMA 1G6ZA 1UEAB 3HKSA 3ND8A 3PUVA 1GUWA 4C2MH 3GTKB 3KJPA 4FO2A 1XPOA 2XN9C 4A3MH 1T9HA 4DV2Q 2H5XA 5LMNW 1CKOA 1GUNA 2NVQB 1G291 4LF6Q 4IALA 4HJAA 2K75A 2R7DA 2R61A 3WWVA 3K0YA 3BS1A 4B3SQ 1U4PA 1E2WA 3QOLA 5CORA 2FXQA 1VQ8A 3W2DA 4U86A 1VQAA 2Y0SE 1CSPA 1H95A 1QG7A 4X3TA 3CPFA 3QJYA 5LL6X 1VQFA 3GDEA 4YY3Q 3ZJYC 2ZJPA 4LMQD 1JCKB 2D0OA 4A3KG 1XNRQ 3M9BA 1WTPA 1AE2A 2VZAA 4POGA 1A0IA 3T53B 1G8ZD 2PZUA 3TS0A 2HIVA 4GKKQ 2NN6I 3D4WA 4B3MQ 5J39A 3KOJA 4RMFA 5I4DA 1XPRA 2OTLA 1A3VA 4LF8L 2YU9B 1E2VA 2LXKA 4CKBA 4K2KA 2MHVA 1IBML 3BZCA 2H1EA 4OO1H 4GS3A 4HCSA 2PQEA 3D4DA 3AMUA 1YHAA 4XTCS 1VS0A 1W3SA 2L0CA 1WFQA 1TS2A 2O2LD 2BA1A 1S5FD 4K6DA 3I3CA 3NP8A 2A6HC 2Z6KA 1D5MC 2I46A 2VQEQ 4LF9Q 3A54A 2XP5A 2Z0SA 3M4PA 1VDZA 2ITKA 4RHSA 1N36L 3K8AA 1KIXA 4GOPC 4NW2A 1M1KC 4IQZA 5ELDA 5FO7B 1U9RA 2JE6I 5I9PA 3GTGB 4DA2A 4A75A 2C9OA 1K8GA 3MXPA 3HOZH 4A3DH 1D8LA 1HNWQ 2Q8RE 2XP8A 3PIO3 4LUOA 4N9PA 1FNUA 2BH8A 3HOUH 2VB2X 3TP8A 5C44B 2B63G 2CQAA 1YJWA 1QZGA 4RKLA 3H0GG 1VQPA 1SYFA 4K0KL 3PMFA 4JI3L 4TVAB 1CQVA 4J15A 1A8VA 3OSOA 3GV6A 4JCVE 3CF5A 1PTOC 4FYDA 5IYCG 1Q81C 1NSNS 4KV6A 2N3SA 2A6EC 1LYLA 3DXJC 5LMUQ 2PMZB 1Q46A 2HHHQ 4Y7NB 3GTPB 1I5HW 2IL8A 4V190 2EYLA 3PV0A 2UXDL 5EBCA 1U4MA 4K14A 1TWAB 4JI8Q 3P7JA 4C1NI 3J7YW 2E2HH 4R4IA 1ICWA 1SSOA 3U9SA 1FLCA 1XNQQ 1HZCA 2WB1B 3K5OA 1F9QA 1TY0A 4OL7A 2N8NA 3CMEA 4JBJA 4R9WA 1SLJA 1NJIC 1C0AA 3ERSX 1PH1A 3HOXH 5CGKA 3KLRA 4H44C 1GKHA 4ZUJA 1VF7A 4EQOA 4ALPA 1EYDA 4QB4A 2B3GA 1M4VA 5J1ZA 1YZ6A 2IW3A 2D0PA 2ZQSA 4X64L 3BVGA 3PUWA 4XDXA 3SGIA 4ID6A 2KHJA 3RLOA 2F0NA 3H6MA 4RGMA 2HT1A 5EQ0A 3DMUA 5M3MB 4JI7L 1S5CD