3M7NA

Archaeoglobus fulgidus exosome with rna bound to the active site
Total Genus 42
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
42
sequence length
179
structure length
179
Chain Sequence
MRFVMPGDRIGSAEEYVKGEGVYEEGGELFAAVAGKLIIKDRVAKVESISPIPEIVKGDVVLGRVVDLRNSIALIEVSSKKGENRGPSNRGIGILHVSNVDEGYVKEISEAVGYLDILKARVIGDNLRLSTKEEEMGVLRALCSNCKTEMVREGDILKCPECGRVEKRKISTDYGKGEW
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Quantitative analysis of processive RNA degradation by the archaeal RNA exosome
pubmed doi rcsb
source organism Archaeoglobus fulgidus
molecule tags Hydrolase/rna
molecule keywords Putative uncharacterized protein AF_0206
total genus 42
structure length 179
sequence length 179
chains with identical sequence B, C
ec nomenclature
pdb deposition date 2010-03-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF10447 EXOSC1 Exosome component EXOSC1/CSL4
A PF14382 ECR1_N Exosome complex exonuclease RRP4 N-terminal region
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.20.70.10 Mainly Beta Single Sheet Ubiquitin Ligase Nedd4; Chain: W; Ubiquitin Ligase Nedd4; Chain: W; 3m7nA03
2.40.50.100 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 3m7nA01
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 3m7nA02
4NPSA 5IWAQ 1MJEA 1H9KA 4L5TA 1YNJC 5BR8L 2MO1A 2JA7H 1K9QA 4X62Q 4K0KQ 2JXMB 1VDZA 1J5EQ 1YJWA 4B3RQ 4A3IH 4KKSA 3F8TA 3GTLH 1NMVA 4QGUA 4PV1C 4LF5L 1N33Q 2N78A 2B63G 1XNRQ 3NTPA 3HOUG 3AFQA 4DV0Q 4QJFA 4QIWE 2LMCB 4JV5Q 3VR5A 1Q46A 1FJGL 3KAGA 1O7LA 2BH2A 3GQBA 1WOCA 2PCFB 1HNXQ 3IFTA 4AIMA 5JJKA 1K8GA 2H5XA 4POGA 3RLOA 2UUCQ 4JI5L 1K9RA 1GUNA 2JA6G 1A63A 2VL6A 3CCQA 2DWVA 1LM0A 4WJ4A 2RHQB 2MO0A 3OTOQ 4KN7C 1VQEA 4OWTB 3E9IA 2L5TA 2K7VA 4HJ5A 2IX0A 4RG1A 3I4LA 1PH1A 4DV4L 2CCZA 2OQ0A 1B9NA 2EDGA 3OW7A 2B8GA 1G51A 3K7UC 1EG3A 5JEAJ 1Y1VH 3U58A 5BN4A 1GJXA 2UUBL 1HNWL 3S17H 5IP9G 1PH7A 2HQLA 3I55A 2NN6H 2MQHA 2UUCL 1PH3A 4XTCS 2YSIA 1HR0L 3CNGA 2XP7A 1O6WA 1KQSA 2AMCB 4A3MH 1HNXL 1OXUA 2Q2IA 1S3OA 3H3VI 3I56A 4DR4L 3KOJA 3I4MH 4HIOA 3GTKH 4JV5L 1YHBA 3KF8B 4L5RC 3U50C 1X6OA 3DM3A 1PH2A 2VS1A 4JG2A 1IL2A 3N6RA 3RLNA 4NXNL 4BY1G 3S2DH 4JI2L 2ZR5A 2OWOA 4DV5Q 3S14H 1HZAA 5IYBH 1HZCA 2VUMH 1FYCA 5J3BA 4A93H 1V8QA 1VQLA 4H13C 2LAJA 3CCUA 5E7NA 1SR3A 4R4IA 3AB9A 1IW7C 4U86A 3NEMA 3KYHC 1ONLA 4DV6Q 1NMGA 1TWGH 4DV2Q 1XNQL 1TWCH 2ZJRA 3HKZG 1Z7TA 4LFCL 5GADC 2NN6I 1PH4A 1O7IA 1B9MA 1TXYA 2E8GA 3NELA 4GOPB 1QUQB 2XTIA 1LTLA 2EJMA 1MJCA 3CW2C 3J81i 1E1OA 1HZBA 3B6YA 4YWKA 1HNZL 4OWWB 4ALPA 2KBNA 2E2HH 1OXSC 3J7ZC 2R93G 3FKIG 3I7FA 2F4VQ 4A3GH 3TEHB 2PQAA 3CPWA 1ASYA 3PUYA 1YZ6A 3CCRA 1GHKA 1IBLL 1C9OA 2K5HA 1CKNA 1D7QA 4O0AA 1VQIA 4MNOA 4DR2Q 3FHWA 2A1AA 3TCZA 1Y1VG 4IPDA 3K80C 2YTVA 1EG4A 3W5OA 4UP9A 1KRSA 2ZQUA 2C35B 1PMRA 1IBLQ 5LMNW 1PH6A 2RF4A 3MEFA 2E2JH 1BKBA 4DV1Q 5M5XH 3A8IE 1PYBA 3GO5A 1KC8C 2ZR4A 3HOWG 5M3FG 1W3SA 2B3GA 3KJPA 3MFYA 2F4VL 3OW2A 1AE3A 2EJGC 4LK1C 3M85A 3PUZA 2GN5A 3G48A 3KABA 1X9NA 2E5LL 2PI2E 4APVA 4P74A 4HJ8A 1Q82C 1TKWB 1Y1WG 4DV0L 2JA5H 1I3QH 3F1ZA 4IPCA 2DJYA 1LUZA 3AQQA 4LF5Q 4J15A 3CMAA 1Q12A 5C0XJ 4LUZA 2V1CC 2ZQVA 1LABA 1PYSB 1NE3A 1XPRA 2AUJD 2D2CC 5M3MH 1ZCNA 3FKIH 4XIGS 4A3MG 1WMVA 1LACA 4DV7Q 1YBYA 4A3FH 2A6HC 1Y8PB 3ODKA 1Q1EA 4HJAA 2NVTH 3QJYA 5M5YH 1BBWA 3HOXH 1N32L 1JJ2A 2JA6H 4A76A 2YSFA 4P72A 3VDYA 4HJ7A 1KAWA 2PMZE 5C4XH 1QUQA 4GKKQ 4DAYB 3ND8A 3S1NH 1N36Q 1VQGA 1VQMA 2L15A 2ES2A 4LWCA 2IX1A 1GKHA 4C2MH 4DR7L 4BXXH 2RHSB 1YIJA 1YW5A 4IFDH 2BE5C 1PFSA 4TVAB 4OWXB 5K36H 1I50H 4U85A 4IFDI 1X65A 4OXPA 2UXDL 1U5KA 5C44G 4X64L 3GDEA 1D8LA 1GHJA 1XPUA 5LMNL 4UPAA 4X65L 3I73A 1UE1A 1S72A 4C3IH 1A6XA 1O78A 4TKOB 1CSPA 1L1OB 1GM5A 2YSGA 4JBJA 2WAQE 2WB1E 4DAMA 3PO3H 4GLXA 5JJLA 1WR7A 3HKSA 2A8VA 4KKTA 2VZAA 4DR2L 4JOIA 1IBML 4B3SQ 4DR1Q 1EIFA 3K7AH 3M9BA 5LMNQ 3AEVA 4A3JG 3STBD 2I0QA 2NZHA 1SMYC 3ZJYC 1X54A 2E74C 3CC4A 2I5HA 2Y0SE 2XP3A 4AYBG 3GTPH 4A3KH 1K9MC 1KHIA 2WB1G 3G71A 2AWOA 3BJUA 2HIXA 3ULJA 2UU9Q 2ALYB 2ZM6Q 1XTDA 4HIMA 2Q2TA 1XNQQ 3F2DA 5AJ3L 5M5WH 4TQUS 4E5RA 3FPPA 1VF5C 2V4DA 4H02A 1QVFA 2NVXH 2AUKA 3EIVA 2BA1A 1A62A 1YHQA 2NVQH 4LF7Q 5AJ3Q 4JI0Q 5JJIA 4JI1Q 4YHHQ 1I5FA 1J6QA 4JYAL 3Q8DA 1EWHA 1QZHA 5JEAH 1BVSA 3T1HL 2UUBQ 5EAYA 4LUVA 2FXQA 5FJ8G 1ZKOA 4YCVA 4HIDA 2EIFA 2K5NA 3JAMc 3L2PA 3S1MH 3F2BA 3ND9A 3TS0A 4GNXB 4X62L 4K0KL 4KN4C 1X3EA 3D31A 1OXXK 4PG3A 4FDBA 4JI7Q 4L8JA 2JEBI 3H3VH 1IXRA 3RNUA 3A8JE 4LFAQ 1A8VA 1VQBA 2NN6G 5DLQE 4B3TQ 2K5VA 2BA0A 1YEZA 4BBSH 4DR1L 3M4PA 4JI4Q 1V43A 2QGQA 4DK1A 1S40A 3H0GH 1PINA 1VQ5A 2EVBA 2ID0A 3JAMi 3S1RH 4DNRB 1TWFH 4A3GG 1K3RA 1UE5A 3CCMA 1H9RA 1E2VA 5H1SE 4YY3L 4YWLA 4IJHA 3FMCA 4R4QA 4UY8C 5A35A 1R9TH 3KFUA 1G6PA 4JI6L 1VCIA 1T5EA 1MKHA 4GLAC 1GUSA 2D5DA 4LF7L 2YV5A 4DV4Q 4DR3L 2BDOA 1CKNB 5HY6A 3TZUA 3UDIA 1PH8A 4A3CG 5C44H 3CCLA 4A3DG 1YVCA 4QY7A 4DR5L 4L5QA 4OO1G 2VUMG 1UEBA 5IP9H 1IYVA 3EN2A 1KRTA 3P20A 2AKWB 4GS3A 2VQFQ 1YHAA 3VR2A 4G7HC 1HPCA 1X3FA 4R4OA 2M8JA 1WI5A 4A3LG 1U0LA 2Y0SG 4A3JH 3RZOH 2Q2HA 2HT1A 4DUYL 1WCMG 1C0AA 5C0XH 3BG3A 3J7A5 4HJ9A 1A0IA 2A68C 4DV7L 1WFQA 1OTCA 2IHFA 1N34Q 1HTPA 3RN2A 2LXKA 2F21A 2XP9A 5IYCG 1H9SB 2JEAI 4A3BG 1E7ZA 1VQ7A 4NXNQ 4GKJL 3U4VA 4P73A 3CAMA 3PGZA 2XP8A 3HOZH 2ATWA 4R4TA 2M3OW 1VQJA 4LF9Q 5FLMH 1K8MA 4GNXA 5BR8Q 3OOBA 3PCOB 4LFBQ 1F8AB 1HZ9A 1K8OA 4A3EG 1K83H 1XMOQ 3ER0A 5IY0A 4JOIC 1KIXA 4DNTB 3NE5B 3PIPA 1UE6A 4GLVB 4DNIA 5KNBA 2XPAA 2O5IC 3J80c 3W3AA 2YSHA 1E24A 3HOWH 3LWUA 1IBKL 3HGBA 2B8FA 4LUOA 2JJQA 1EYGA 3CCJA 2ZQSA 4C3JH 2A19A 1RL2A 2UUAL 5BN3A 2AHOB 1IBKQ 2JA5G 4KHPQ 4A3FG 1VS0A 2F1MA 3I4MG 5IP7G 2UXCQ 3T51B 3TQYA 4JI8Q 3K8AA 2OTJA 2ZAJA 5AHTA 5GROA 1XJVA 2BE5D 3PF4A 2OQKA 1IYJB 1JB7A 1DGSA 3G6EA 4A4IA 5BN5A 4REXA 1VQ6A 1Y69U 1TU2B 5C4XG 1YNXA 2NZOA 1VQFA 4G7OC 2N49A 3SGIA 4R4CA 4DK3C 2YTXA 3BDOA 3CCEA 3HOXG 3BZCA 1TWAH 4POFA 3F2CA 1DCZA 4DUZL 4R1JA 4LF8L 1NJIC 3EBEA 4A3BH 3HOYG 5KNCA 2JX8A 4QQBX 3CCSA 5FLMG 2UXBL 3RZDH 3H15A 3S16H 3KAFA 4GZYC 4MZ9A 3OYYA 3HOVG 3T53B 1VQHA 2PNHA 4JI3Q 2F52A 1N33L 4HR7B 2KCTA 1J5EL 1DD2A 5IYCH 1VQAA 3PO3G 2A69D 3GTOH 2EXDA 4P71A 1N9WA 2IY5B 4OONA 4YCUA 4RMFA 2ZTDA 2N3SA 1FR3A 1CFMA 1E2ZA 3M4YA 1Q8KA 4IOAA 1X56A 3A5ZB 2VQEL 3A0JA 2R93H 3PUVA 2UUAQ 4ME3A 1Y8OB 1N36L 5C3EH 3KDFA 5KNDA 1KD1C 2Q8IB 4JYAQ 2DK7A 2R7ZH 4B3MQ 4OX9Q 4OX9L 1GUGA 1HJPA 1Y1WH 4PZ8A 1HH2P 2A6HD 1N32Q 4A3KG 3L4HA 2VQEQ 3GTQH 3CQZH 1M90C 3W1BA 1Q90A 3J81c 4BY7H 2RE3A 2QF7A 4Y7NH 4DPGA 1L0WA 2JA9A 1XMOL 4BA2I 3A7AB 3SDZA 2R6GA 1W2BA 3IKJA 2F3IA 1LYLA 3KLRA 1PH9A 2ZR6A 4DV5L 1XPOA 1PV4A 5M3MG 3CXCA 1HCZA 2K4KA 4JI5Q 1OXVA 3H0GG 3PSIA 1E22A 1GUTA 1I94Q 3WH0A 3I2ZA 1BBUA 1VQOA 4JC0A 4O2DA 2YSBA 4JCVE 2K14A 4BBRG 3PO2H 2A69C 3A8KE 2KCMA 2B63H 5GAHC 2ZT9C 1QVCA 2MFIA 2KA7A 1IZ6A 4YY3Q 1HQMC 1YI2A 1I94L 4YCWA 4X66Q 1CI3M 1PH5A 1H9JA 1IBMQ 4B3SL 2D62A 3PV0A 3NBHB 4Y52H 1FVIA 4LF8Q 1L1OC 2E75C 4JI4L 2R7ZG 2JQOA 2UU9L 1SE8A 4LW1A 4KLKA 3RR5A 5JEAG 3VR3A 2JV4A 1T9HA 4NB3A 3HOVH 3CMEA 2E45A 3W1GA 1X3GA 1EWIA 2XP4A 2HIVA 1P8LA 2DNCA 2KXQA 2CWAA 4JK1C 2QEXA 5C0XG 3UDXA 4KI0A 3E9HA 3KF6A 4DKAC 1JJCB 1YJNA 3I4NH 3HFZB 4JI6Q 3GTGH 1RIPA 4OO1I 2PPBC 3TDBA 1K73C 2DN8A 5K36G 3K81C 2EQSA 4RCNA 2K50A 4GKKL 1CKMA 2WP8J 4KHPL 5GAGC 3PF5A 4DR6Q 4DR6L 4AQYL 4B3ML 4AH6A 4JBKA 3M3YH 3KLWA 4LFCQ 4JI1L 2O5JC 1B7YB 2OCEA 3TRZA 3KAHA 1JT8A 4EX5A 3PIOA 2R92H 2QA4A 2D0OA 2KHJA 1GD7A 5GQOA 1EOVA 3WDNA 3ULPA 1UWVA 1Q1BA 5IE8A 5IP7H 4A93G 2GVAA 5ELOA 1WCMH 1VQNA 4NXMQ 2K33A 3EQLC 1FGUA 4JI3L 1AE2A 4GKJQ 4IFDG 3KCEA 1YNNC 1E2WA 2DUDA 3QG1A 3ICEA 4AQYQ 2Z0SA 3IRBA 3TREA 2DGYA 4A3IG 4JI0L 5IWAL 4A75A 5GAEC 3MXNB 4KMUC 2XP6A 2B29A 5LMUQ 4LNQA 4DV3Q 4A3EH 2A6ED 1CUKA 2K75A 1SLJA 1L1OA 2MNAA 2AWNA 1HR0W 3QIAA 2IT1A 2RCNA 3G4SA 3H94A 3PUXA 4GNXC 2VY3A 3KDFB 1E1TA 4IO9A 1MIUA 4X64Q 4WJ3M 1Z9FA 3CRLC 2Z6KA 5IT9c 2HHHL 1OXTA 1V1QA 3KAIA 2DMVA 3T1YQ 4IJLA 3PUWA 1H9MA 3PO2G 4DV3L 3VR6A 3KF6B 4X66L 1Y14B 4EQ5A 3OTOL 1SMXA 2NVYH 4U84A 3S15H 3VA7A 3MXUA 1QJOA 1Z47A 3A74A 4QL5A 4BY7G 1VQ8A 4PZ7A 2XP5A 2M8IA 1JMCA 5FJ8H 2ZJPA 2ITKA 2D0PA 1K0RA 5C4JH 4A3CH 2ZQTA 4A3DH 4PMWA 2UXDQ 1FJGQ 3WWVA 1EFWA 4B3TL 4JI7L 4UP8A 4OGQC 1CKOA 1QZGA 3TC5A 1I6VC 1QVGA 2A68D 4A3LH 2KENA 2KCCA 1Q86C 1SN8A 4LF9L 4B3RL 3I4OA 3LE4A 1Y8NB 2K32A 1G291 3AYHB 1X55A 2ZJQA 4GN5A 2YU9H 1GO3E 3T1HQ 1BDOA 1SRUA 4IPGA 2WFWA 2XGTA 1ZYRC 4DV2L 4YHHL 3HKZE 3GTJH 1JE5A 4DV1L 1XMQL 2XPBA 4MTNA 2JA8G 3A5UA 1NMFA 4AYBE 1HR0Q 3M4QA 1Q7YC 1EUJA 2L4JA 3UE0A 4JBWA 2I5MX 2R7DA 4DK0A 5CQ2A 3LGJA 4H0LC 3TS2A 4JI2Q 4KHZA 2PNRC 2IHEA 5FLXc 5IYDG 2DNEA 1SFOH 1UE7A 1VF7A 1Q81C 5C3EG 2DK1A 3STBC 4LF6Q 3BZKA 1VQ4A 4DR3Q 1IW7D 3LNNA 4HIKA 2VNUD 4BBRH 5LMUL 4BA1I 2YTYA 3I72A 2UXBQ 4GN4B 2PI2A 1YITA 3CRKC 4I7ZC 5C0XI 4L5SA 2CKZB 1I6HH 2OTLA 2ZTEA 1WYDA 2E76C 3UDGA 2ZTCA 2LXJA 3T56B 4X65Q 4NXML 3M7NA 2I5LX 2GVBA 4DK6C 1JMQA 3RLFA 1VQKA 4GOPC 3UE1A 3S2HH 2LSSA 1B8AA 3CC2A 3D0FA 3CPFA 4DR7Q 4JBMA 3CF5A 1VQPA 3ERSX 3J80i 1H9SA 1PVOA 4QIBA 3CCVA 3M4OH 4IPHA 4IOCA 1H95A 1TK7A 2Q2UA 3HOYH 4DR4Q 1PA6A 4IFDJ 3SE0A 3VR4A 2JA8H 1TWHH 1B70B 3S24A 3DLLA 2Q5AA 3S1QH 1ASZA 2A6EC 3AFPA 1Z6HA 4GN3B 4C3HH 1VQCA 3T1YL 2BH8A 1NTGA 3L7ZC 1NY4A 3CP0A 1EIYB 2R92G 2EZ5W 4DUZQ 4KKUA 4PZ6A 1CSQA 1IYUA 3CC7A 3CD6A 2ZM6L 4LFBL 4H44C 5ELNA 1K8AC 2E2IH 1AH9A 4DR5Q 3OPOA 2E5LQ 1DXMA 3L0OA 2PQAB 3RN5A 1V9PA 2CWPA 2WAQG 1VQ9A 4JI8L 1SROA 2CW0C 4GOPA 1JJGA 2UXCL 4X6AH 4IQZA 1P16A 3HOUH 5IYBG 3D4RA 2JE6I 1YJ9A 4YWMA 4DUYQ 3E0EA 3HOZG 5IYDH 1N8RC 4OO1H 1NBWA 1HNWQ 2Z6KC 2YYZA 2VQFL 1VQDA 3U9SA 2JA7G 2N8NA 3OOCA 2JXWA 1C7YA 3FP9A 2KHIA 4LF4Q 3U4ZA 3BU2A 1EQQA 1I5HW 4LFAL 1KXLA 1GUOA 2CFMA 4G7ZC 5M3FH 2R7FA 1WJJA 2VW9A 1XNRL 3I4NG 3K0XA 3NENA 1E3PA 3J81j 1EQRA 3KADA 4LJZC 3A7LA 4BBSG 3DXJC 1HNZQ 1FL0A 1KL9A 3ULLA 2HHHQ 4LF6L 2ASBA 4LF4L 2EJFC 3JC66 1CTMA 2MDIA 2JK8A 4BY1H 3KJOA 2CQOA 1PHJA 3UDFA 2K52A 1L2FA 5HGQA 1N34L 3GD7A 2JMFA 4DV6L 1XMQQ 3GTMH 1GVPA 4BXXG 1M1KC 4P75A 4UP7A
chains in the Genus database with same CATH superfamily
4NPSA 5JOBA 5IWAQ 1SFOB 1MJEA 1H9KA 3HOZB 4A0TA 2XWJB 4L5TA 2K5QA 2KHSA 4FF4A 4U673 3HKZB 1YNJC 5BR8L 2MO1A 2RVLA 1S5BD 1K9QA 2JA7H 4X62Q 4K0KQ 2B2YC 2JXMB 1VDZA 1J5EQ 1YJWA 3SK8A 4B3RQ 4A3IH 4BBRB 2BCOA 4KKSA 3F8TA 3GTLH 1NMVA 4QGUA 4PV1C 4LF5L 2PZUA 1N33Q 3NTHA 1XYIA 5LL6S 2N78A 3C3LA 2B63G 1XNRQ 4CDFC 3NTPA 3HOUG 3TSSA 3AFQA 2RQXA 4DV0Q 3V96A 4QJFA 4QIWE 2LMCB 4JV5Q 3KF8A 3VR5A 1Q46A 1FJGL 2WIIB 4IUVA 3KAGA 3SR1A 1ICWA 1O7LA 4UP7A 2BH2A 3GQBA 2DY7A 1WOCA 2PCFB 3FKIB 1HNXQ 3MHBA 3IFTA 4ZUIA 1M4VA 4AIMA 1ML0D 5JJKA 1NAPA 1K8GA 2H5XA 4POGA 3MZ5A 3E3XA 1FLCA 3RLOA 2NVTB 2UUCQ 1V1PB 2I07B 4JI5L 4E6IA 1K9RA 5CR3A 4ZUJA 1BCPC 1RP5A 5KIXA 1GUNA 2JA6G 1A63A 2VL6A 3JAML 3CCQA 1D6EC 2JA6B 1WTRA 2DWVA 1LTTD 3J80E 1LM0A 3KBGA 4WJ4A 2RSOA 5HURA 1BCPB 2RHQB 2MO0A 2PYKA 3OTOQ 4KN7C 1GOZA 1VQEA 4OWTB 3E9IA 3H6MA 3BVZA 3BVGA 3HZXA 2L5TA 3LKXB 2K7VA 4HJ5A 2IX0A 4RG1A 2F4IA 3CHBD 3I4LA 1PH1A 4DV4L 2CCZA 1IKLA 2OQ0A 1B9NA 2EDGA 3OW7A 2B8GA 1G51A 1SYGA 3K7UC 1EG3A 5JEAJ 3I91A 1Y1VH 2D9UA 1AEXA 1EOTA 5KGUA 2JA8B 1WD0A 3U58A 2K03A 5BN4A 3D4WA 1GJXA 2UUBL 2XRSD 4KJOA 1HNWL 3K5NA 3S17H 1PFNA 5IP9G 3I4NB 1PH7A 2HQLA 1EQVA 3I55A 1JOQA 1ZEQX 1WTWA 2K28A 3D4DA 2NN6H 2MQHA 1D5XC 3VYTA 2UUCL 1PH3A 4XTCS 4DXGA 3PO3B 2YSIA 1HR0L 3CNGA 1NNXA 2XP7A 1O6WA 1KQSA 2AMCB 1BXTA 3NBHA 2EE1A 4A3MH 3M3YB 2ZXPA 1HTLD 1HNXL 1OXUA 2Q2IA 1S3OA 3H3VI 5K5PA 1IL8A 2FFKB 3I56A 3K7AB 4DR4L 3KOJA 1FNWA 2F0GA 3I4MH 4HIOA 3GTKH 1WTHA 4JV5L 1YHBA 4IURA 3GTOB 2G9DA 3KF8B 4L5RC 5EPKA 3U50C 1KDAA 4CJ1B 1X6OA 5DM63 1SNPA 3GP7A 3DM3A 3QO2A 3CKIB 3I70A 1PH2A 1B4OA 4K5VA 2VS1A 4JG2A 3Q24A 1IL2A 3N6RA 1LTRD 1WCMB 3RLNA 4NXNL 4BY1G 1CQVA 3S2DH 4JI2L 1ZXTA 2ZR5A 1EU4A 2OWOA 4DV5Q 3S14H 1HZAA 3ONAB 5IYBH 2Q8RE 1I4XA 1ILQA 1LLRD 1HZCA 2VUMH 3R3OA 4F7XA 1FYCA 5J3BA 4A93H 1L0XB 1V8QA 1VQLA 4H13C 2LAJA 3CCUA 5E7NA 1SR3A 2B2UA 4R4IA 3AB9A 1IW7C 4U86A 3NEMA 3NWSA 3KYHC 4QCLA 1ONLA 1F9PA 4DV6Q 1ILPA 1NMGA 1TWGH 4ULLA 4DV2Q 2KVMA 5ELEA 1JOKA 2B2VC 2EYOA 4X3TA 1XNQL 1TWCH 3D8GA 2ZJRA 3HKZG 1Z7TA 4LFCL 5GADC 2NN6I 3ERQA 1PH4A 1O7IA 1B9MA 1TXYA 2E8GA 1LTGD 3NELA 1MBYA 4GOPB 1QUQB 2XTIA 1LTLA 2EJMA 3Q0AA 1MJCA 3CW2C 2ZXRA 3J81i 1B3QA 1STAA 1ICFB 1EY4A 1MHWC 1E1OA 1QWYA 1HZBA 3B6YA 4YWKA 1U9RA 2J4XA 1HNZL 4OWWB 4DFAA 3TMEA 3MAQA 1PRTF 4ALPA 5EJWA 2NTTA 2F0EA 1J9OA 3NQIA 2KBNA 4XT1B 1C48A 1LTID 2E2HH 1OXSC 3J7ZC 4FVMA 5DEHA 1STYA 2R93G 3FKIG 2NB0A 3I7FA 4DAPA 3D6WA 2F4VQ 2XIWA 1HUMA 4CKCA 4A3GH 4CDDC 1S4ZA 5IT9E 1CHPD 5I6WA 3TEHB 2PQAA 3CPWA 1ASYA 3PUYA 1YZ6A 3CCRA 2Z4HA 1IBLL 1GHKA 1C9OA 2ICIA 2K5HA 1CKNA 1PYWD 1QG7A 2B63B 3MXNA 1D7QA 1RODA 4O0AA 2MHVA 1VQIA 4MNOA 4DR2Q 4K5WA 3FHWA 2A1AA 3TCZA 1Y1VG 4BBSB 4IPDA 2DY8A 1CZWA 3GV3A 3K80C 2YTVA 2QRVA 1DOKA 5E66A 1EG4A 3W5OA 4UP9A 4ZK9B 1BR9A 1KRSA 2ZQUA 2C35B 1PMRA 1IBLQ 4FXKC 5LMNW 1PH6A 2RF4A 3MEFA 2E2JH 1BKBA 5I9OA 4DV1Q 3HS0C 3RUZA 5M5XH 1PTOB 3A8IE 1PYBA 3GO5A 2PO4A 2ZR4A 1KC8C 3HOWG 2EYFA 5M3FG 2JA7B 1W3SA 2B3GA 3KJPA 3MFYA 3FDTA 5EPJA 3OW2A 2F4VL 3OWFA 1YNJD 1AE3A 2EJGC 1RTNA 4LK1C 3M85A 4X3KA 3PUZA 1EY8A 2GN5A 3G48A 4ME5A 3KABA 4UAIA 1X9NA 2E5LL 1SNMA 1JCKB 2PI2E 4APVA 4P74A 4HJ8A 1Q82C 1TKWB 1Y1WG 4DV0L 1EWCA 3TP7A 2JA5H 1I3QH 4NDXA 3HOVB 1EY6A 4DN4M 3F1ZA 1JWMD 5CV6A 2R3ZA 4IPCA 2DJYA 4DGZA 2L55A 1LUZA 3BVMA 3AQQA 2SNSA 3D3RA 4LF5Q 5C5MA 4J15A 3CMAA 1Q12A 5C44B 5C0XJ 1CHQD 4LUZA 1RKNA 2V1CC 1OO9B 2ZQVA 1LABA 4F87A 1PYSB 1NE3A 3C2PA 1RCVD 1XPRA 2PQEA 2AUJD 2D2CC 3A54A 5M3MH 1ZCNA 3FKIH 1W6KA 4XIGS 1WMVA 1QNUA 4A3MG 1LACA 4DV7Q 5IT9L 1G91A 5C6AA 3QR8A 1YBYA 1SEBD 4A3FH 2A6HC 1Y8PB 2QW7A 3ODKA 1Q1EA 4J6HA 4HJAA 4DA2A 4F8MA 1GUWA 3TP5A 2NVTH 4OELB 3FS8A 2EY6A 4J8QA 3G6JB 3QJYA 2Y8NB 4C1NK 5M5YH 1EYCA 1BQQT 2L11A 1EIGA 2CW0D 2F0WA 1BBWA 1M8AA 3SK6A 3HOXH 3GTJB 1N32L 3SK4A 1JJ2A 5J1ZA 3NPPA 2JA6H 5CMDA 4A76A 5JPNC 2PZWA 2YSFA 4P72A 3VDYA 4EQNA 4HJ7A 1KAWA 3M7GA 2PMZE 5C4XH 1QUQA 1NR2A 3K59A 4GKKQ 4DAYB 2IJ0A 2R92B 3ND8A 3S1NH 1N36Q 1VQGA 1RTOA 3X3MA 1WVLA 1VQMA 2L15A 5JVG3 2ES2A 4LWCA 2IX1A 1GKHA 1ZYRD 4C2MH 4DR7L 2M2LA 4BXXH 2RHSB 1YIJA 1WTQA 4XQJA 4IFDH 2G9HD 2BE5C 1PFSA 4TVAB 3TP6A 4OWXB 5K36H 1A3VA 2Q8TA 4K6DA 1I50H 4U85A 4IFDI 1X65A 3JAME 4OXPA 3IFDA 4KY5A 2UXDL 3J81E 1U5KA 5C44G 1PZJD 4X64L 3GDEA 1D8LA 1GHJA 1XPUA 1LT5D 5LMNL 3VYSA 4UPAA 2IWHA 5IGDA 3C46A 4X65L 3I73A 1UE1A 1S72A 1K83B 1XX8A 4C3IH 1A6XA 1O78A 4TKOB 1CSPA 3OIQA 1L1OB 2KEDA 1GM5A 2YSGA 4JBJA 3LWEA 2WAQE 5KYIA 2WB1E 4DAMA 3PO3H 4GLXA 5JJLA 2MPMA 5JJZA 2K01A 3KLSX 1WR7A 3HKSA 4PMCA 2A8VA 4KKTA 4HSPA 2VZAA 5HGTA 4DR2L 4JOIA 1IBML 4B3SQ 4DR1Q 3PQHA 3HOWB 1EIFA 2TMPA 4A3EB 1DONA 2KJXA 3K7AH 2H1EA 1I6HB 3M9BA 4IUUA 4C3JB 3I90A 5LMNQ 3AEVA 1JWUD 2VB3X 4A3JG 5C3WA 5L37A 3STBD 1F9SA 2I0QA 2NZHA 3NTIA 5M9OA 1FGBD 1SMYC 3ZJYC 1X54A 5EKKA 3NP8A 4RA8A 5NUCA 1ENFA 1QOHA 5CV8A 2E74C 3CC4A 2I5HA 2Y0SE 2DJGC 1ET9A 2XP3A 1KDBA 2C5CA 1E0BA 4AYBG 3GTPH 2B2UC 3S14B 2XSCA 4A3KH 1PRTB 1K9MC 1KHIA 4K2KA 2WB1G 3G71A 2AWOA 3BJUA 2HIXA 3ULJA 4ODGA 2UU9Q 2HDLA 5FK9C 4B9XA 1QNKA 1B3AA 1F2YA 2ALYB 3TN2A 2A5HA 2ZM6Q 1XTDA 3P1HA 4HIMA 2Q2TA 2J0TD 1F2ZA 1XNQQ 3F2DA 5AJ3L 3SK5A 5M5WH 4TQUS 4E5RA 4CKEA 3FPPA 1BOSA 1VF5C 1CK1A 4DAYA 2AQ3B 2V4DA 2VXWA 4H02A 1D5MC 1QVFA 4CHTB 2A73B 2NVXH 2AUKA 3EIVA 4FO2A 2BA1A 1A62A 2XN9C 1YHQA 2NVQH 4LF7Q 1CM9A 5AJ3Q 4A0UA 4JI0Q 5JJIA 4DAVA 4JI1Q 2X69A 2WADA 4YHHQ 5C4JB 5KEEA 1I5FA 4C3HB 1J6QA 5IIFA 3Q8DA 4JYAL 2AQ2B 1EWHA 2K5WA 4A3DB 1QZHA 5JEAH 4TSSA 1BVSA 3T1HL 1EYDA 1HFNA 3DWAA 2UUBQ 5EAYA 1PTOF 4LUVA 2FXQA 2LFNA 5FJ8G 4J1MA 1TY0A 4C3JG 1ZKOA 4YCVA 1LTSD 4HIDA 3J80L 2EIFA 2K5NA 3JAMc 3L2PA 3S1MH 3AU7A 3F2BA 1JR0D 3ND9A 2B2TC 3TS0A 4GNXB 4X62L 4K0KL 4KN4C 4ZAIA 4FF1A 3BDLA 1X3EA 3D31A 1OXXK 4PG3A 4FDBA 4JI7Q 4L8JA 3H3VC 4C3IG 2JEBI 3H3VH 2E2IB 2F0PA 5CGKA 1EZ8A 1IXRA 3RNUA 4B08A 3I3CA 3A8JE 4LFAQ 1A8VA 1VQBA 2NN6G 5DLQE 3J7AV 4B3TQ 2K5VA 2BA0A 4NW2A 1YEZA 1JQYD 4BBSH 1JORA 3T13A 3V2TA 3SEBA 2YU9B 5FOBB 5C4HA 4DR1L 3M4PA 4M8AA 4JI4Q 1V43A 2QGQA 1UUPA 5IGEA 1CQFA 4DK1A 1S40A 3H0GH 4PNYA 1CZGA 1PINA 1VQ5A 2EVBA 2ID0A 2E2JB 4V0BA 1IHZA 3JAMi 2F0LA 3S1RH 2K6AA 4DNRB 1K3BC 1TWFH 1STHA 4A3GG 1K3RA 3HOUB 2XVSA 1UE5A 3CCMA 3MXGA 2E2DC 2PMZB 1H9RA 4CKBA 3R2TA 3MCBA 2K04A 1E2VA 4LAAA 5H1SE 4YY3L 4YWLA 4KHVA 3DMUA 2A74C 3FPUB 4IJHA 3FMCA 4R4QA 3J81L 4UY8C 5A35A 1R9TH 3KFUA 4ZKBB 1G6PA 4JI6L 1VCIA 1T5EA 1MKHA 4GLAC 1GUSA 1I3QB 1ET6A 1PLFA 2D5DA 4QF4A 2RSNA 4LF7L 2F0OA 2YV5A 3HEJA 4DV4Q 2C9OA 4RAUC 2Z6BA 4DR3L 3BDCA 2Z8LA 5FLXE 2BDOA 1CKNB 5HY6A 3TZUA 3UDIA 1PH8A 3GTQB 3CQZB 4R8NA 4A3CG 1WTXA 4MTKA 5C44H 3CCLA 4A3DG 2I46A 3DHQA 1YVCA 2JN4A 4BY7B 4QY7A 4OHJA 5CORA 4DR5L 4L5QA 4OO1G 4ZQ3A 2VUMG 1UEBA 2B2WA 2QCPX 3R93A 5IP9H 3EN2A 1SJED 1IYVA 4RWSC 3QWNA 2N55A 5E65A 1KNAA 1KRTA 3P20A 2AKWB 4GS3A 1HA6A 2VQFQ 1YHAA 4A3FB 3VR2A 2F3WA 4G7HC 1EEID 1HPCA 3I8ZA 1X3FA 4KJNA 2M8JA 4R4OA 1WI5A 5FO8B 4A3LG 2VB2X 1U0LA 2Y0SG 4A3JH 1DM0B 2AQ1B 4RHSA 5M5YB 3RZOH 2Q2HA 4WFN3 4BY1B 2HT1A 1DOMA 4DUYL 1U4PA 1WCMG 1C0AA 2RA4A 2SOBA 2OEOA 5C0XH 2XNAC 3BG3A 3J7A5 4HJ9A 1STGA 1A0IA 4IUNA 2A68C 4FNFA 4DV7L 1DYQA 1R4QB 2R61A 4XYOA 4X3SA 1WFQA 1OTCA 1NUCA 2IHFA 1N34Q 3BYTB 1HTPA 3KUPA 3RN2A 2LXKA 2F21A 5IGCA 2XP9A 5IYCG 2L4NA 1MD2D 1H9SB 2SDFA 2JEAI 4A3BG 2F0JA 2JYOA 2K1BA 1E7ZA 3TP8A 1VQ7A 4IUTA 4NXNQ 4GKJL 1TIID 3U4VA 4P73A 1EY7A 1SE2A 3KBXA 3SXHA 3CAMA 1B50A 4H7BA 3URYA 3PGZA 1S5FD 2XP8A 1SYCA 3HOZH 1I50B 2ATWA 4R4TA 2M3OW 4NP5A 1VQJA 3GV6A 2QDLA 4LF9Q 5FLMH 1K8MA 4GNXA 5BR8Q 3OOBA 3PCOB 4LFBQ 1LTAD 1F8AB 5CBAE 1HZ9A 2F0QA 4XT3B 5EKLA 1MSGA 4A3EG 1K8OA 1K83H 2EY5A 2F0HA 1XMOQ 3LX0A 3ER0A 4A3IB 1HXYD 5IY0A 4JOIC 1KIXA 4DNTB 3NE5B 3PIPA 4N9PA 4L6TB 1UE6A 4GLVB 5C4ZA 4DNIA 2XPAA 5KNBA 1PFBA 5J22A 3J80c 2O5IC 3W3AA 2YSHA 3K0YA 3FEWX 4KD4A 1FNVA 3HOYB 1E24A 3HOWH 2EYPA 2OF1A 3LWUA 1IBKL 3HGBA 3S1QB 4FF2A 4NMZA 2B8FA 4S3SA 4LUOA 2JJQA 1EYGA 3CCJA 2ZQSA 4C3JH 1SNQA 2A19A 1PTOC 2H4OA 3GTGB 3K6OA 2WKCA 5FO9B 3MCBB 1RL2A 2UUAL 3U9OA 2AHOB 5BN3A 1IBKQ 2JA5G 4F88A 4KHPQ 4A3FG 1VS0A 2F1MA 3I4MG 3O13A 5IP7G 1CA6A 2UXCQ 4XXEA 3T51B 3TQYA 3NSWA 2SNMA 1EZ6A 1PXUA 4FXDA 3D6CA 4JI8Q 4C1NI 1G2TA 3K8AA 2OTJA 2ZAJA 5AHTA 5GROA 1PRTC 1XJVA 2BE5D 4WORA 1O7YA 4HN7A 1S5ED 2OQKA 1IYJB 4ZRZA 4XYQA 3PF4A 1JB7A 1DGSA 2F0FA 3G6EA 4A4IA 5BN5A 4REXA 3VYRA 1VQ6A 4KY6A 1Y69U 1TU2B 5C4XG 1YNXA 2NZOA 1VQFA 4G7OC 2N49A 3SGIA 4R4CA 4DK3C 2YTXA 3BDOA 2HUGA 4CBVA 3CCEA 1CA5A 3HOXG 3BZCA 4IUPA 1TWAH 2GA4B 4HCEA 1HRJA 4POFA 4QUFA 3F2CA 2NVXB 1DCZA 4DUZL 3MQHA 4R1JA 1II3A 5TSSA 4LF8L 5E5WA 5A2QE 3T4AC 3DWPA 1NJIC 2LS01 1UAPA 1NR4A 3EBEA 5DM73 4A3BH 3HOYG 5KNCA 2JX8A 1EQTA 4QQBX 3CCSA 4HTHA 5FLMG 2UXBL 2G5DA 1B2TA 3RZDH 3H15A 3S16H 3KAFA 1BF4A 4GZYC 4MZ9A 3R2IA 2FMMA 3OMCA 3OYYA 3ZYYX 5I2YA 3HOVG 3S1MB 1I4HA 3T53B 1VQHA 2PNHA 4JI3Q 2F0MA 2F52A 3NWTA 1TS2A 1N33L 2KCTA 4HR7B 2K05A 5EBCA 1KDCA 1J5EL 4OL7A 4Z9CB 2IL8A 5M3FB 2X6LA 5IYCH 1DD2A 1VQAA 3GTKB 1SYEA 1RF2D 5I4DA 3PO3G 2A69D 1ENAA 1B1ZA 3R8BA 2EXDA 3GTOH 3EJIA 4P71A 2HDMA 1N9WA 2IY5B 2MGSA 4R9WA 4OONA 2M00A 3E0JA 4YCUA 2B2VA 4K6LA 4RMFA 2ZTDA 3NTKA 2N3SA 1FR3A 1CFMA 5CV5A 1E2ZA 3M4YA 1Q8KA 1KLUD 4IOAA 3S1RB 1X56A 3A5ZB 2VQEL 5KRUA 3A0JA 2R93H 1SBBB 1FNUA 4HSVA 2VUMB 3C1FA 3PUVA 3DM1A 2KOLA 2UUAQ 4ME3A 2IW3A 1Y8OB 1N36L 1S5DD 4G57A 5I2XA 5C3EH 3KDFA 5KNDA 1KD1C 2Q8IB 5COYA 5KYLA 2NUCA 4JYAQ 3FVQA 2DK7A 2F3VA 2R7ZH 4B3MQ 4OX9Q 4OX9L 1GUGA 1HJPA 1TWGB 1Y1WH 4PZ8A 1HH2P 2A6HD 1N32Q 4A3KG 3L4HA 1TWCB 1STEA 2VQEQ 3GTQH 3CQZH 1M90C 2WB1B 1WD1A 3W1BA 1Q90A 3J81c 1SAPA 2O2LD 1YNND 4N8FA 4BY7H 2L12A 1U4RA 2RE3A 2QF7A 1XWEA 4Y7NH 4DPGA 1L0WA 1I4GA 5C3XA 4KK7A 2JA9A 1XMOL 3DWQA 4XQQA 3MQGA 4BA2I 3A7AB 4FXGC 3SDZA 2R6GA 3GTLB 1PTOD 1W2BA 3IKJA 3KLSA 5T1IA 2F3IA 2QKIC 1LYLA 3KLRA 1PH9A 2ZR6A 4DV5L 1XPOA 1TY2A 1PV4A 1BCPD 5M3MG 3CXCA 2E2HB 1HA5A 1HCZA 2EYJA 2K4KA 4JI5Q 4A3JB 1OXVA 3H0GG 5CV9A 3FSBA 1DOLA 5ISRA 3PSIA 5JVH3 1E22A 5D14A 3S9WA 1BBXC 1GUTA 2BOSA 1I94Q 3WH0A 3I2ZA 2F0TA 1BBUA 4XDXA 1VQOA 5U47A 1KABA 4JC0A 4O2DA 3EA6A 2YSBA 4JCVE 5E4XA 2K14A 2QDBA 4BBRG 4RHRA 4BS9A 3PO2H 2A69C 2KCMA 3A8KE 2B63H 3PIO3 5GAHC 2ZT9C 1QVCA 2MFIA 2KA7A 1IZ6A 2B39A 3LKXA 4KY7A 4YY3Q 1HQMC 2QEJC 1YI2A 1CT1D 4V190 1MI2A 1I94L 4YCWA 4X66Q 1UEAB 1CI3M 2B2YA 2ICEC 1PH5A 1H9JA 1IBMQ 1PTOH 4B3SL 2D62A 3PV0A 5G3LF 3NBHB 4Y52H 5F2DA 1FVIA 4LF8Q 2L1BA 1L1OC 2E75C 1JE4A 4KTAA 3DEOA 4JI4L 1I4QA 2R7ZG 2JQOA 2UU9L 1TT2A 4MIUA 1SE8A 4LW1A 4KLKA 4RKBA 3RR5A 3K5LA 3OSOA 3VR3A 5JEAG 2JV4A 1T9HA 2MJ8A 4NB3A 3HOVH 3CMEA 2E45A 3MXPA 1LO5D 3W1GA 1X3GA 1EWIA 1C4QA 5E1FA 1TR8A 1EYAA 4FF3A 2XP4A 2HIVA 4O42A 1P8LA 3J7AF 1Y1VB 2DNCA 2KXQA 2L0CA 3T16A 2CWAA 4JK1C 2QEXA 3MA2B 5C0XG 3DUZA 2J7ZA 3UDXA 4KI0A 3E9HA 1LTBD 4PQXA 1KTKA 3KF6A 4DKAC 1JJCB 1YJNA 3I4NH 3HFZB 4JI6Q 3GTGH 1RIPA 4OO1I 1O80A 4P2CB 3BYYB 3TZDA 2PPBC 1A15A 2FINB 3TDBA 1K73C 2DN8A 2SEBD 5K36G 3K81C 1C8CA 2EQSA 2IPKD 4RCNA 2K50A 4GKKL 2WINB 4QMGA 1CKMA 3X3NA 2WP8J 4KHPL 1JB3A 1SYDA 5GAGC 2NZ1D 1U4LA 1F2LA 5FO7B 3PF5A 4DR6Q 2CH4A 4DR6L 4AQYL 4B3ML 4AH6A 4A3MB 4JBKA 3M3YH 1RDPD 2M9VA 3KLWA 3E5SA 4LFCQ 1AP0A 4JI1L 2O5JC 1B7YB 4ID6A 4ZYSA 2OCEA 3TRZA 3KAHA 3Q6SA 2F03A 1JWSD 1JT8A 3MC0B 2WAEA 4RGOS 4N9TA 1BCPF 4EX5A 3F2UA 1QCBD 1TS3A 1SMYD 1U4MA 3PIOA 2R92H 5CV4A 3MWYW 2KQ3A 4AYBB 2QA4A 2JP1A 2D0OA 2KHJA 2FMCA 1GD7A 5GQOA 1EOVA 1HQRD 2ZXOA 3WDNA 3ULPA 5IODA 4C2MB 1SNOA 3Q23A 1UWVA 1Q1BA 5IE8A 5IP7H 4A93G 2GVAA 5ELOA 1WCMH 4HAEA 3CU7A 3WOEA 2Z4IA 1VQNA 5CYUA 4NXMQ 1MGSA 2K33A 3C1EA 3EQLC 3NHHA 1FGUA 5LHY1 3PQIA 4K5XA 4K2LA 4JI3L 3S2HB 3A55A 1AE2A 4GKJQ 4IFDG 3KCEA 2WAQB 1YNNC 4A93B 2Y0SB 1E2WA 4C3IB 2DUDA 3QG1A 3ICEA 4AQYQ 2Z0SA 3IRBA 3VA5A 4RFBA 5E3FA 4X3UA 3TREA 2DGYA 4A3IG 4JI0L 3M4OB 3RZDB 3S16B 1DZ1A 5ELBA 1Q8IA 5IWAL 2NWGA 4A75A 3G7LA 5GAEC 1KLGD 2ENBA 3MXNB 3HP3A 4KMUC 3K5MA 2XP6A 2B29A 3P7JA 1TWHB 2NTSA 2WACA 4CDEC 5LMUQ 4OEMB 4LNQA 4MHEA 1SDFA 4DV3Q 4A3EH 2A6ED 1CUKA 2K75A 4C3HG 2FHTA 1SLJA 1D5ZC 3K57A 1XXGA 1L1OA 2MNAA 2AWNA 1HR0W 4EQOA 3QIAA 2IT1A 2EXZA 2RCNA 5EKIA 3G4SA 1STBA 3H94A 5LL6X 2EPBA 3PUXA 4GNXC 1V1OA 3OHXC 2VY3A 3KDFB 2CQAA 2B2WC 2EYMA 2XRQD 2O4XA 1E1TA 4IO9A 1MIUA 4X64Q 4WJ3M 1Z9FA 3CRLC 3UI2A 2Z6KA 4A3KB 5IT9c 2HHHL 4A3GB 4ZCKA 1OXTA 4QIWB 3NK9A 5D3DA 1V1QA 3KAIA 3WOFA 2DMVA 5AFWA 3T1YQ 4IJLA 4Q0FA 3PUWA 2F0SA 1H9MA 3PO2G 4DV3L 5E64A 3VR6A 4DXFA 3KF6B 4X66L 1Y14B 4EQ5A 3OTOL 2MUYA 2N88A 1QILA 5I9PA 1KNEA 2EOTA 1SMXA 2NVYH 1R4PB 5DAUA 5M5WB 1S5CD 4U84A 3MFGA 4IN3A 3S15H 4ABNA 1B44D 4FYDA 4RGTA 2RDHA 2F0KA 4QUCA 5E4WC 3VA7A 3MXUA 1PFMA 1QJOA 4OIJA 1Z47A 4NKLA 3A74A 4CGYB 4QL5A 4BY7G 1VQ8A 4PZ7A 5M5XB 1F2MA 2XP5A 4K8IA 2M8IA 1JMCA 5FJ8H 5DNFA 2ZJPA 2ITKA 2D0PA 4Y7NB 5D3IB 1K0RA 3PIP3 1W6JA 4HCSA 3NQTA 5C4JH 1EFID 3Q22A 4A3CH 5C5LA 2EYLA 3RMHA 2ZQTA 5D65A 4A3DH 4PMWA 4U68A 5J39A 2JA5B 3E6ZX 1IKMA 4JPBW 2UXDQ 1FJGQ 3EROA 3WWVA 3FRPB 4TRDA 1EFWA 4B3TL 4JI7L 4UP8A 2HCCA 4OGQC 1CKOA 5IGBA 3L9AX 1QZGA 1KAAA 3OWEB 2FJ2A 1BO0A 5JPMC 2Z9HA 3TC5A 1I6VC 1QVGA 1NSNS 1AZQA 1SSOA 3QOJA 2A68D 4CJ0B 2KECA 4A3LH 5A2QL 5EGTA 5E62A 2KENA 5M3MB 2KCCA 1Q86C 1SN8A 2B2TA 1QB5D 3HRZC 4LF9L 4B3RL 1EY5A 3I4OA 3LE4A 1X3PA 3AMUA 3PO2B 4MN3A 1Y8NB 2K32A 4K8JA 1G291 3RD4A 3AYHB 1PDQA 5EBDA 1X55A 3H09A 2ZJQA 3BZDB 4GN5A 2EY1A 2YU9H 3TDQA 1EL0A 2OXPA 1GO3E 2LY7A 1BUVT 3T1HQ 1BDOA 1SRUA 4IPGA 2WFWA 2XGTA 4RGMA 1AN8A 5EPLA 5G3LD 2F0UA 1ZYRC 4DV2L 1VMCA 1X32A 3HKZE 4YHHL 1JE5A 1GXDC 3GTJH 4DV1L 2RCFA 3HOXB 1HHVA 4RKLA 2XWBB 1LV9A 1XMQL 2XPBA 1EY9A 4L63B 4MTNA 2JA8G 3A5UA 1NMFA 1F9QA 5FLXL 4AYBE 1HR0Q 3M4QA 1Q7YC 1EUJA 2L4JA 1G2SA 3UE0A 1WTVA 5C4XB 3DEPA 4JBWA 1F9RA 2I5MX 3S1NB 2R7DA 2CH4W 1G6ZA 1JOOA 4DK0A 5CQ2A 1TR5A 3LGJA 2EY2A 4H0LC 3K5OA 3TS2A 4LMQD 4R8IA 4JI2Q 3GTMB 4KHZA 1NCVA 2PNRC 4ILWA 2IHEA 5T1GA 5I6YA 5FLXc 5IYDG 2HQEA 2DNEA 2F0VA 1SFOH 1UE7A 1VF7A 1Q81C 3MVVA 5C3EG 2DK1A 3STBC 4LF6Q 4I65A 3BZKA 4YIJA 1VQ4A 4DR3Q 3HG9A 4BWGB 1IW7D 1EEFD 1RHPA 1SXTA 3LNNA 4HIKA 2VNUD 4BBRH 1V1PA 2PW7A 1JC7A 5LMUL 2YTYA 4BA1I 3I72A 4ZLTF 1X3QA 2UXBQ 4GN4B 2PI2A 1A3UA 1A2TA 2NBFA 1YITA 3CRKC 4I7ZC 5C0XI 4L5SA 3RZOB 1PRTD 3IL8A 4B9WA 2CKZB 1I6HH 2OTLA 2ZTEA 1WYDA 1WTPA 1QE6A 2E76C 3UDGA 2ZTCA 2F0NA 2LXJA 2DJFC 4G4KA 3T56B 4JW0A 4X65Q 4NXML 1JICA 2WV6D 3M7NA 2I5LX 2GVBA 4DK6C 1JMQA 2CVRA 4WJWA 3RLFA 1TS4A 2RKSA 1VQKA 4GOPC 3GTPB 2P5ZX 3UE1A 1D1IA 3K58A 3S2HH 2LSSA 1B8AA 3CC2A 3D0FA 3CPFA 4DR7Q 4JBMA 3CF5A 2F0DA 1VQPA 3ERSX 4EGVA 1AW7A 3J80i 1SJHD 1H9SA 2X6GA 5FKAC 4FP5D 4Q5VA 1PVOA 4QIBA 2RBMA 1F77A 1MSHA 3FSCA 4N8X1 4RCOA 4CDCC 3CCVA 3M4OH 4M1UB 4IPHA 4DF7A 4IOCA 1H95A 2EYHA 1SYBA 1TK7A 2Q2UA 4KV6A 3EVQA 3HOYH 4DR4Q 1PA6A 1HUNA 4IFDJ 3SE0A 3VR4A 2JA8H 1TWHH 1B70B 3S24A 3DLLA 2Q5AA 2NVQB 3S1QH 1A3TA 4IALA 3S17B 2KEEA 1ASZA 2A6EC 1EU3A 4DU9A 3AFPA 1Z6HA 1SNCA 4GN3B 3NBIA 1LT6D 3W2DA 4C3HH 1VQCA 3T1YL 3QOLA 2BH8A 3BS1A 4EVOA 1NTGA 1NY4A 3CP0A 3H91A 3L7ZC 1EIYB 1ESRA 3VYUA 2R92G 2EZ5W 4DUZQ 4XQNA 3MTSA 1SYFA 4KKUA 2WKDA 2RDGA 2PW5A 4PZ6A 1CSQA 1K28A 2MP1A 5JAVA 2IX3A 1IYUA 1SE3A 3CC7A 3CD6A 2ZM6L 3A56A 4H44C 4LFBL 5CC4A 5ELNA 3MEHA 1K8AC 3V05A 5ELDA 1TS5A 4UDUC 2E2IH 1AH9A 5IGFA 3I4MB 4PMBA 2F0IA 4DR5Q 5ELCA 3KK7A 3OPOA 2E5LQ 1DXMA 4RH6A 2NVYB 1B53A 1O7ZA 3J7YW 3L0OA 2PQAB 4RGNA 3RN5A 2RDFA 1PZID 4CJ2C 3S15B 1V9PA 2CWPA 2WAQG 1VQ9A 4JI8L 1SROA 2L9HA 2Z1CA 1TWAB 2LKVA 5IGGA 5EQ0A 2CW0C 2EZVA 3SHLA 4GOPA 3S2DB 1L0YB 3H0GB 1TVXA 1JJGA 2UXCL 4X6AH 1P16A 4IQZA 1RJTA 1EIHA 1TWFB 3HOUH 3SVMA 4C56C 5IYBG 1LT3D 3D4RA 2JE6I 1YJ9A 2KCNA 4YWMA 4DUYQ 1VMPA 3E0EA 1I4RA 1D2BA 3HOZG 4A3BB 1FD7D 1HFGA 3EFXD 5ELFA 1STNA 4EQPA 1R9TB 5IYDH 1LT4D 1N8RC 3NXWA 3QB3A 4OO1H 1NBWA 1HNWQ 2Z6KC 2YYZA 2VQFL 1VQDA 1AFPA 2BDNA 3U9SA 1UNSA 3L3OC 2JA7G 2N8NA 3OOCA 2JSOA 2JXWA 2QILA 3FP9A 1C7YA 2K5DA 2KHIA 3PMFA 4LF4Q 1K0SA 3U4ZA 4IZ8A 1J8IA 3P75A 3BU2A 2NYZD 1EQQA 3OIPA 1I5HW 4LFAL 3TBIB 1KXLA 1GUOA 1BNZA 2CFMA 1A2UA 3ITPA 2YAJB 2R7FA 5M3FH 1WJJA 4G7ZC 2VW9A 1XNRL 4HEDA 3I4NG 3K0XA 3NENA 1TQOA 1D1KA 1E3PA 3J81j 1EQRA 3KADA 1ENCA 4LJZC 3A7LA 4IUQA 4BBSG 3DXJC 1WTOA 1HNZQ 1FL0A 1KL9A 4OIKA 1G8ZD 2HCIA 1I4PA 3ULLA 3NUCA 5CBEE 2OT2A 4K14A 2HHHQ 4KD3A 4LF6L 1EY0A 2ASBA 4LF4L 2EJFC 2CHBD 3OMGA 1DJRD 3IAYA 3JC66 1CTMA 2MDIA 2JK8A 4QB4A 4BY1H 3KJOA 2CQOA 4O1NA 4UHVA 1PHJA 4WRDA 3UDFA 5IOCA 1AZPA 2K52A 1PZKD 1L2FA 1SNDA 2R93B 2HD3A 4JVZA 1XTCD 5HGQA 2TSSA 4HMJA 1N34L 4I7AA 4HMIA 5C3EB 1ESFA 3GD7A 2R7ZB 3N52A 2JMFA 4DV6L 1XMQQ 1SE4A 1T5XD 1Y1WB 1Q3LA 1RD9D 3GTMH 1GVPA 2PZTA 2KUMA 4ZKCB 4BXXG 1M1KC 4P75A 5CV7A 1YW5A
chains in the Genus database with same CATH topology
4NPSA 5JOBA 5IWAQ 1SFOB 1MJEA 1H9KA 3HOZB 4A0TA 2XWJB 4L5TA 2K5QA 2KHSA 4FF4A 4U673 3HKZB 1YNJC 5BR8L 2MO1A 2RVLA 1S5BD 1K9QA 2JA7H 4X62Q 4K0KQ 2B2YC 2JXMB 1VDZA 1J5EQ 1YJWA 3SK8A 4B3RQ 4A3IH 4BBRB 2BCOA 4KKSA 3F8TA 3GTLH 1NMVA 4QGUA 4PV1C 4LF5L 2PZUA 1N33Q 3NTHA 1XYIA 5LL6S 3C3LA 2N78A 2B63G 1XNRQ 3NTPA 3HOUG 3TSSA 3AFQA 2RQXA 4DV0Q 3V96A 4QJFA 4QIWE 2LMCB 4JV5Q 3KF8A 3VR5A 1Q46A 1FJGL 2WIIB 4IUVA 3KAGA 3SR1A 1ICWA 1O7LA 4UP7A 2BH2A 3GQBA 2DY7A 1WOCA 2PCFB 3FKIB 1HNXQ 3MHBA 3IFTA 4ZUIA 1M4VA 4AIMA 1ML0D 5JJKA 1NAPA 1K8GA 2H5XA 4POGA 3MZ5A 1FLCA 3RLOA 2NVTB 2UUCQ 1V1PB 2I07B 4E6IA 4JI5L 1K9RA 5CR3A 4ZUJA 1BCPC 1RP5A 5KIXA 1GUNA 2JA6G 1A63A 2VL6A 3JAML 3CCQA 1D6EC 2JA6B 1WTRA 2DWVA 1LTTD 3J80E 1LM0A 3KBGA 4WJ4A 2RSOA 5HURA 1BCPB 2RHQB 2PYKA 2MO0A 3OTOQ 4KN7C 1GOZA 1VQEA 4OWTB 3H6MA 3E9IA 3BVZA 3BVGA 3HZXA 2L5TA 3LKXB 2K7VA 4HJ5A 2IX0A 4RG1A 2F4IA 3CHBD 3I4LA 1PH1A 4DV4L 2CCZA 1IKLA 2OQ0A 1B9NA 2EDGA 3OW7A 2B8GA 1SYGA 1G51A 3K7UC 1EG3A 5JEAJ 3I91A 1Y1VH 2D9UA 1AEXA 1EOTA 5KGUA 2JA8B 1WD0A 3U58A 2K03A 5BN4A 3D4WA 1GJXA 2UUBL 2XRSD 4KJOA 1HNWL 3K5NA 3S17H 1PFNA 3I4NB 5IP9G 1PH7A 2HQLA 1EQVA 3I55A 1JOQA 1ZEQX 1WTWA 2K28A 3D4DA 2NN6H 3VYTA 1D5XC 2MQHA 2UUCL 1PH3A 4XTCS 4DXGA 3PO3B 2YSIA 1HR0L 3CNGA 2XP7A 1O6WA 1KQSA 2AMCB 1BXTA 3NBHA 2EE1A 3M3YB 4A3MH 2ZXPA 1HTLD 1HNXL 1OXUA 2Q2IA 1S3OA 3H3VI 5K5PA 1IL8A 2FFKB 3I56A 3K7AB 4DR4L 3KOJA 1FNWA 2F0GA 3I4MH 4HIOA 3GTKH 4JV5L 1YHBA 4IURA 3GTOB 2G9DA 3KF8B 4L5RC 5EPKA 3U50C 1KDAA 4CJ1B 5DM63 1X6OA 1SNPA 3GP7A 3DM3A 3QO2A 3CKIB 3I70A 1PH2A 1B4OA 4K5VA 2VS1A 3Q24A 4JG2A 1IL2A 3N6RA 1LTRD 1WCMB 3RLNA 4NXNL 4BY1G 1CQVA 3S2DH 4JI2L 1ZXTA 2ZR5A 1EU4A 2OWOA 4DV5Q 3S14H 1HZAA 3ONAB 5IYBH 2Q8RE 1I4XA 1ILQA 1LLRD 1HZCA 2VUMH 3R3OA 4F7XA 1FYCA 5J3BA 4A93H 1L0XB 1V8QA 1VQLA 4H13C 2LAJA 3CCUA 5E7NA 1SR3A 2B2UA 4R4IA 3AB9A 1IW7C 4U86A 3NEMA 3NWSA 3KYHC 4QCLA 1ONLA 1F9PA 4DV6Q 1ILPA 1NMGA 1TWGH 4ULLA 4DV2Q 2KVMA 5ELEA 1JOKA 2B2VC 2EYOA 4X3TA 1XNQL 1TWCH 3D8GA 2ZJRA 3HKZG 1Z7TA 4LFCL 5GADC 2NN6I 3ERQA 1PH4A 1O7IA 1B9MA 1TXYA 2E8GA 1LTGD 3NELA 1MBYA 4GOPB 1QUQB 2XTIA 1LTLA 2EJMA 3Q0AA 1MJCA 3CW2C 2ZXRA 3J81i 1STAA 1EY4A 1E1OA 1QWYA 1HZBA 3B6YA 4YWKA 1U9RA 2J4XA 1HNZL 4OWWB 4DFAA 3TMEA 3MAQA 1PRTF 4ALPA 5EJWA 2NTTA 2F0EA 1J9OA 3NQIA 2KBNA 4XT1B 1C48A 1LTID 2E2HH 1OXSC 3J7ZC 4FVMA 5DEHA 1STYA 2R93G 3FKIG 2NB0A 3I7FA 4DAPA 3D6WA 2F4VQ 2XIWA 1HUMA 4CKCA 4A3GH 1S4ZA 5IT9E 1CHPD 5I6WA 3TEHB 2PQAA 3CPWA 1ASYA 3PUYA 1YZ6A 3CCRA 2Z4HA 1GHKA 1IBLL 1C9OA 2ICIA 2K5HA 1CKNA 1PYWD 1QG7A 2B63B 3MXNA 1D7QA 1RODA 4O0AA 2MHVA 1VQIA 4MNOA 4DR2Q 4K5WA 3FHWA 2A1AA 3TCZA 1Y1VG 4BBSB 4IPDA 2DY8A 1CZWA 3GV3A 3K80C 2YTVA 2QRVA 1DOKA 5E66A 1EG4A 4ZK9B 4UP9A 3W5OA 1BR9A 1KRSA 2ZQUA 2C35B 1PMRA 1IBLQ 4FXKC 5LMNW 1PH6A 2RF4A 3MEFA 2E2JH 1BKBA 5I9OA 4DV1Q 3HS0C 3RUZA 5M5XH 1PTOB 3A8IE 1PYBA 3GO5A 2PO4A 2ZR4A 1KC8C 3HOWG 2EYFA 5M3FG 2JA7B 1W3SA 2B3GA 3KJPA 3MFYA 3FDTA 5EPJA 3OW2A 2F4VL 1YNJD 3OWFA 1AE3A 2EJGC 1RTNA 4LK1C 3M85A 4X3KA 3PUZA 1EY8A 2GN5A 3G48A 4ME5A 3KABA 4UAIA 1X9NA 2E5LL 1SNMA 1JCKB 2PI2E 4APVA 4P74A 4HJ8A 1Q82C 1TKWB 1Y1WG 4DV0L 1EWCA 3TP7A 2JA5H 1I3QH 4NDXA 3HOVB 1EY6A 4DN4M 3F1ZA 1JWMD 5CV6A 2R3ZA 4DGZA 2DJYA 4IPCA 2L55A 1LUZA 3BVMA 3AQQA 2SNSA 3D3RA 4LF5Q 5C5MA 4J15A 3CMAA 1Q12A 5C44B 5C0XJ 1CHQD 4LUZA 1RKNA 2V1CC 1OO9B 2ZQVA 1LABA 4F87A 1PYSB 3C2PA 1NE3A 1RCVD 1XPRA 2PQEA 2AUJD 2D2CC 3A54A 5M3MH 1ZCNA 3FKIH 4XIGS 1W6KA 1WMVA 1QNUA 4A3MG 1LACA 4DV7Q 5IT9L 1G91A 5C6AA 1YBYA 1SEBD 4A3FH 2A6HC 1Y8PB 3ODKA 1Q1EA 4J6HA 4HJAA 4DA2A 4F8MA 1GUWA 3TP5A 2NVTH 3FS8A 2EY6A 4J8QA 3G6JB 3QJYA 2Y8NB 4C1NK 5M5YH 1EYCA 1BQQT 2L11A 1EIGA 2CW0D 2F0WA 3SK6A 1M8AA 1BBWA 3GTJB 3HOXH 1N32L 3SK4A 1JJ2A 5J1ZA 3NPPA 2JA6H 5CMDA 4A76A 5JPNC 2PZWA 2YSFA 4P72A 3VDYA 4EQNA 4HJ7A 1KAWA 3M7GA 2PMZE 5C4XH 1QUQA 1NR2A 3K59A 4GKKQ 4DAYB 2IJ0A 2R92B 3ND8A 3S1NH 1N36Q 1VQGA 1RTOA 3X3MA 1WVLA 1VQMA 2L15A 5JVG3 2ES2A 2IX1A 4LWCA 1ZYRD 1GKHA 4C2MH 4DR7L 2M2LA 4BXXH 2RHSB 1YIJA 1WTQA 4XQJA 4IFDH 2G9HD 2BE5C 1PFSA 4TVAB 3TP6A 4OWXB 5K36H 1A3VA 2Q8TA 4K6DA 1I50H 4U85A 4IFDI 1X65A 3JAME 4OXPA 3IFDA 4KY5A 2UXDL 3J81E 1U5KA 5C44G 1PZJD 4X64L 3GDEA 1D8LA 1GHJA 1XPUA 1LT5D 5LMNL 3VYSA 2IWHA 5IGDA 3C46A 4UPAA 4X65L 3I73A 1UE1A 1S72A 1K83B 1XX8A 4C3IH 1A6XA 1O78A 4TKOB 1CSPA 3OIQA 1L1OB 2KEDA 1GM5A 2YSGA 4JBJA 3LWEA 5KYIA 2WAQE 2WB1E 4DAMA 3PO3H 4GLXA 5JJLA 2MPMA 5JJZA 2K01A 3KLSX 1WR7A 3HKSA 4PMCA 2A8VA 4KKTA 4HSPA 2VZAA 5HGTA 4DR2L 4JOIA 1IBML 4B3SQ 4DR1Q 3PQHA 3HOWB 1EIFA 2TMPA 4A3EB 1DONA 2KJXA 3K7AH 2H1EA 1I6HB 3M9BA 4IUUA 4C3JB 3I90A 5LMNQ 3AEVA 1JWUD 2VB3X 4A3JG 5C3WA 3STBD 1F9SA 2I0QA 2NZHA 3NTIA 5M9OA 1FGBD 1SMYC 3ZJYC 5EKKA 1X54A 3NP8A 4RA8A 5NUCA 1ENFA 1QOHA 5CV8A 2E74C 3CC4A 2I5HA 2Y0SE 1ET9A 2XP3A 1KDBA 2C5CA 1E0BA 4AYBG 3GTPH 2B2UC 3S14B 2XSCA 4A3KH 1PRTB 1K9MC 1KHIA 4K2KA 2WB1G 3G71A 2AWOA 3BJUA 2HIXA 3ULJA 4ODGA 2UU9Q 2HDLA 5FK9C 4B9XA 1QNKA 1B3AA 1F2YA 2ALYB 3TN2A 2A5HA 2ZM6Q 1XTDA 3P1HA 4HIMA 2Q2TA 2J0TD 1F2ZA 1XNQQ 3F2DA 5AJ3L 3SK5A 5M5WH 4TQUS 4E5RA 4CKEA 3FPPA 1BOSA 1VF5C 1CK1A 4DAYA 2AQ3B 2V4DA 2VXWA 4H02A 1D5MC 1QVFA 4CHTB 2A73B 2NVXH 2AUKA 3EIVA 4FO2A 2BA1A 2XN9C 1A62A 1YHQA 2NVQH 4LF7Q 1CM9A 5AJ3Q 4A0UA 4JI0Q 5JJIA 4DAVA 4JI1Q 2X69A 2WADA 4YHHQ 5C4JB 5KEEA 4C3HB 1I5FA 1J6QA 5IIFA 3Q8DA 4JYAL 2AQ2B 1EWHA 2K5WA 4A3DB 1QZHA 5JEAH 4TSSA 1BVSA 3T1HL 1EYDA 1HFNA 3DWAA 2UUBQ 5EAYA 1PTOF 4LUVA 2LFNA 2FXQA 5FJ8G 4J1MA 1TY0A 4C3JG 1ZKOA 4YCVA 1LTSD 4HIDA 3J80L 2EIFA 2K5NA 3JAMc 3L2PA 3S1MH 3AU7A 3F2BA 1JR0D 3ND9A 2B2TC 3TS0A 4GNXB 4X62L 4K0KL 4KN4C 4ZAIA 4FF1A 3BDLA 1X3EA 3D31A 1OXXK 4PG3A 4FDBA 4JI7Q 4L8JA 3H3VC 4C3IG 2JEBI 3H3VH 2E2IB 2F0PA 5CGKA 1EZ8A 1IXRA 3RNUA 4B08A 3I3CA 3A8JE 4LFAQ 1A8VA 1VQBA 2NN6G 3J7AV 5DLQE 4B3TQ 4NW2A 2BA0A 2K5VA 1YEZA 1JQYD 4BBSH 1JORA 3T13A 3V2TA 3SEBA 2YU9B 5FOBB 5C4HA 4DR1L 3M4PA 4M8AA 4JI4Q 1V43A 5IGEA 1UUPA 2QGQA 1CQFA 4DK1A 1S40A 4PNYA 3H0GH 1CZGA 1PINA 1VQ5A 2EVBA 2ID0A 2E2JB 4V0BA 1IHZA 3JAMi 2F0LA 3S1RH 2K6AA 4DNRB 1TWFH 1STHA 4A3GG 3HOUB 1K3RA 2XVSA 1UE5A 3CCMA 3MXGA 2E2DC 2PMZB 1H9RA 4CKBA 3R2TA 3MCBA 2K04A 1E2VA 4LAAA 5H1SE 4YY3L 4YWLA 4KHVA 3DMUA 2A74C 3FPUB 4IJHA 3FMCA 3J81L 4R4QA 4UY8C 5A35A 1R9TH 3KFUA 4ZKBB 1G6PA 4JI6L 1VCIA 1T5EA 1MKHA 4GLAC 1GUSA 1I3QB 1ET6A 1PLFA 2D5DA 4QF4A 2RSNA 4LF7L 2F0OA 2YV5A 3HEJA 4DV4Q 2C9OA 4RAUC 4DR3L 3BDCA 2Z8LA 5FLXE 2BDOA 1CKNB 5HY6A 3TZUA 3GTQB 3UDIA 1PH8A 3CQZB 4R8NA 4A3CG 1WTXA 5C44H 3CCLA 4A3DG 2I46A 3DHQA 1YVCA 4BY7B 4QY7A 4OHJA 5CORA 4DR5L 4L5QA 4OO1G 4ZQ3A 2VUMG 1UEBA 2B2WA 2QCPX 3R93A 5IP9H 1IYVA 1SJED 3EN2A 4RWSC 3QWNA 2N55A 5E65A 1KNAA 1KRTA 3P20A 2AKWB 4GS3A 1HA6A 2VQFQ 1YHAA 4A3FB 3VR2A 2F3WA 4G7HC 1EEID 1HPCA 3I8ZA 1X3FA 4KJNA 2M8JA 4R4OA 1WI5A 5FO8B 4A3LG 2VB2X 1U0LA 2Y0SG 4A3JH 1DM0B 2AQ1B 4RHSA 5M5YB 3RZOH 2Q2HA 4WFN3 4BY1B 2HT1A 1DOMA 4DUYL 1U4PA 1WCMG 1C0AA 2RA4A 2SOBA 2OEOA 5C0XH 2XNAC 3BG3A 3J7A5 4HJ9A 1STGA 4IUNA 1A0IA 2A68C 4FNFA 4DV7L 1DYQA 1R4QB 2R61A 4XYOA 4X3SA 1WFQA 1OTCA 1NUCA 2IHFA 1N34Q 3BYTB 1HTPA 3KUPA 3RN2A 2LXKA 2F21A 5IGCA 2XP9A 5IYCG 2L4NA 1MD2D 1H9SB 2SDFA 2JEAI 4A3BG 2F0JA 2JYOA 2K1BA 1E7ZA 3TP8A 1VQ7A 4IUTA 4NXNQ 4GKJL 1TIID 3U4VA 4P73A 1EY7A 1SE2A 3KBXA 3SXHA 3CAMA 1B50A 4H7BA 3URYA 3PGZA 1S5FD 2XP8A 1SYCA 3HOZH 1I50B 2ATWA 4R4TA 2M3OW 4NP5A 3GV6A 1VQJA 4LF9Q 5FLMH 1K8MA 4GNXA 5BR8Q 3OOBA 3PCOB 4LFBQ 1LTAD 1F8AB 5CBAE 2F0QA 1K8OA 5EKLA 4XT3B 1MSGA 1HZ9A 4A3EG 2EY5A 1K83H 2F0HA 1XMOQ 3LX0A 4A3IB 3ER0A 1HXYD 5IY0A 4JOIC 1KIXA 4DNTB 3NE5B 3PIPA 4N9PA 4L6TB 1UE6A 4GLVB 5C4ZA 4DNIA 2XPAA 5KNBA 1PFBA 5J22A 2O5IC 3J80c 3W3AA 2YSHA 3K0YA 3FEWX 4KD4A 1FNVA 3HOYB 1E24A 3HOWH 2EYPA 2OF1A 3LWUA 1IBKL 3HGBA 3S1QB 4FF2A 4NMZA 2B8FA 4S3SA 4LUOA 2JJQA 1EYGA 3CCJA 2ZQSA 4C3JH 1SNQA 2A19A 1PTOC 2H4OA 3GTGB 3K6OA 2WKCA 5FO9B 3MCBB 1RL2A 2UUAL 3U9OA 5BN3A 2AHOB 1IBKQ 2JA5G 4F88A 4KHPQ 4A3FG 1VS0A 2F1MA 3I4MG 3O13A 1CA6A 5IP7G 2UXCQ 4XXEA 3T51B 3TQYA 3NSWA 2SNMA 1EZ6A 1PXUA 4FXDA 3D6CA 4JI8Q 4C1NI 1G2TA 3K8AA 2OTJA 2ZAJA 5AHTA 5GROA 1PRTC 1XJVA 4ZRZA 2BE5D 4WORA 1O7YA 1S5ED 4HN7A 4XYQA 1IYJB 2OQKA 3PF4A 1JB7A 1DGSA 2F0FA 3G6EA 4A4IA 5BN5A 4REXA 3VYRA 1VQ6A 4KY6A 1Y69U 1TU2B 5C4XG 1YNXA 2NZOA 1VQFA 4G7OC 2N49A 3SGIA 4R4CA 4DK3C 2YTXA 3BDOA 2HUGA 4CBVA 1CA5A 3CCEA 3HOXG 3BZCA 4IUPA 1TWAH 2GA4B 4HCEA 1HRJA 4POFA 4QUFA 3F2CA 2NVXB 1DCZA 4DUZL 3MQHA 4R1JA 1II3A 5TSSA 4LF8L 5E5WA 5A2QE 3T4AC 3DWPA 1NJIC 2LS01 1UAPA 1NR4A 5DM73 3EBEA 4A3BH 3HOYG 5KNCA 2JX8A 1EQTA 4QQBX 3CCSA 4HTHA 5FLMG 2UXBL 1B2TA 3RZDH 3H15A 3S16H 3KAFA 1BF4A 4GZYC 4MZ9A 3R2IA 2FMMA 3OMCA 3ZYYX 3S1MB 5I2YA 3OYYA 3HOVG 1I4HA 3T53B 1VQHA 2PNHA 4JI3Q 2F0MA 2F52A 3NWTA 1TS2A 1N33L 4HR7B 2KCTA 2K05A 5EBCA 1KDCA 1J5EL 4OL7A 4Z9CB 2IL8A 5M3FB 2X6LA 1DD2A 5IYCH 1VQAA 3GTKB 1SYEA 1RF2D 5I4DA 3PO3G 2A69D 1ENAA 1B1ZA 3R8BA 2EXDA 3GTOH 3EJIA 4P71A 2HDMA 1N9WA 2IY5B 2MGSA 4R9WA 4OONA 2M00A 3E0JA 4YCUA 2B2VA 4K6LA 4RMFA 2ZTDA 3NTKA 2N3SA 1FR3A 1CFMA 5CV5A 1E2ZA 3M4YA 1Q8KA 1KLUD 4IOAA 3S1RB 1X56A 3A5ZB 2VQEL 5KRUA 3A0JA 2R93H 1SBBB 1FNUA 4HSVA 2VUMB 3C1FA 3PUVA 3DM1A 2KOLA 2UUAQ 4ME3A 2IW3A 1Y8OB 1N36L 1S5DD 4G57A 5I2XA 5C3EH 3KDFA 5KNDA 1KD1C 2Q8IB 5COYA 5KYLA 2NUCA 4JYAQ 3FVQA 2DK7A 2F3VA 2R7ZH 4B3MQ 4OX9Q 4OX9L 1GUGA 1HJPA 1TWGB 1Y1WH 4PZ8A 1HH2P 2A6HD 1N32Q 4A3KG 3L4HA 1TWCB 1STEA 2VQEQ 3GTQH 3CQZH 1M90C 2WB1B 1WD1A 3W1BA 1Q90A 3J81c 1SAPA 2O2LD 1YNND 4BY7H 2L12A 1U4RA 2RE3A 2QF7A 1XWEA 4Y7NH 4DPGA 1L0WA 1I4GA 5C3XA 4KK7A 2JA9A 1XMOL 3DWQA 4XQQA 3MQGA 4BA2I 3A7AB 4FXGC 3SDZA 2R6GA 3GTLB 1PTOD 1W2BA 3IKJA 3KLSA 5T1IA 2F3IA 2QKIC 1LYLA 3KLRA 1PH9A 2ZR6A 4DV5L 1XPOA 1TY2A 1PV4A 1BCPD 5M3MG 3CXCA 2E2HB 1HA5A 1HCZA 2EYJA 2K4KA 4JI5Q 4A3JB 1OXVA 3H0GG 5CV9A 3FSBA 1DOLA 5ISRA 3PSIA 5JVH3 1E22A 5D14A 3S9WA 1BBXC 1GUTA 2BOSA 1I94Q 3WH0A 3I2ZA 2F0TA 1BBUA 4XDXA 1VQOA 5U47A 1KABA 4JC0A 4O2DA 3EA6A 2YSBA 4JCVE 5E4XA 2QDBA 2K14A 4BS9A 4RHRA 4BBRG 3PO2H 2A69C 3A8KE 2KCMA 2B63H 3PIO3 5GAHC 2ZT9C 1QVCA 2MFIA 2KA7A 1IZ6A 2B39A 3LKXA 4KY7A 4YY3Q 1HQMC 2QEJC 1YI2A 1CT1D 4V190 1MI2A 1I94L 4YCWA 4X66Q 1UEAB 1CI3M 2B2YA 2ICEC 1PH5A 1H9JA 1IBMQ 1PTOH 4B3SL 2D62A 3PV0A 5G3LF 3NBHB 4Y52H 5F2DA 1FVIA 4LF8Q 2L1BA 1L1OC 2E75C 1JE4A 4KTAA 3DEOA 4JI4L 1I4QA 2R7ZG 2JQOA 2UU9L 1TT2A 4MIUA 1SE8A 4LW1A 3K5LA 4RKBA 4KLKA 3RR5A 3OSOA 5JEAG 3VR3A 2JV4A 2MJ8A 1T9HA 4NB3A 3HOVH 3CMEA 2E45A 3MXPA 1LO5D 3W1GA 1X3GA 1EWIA 1C4QA 5E1FA 1TR8A 1EYAA 4FF3A 2XP4A 3J7AF 4O42A 1P8LA 2HIVA 1Y1VB 2DNCA 2KXQA 2L0CA 3T16A 2CWAA 4JK1C 2QEXA 3MA2B 5C0XG 3DUZA 2J7ZA 3UDXA 4KI0A 3E9HA 1LTBD 4PQXA 1KTKA 3KF6A 4DKAC 1JJCB 1YJNA 3I4NH 3HFZB 4JI6Q 3GTGH 4OO1I 1RIPA 4P2CB 1O80A 3BYYB 3TZDA 2PPBC 1A15A 2FINB 3TDBA 1K73C 2DN8A 2SEBD 5K36G 1C8CA 3K81C 2EQSA 2IPKD 4RCNA 2K50A 4GKKL 2WINB 4QMGA 3X3NA 1CKMA 2WP8J 4KHPL 1JB3A 1SYDA 5GAGC 2NZ1D 1U4LA 1F2LA 5FO7B 3PF5A 4DR6Q 4DR6L 4AQYL 4B3ML 4A3MB 4AH6A 4JBKA 3M3YH 1RDPD 2M9VA 3KLWA 3E5SA 4LFCQ 1AP0A 4JI1L 2O5JC 1B7YB 4ID6A 4ZYSA 2OCEA 3TRZA 3KAHA 3Q6SA 2F03A 1JWSD 1JT8A 3MC0B 2WAEA 4RGOS 4N9TA 1BCPF 4EX5A 3F2UA 1QCBD 1TS3A 1SMYD 1U4MA 3PIOA 2R92H 5CV4A 3MWYW 2KQ3A 4AYBB 2QA4A 2JP1A 2D0OA 2KHJA 2FMCA 1GD7A 5GQOA 1EOVA 1HQRD 2ZXOA 3WDNA 3ULPA 5IODA 4C2MB 1SNOA 3Q23A 1UWVA 1Q1BA 5IE8A 5IP7H 4A93G 2GVAA 5ELOA 1WCMH 4HAEA 3CU7A 3WOEA 2Z4IA 1VQNA 5CYUA 4NXMQ 1MGSA 2K33A 3C1EA 3EQLC 3NHHA 1FGUA 5LHY1 4K5XA 4K2LA 4JI3L 3S2HB 3A55A 1AE2A 4GKJQ 4IFDG 3KCEA 2WAQB 1YNNC 4A93B 2Y0SB 1E2WA 4C3IB 2DUDA 3QG1A 3ICEA 4AQYQ 2Z0SA 3VA5A 3IRBA 4RFBA 5E3FA 4X3UA 3TREA 2DGYA 4A3IG 3M4OB 4JI0L 3RZDB 3S16B 1DZ1A 5ELBA 1Q8IA 5IWAL 2NWGA 4A75A 3G7LA 5GAEC 1KLGD 2ENBA 3MXNB 3HP3A 4KMUC 3K5MA 2XP6A 2B29A 3P7JA 1TWHB 2NTSA 2WACA 5LMUQ 4LNQA 4MHEA 1SDFA 4DV3Q 4A3EH 2A6ED 1CUKA 2K75A 4C3HG 2FHTA 1SLJA 1D5ZC 3K57A 1XXGA 1L1OA 2MNAA 2AWNA 1HR0W 4EQOA 3QIAA 2IT1A 2EXZA 2RCNA 5EKIA 3G4SA 1STBA 3H94A 5LL6X 2EPBA 3PUXA 4GNXC 1V1OA 3OHXC 2VY3A 3KDFB 2CQAA 2B2WC 2EYMA 2XRQD 2O4XA 1E1TA 4IO9A 1MIUA 4X64Q 4WJ3M 1Z9FA 3CRLC 3UI2A 4A3KB 2Z6KA 5IT9c 2HHHL 4A3GB 1OXTA 4QIWB 3NK9A 5D3DA 1V1QA 3KAIA 3WOFA 2DMVA 5AFWA 3T1YQ 4IJLA 4Q0FA 3PUWA 2F0SA 1H9MA 3PO2G 4DV3L 5E64A 3VR6A 4DXFA 3KF6B 4X66L 1Y14B 4EQ5A 3OTOL 2MUYA 2N88A 1QILA 5I9PA 1KNEA 2EOTA 1SMXA 2NVYH 1R4PB 5DAUA 5M5WB 1S5CD 4U84A 3MFGA 4IN3A 3S15H 4ABNA 1B44D 4FYDA 4RGTA 2RDHA 2F0KA 4QUCA 5E4WC 3VA7A 3MXUA 1PFMA 1QJOA 4OIJA 1Z47A 4NKLA 3A74A 4CGYB 4QL5A 4BY7G 1VQ8A 5M5XB 4PZ7A 1F2MA 2XP5A 4K8IA 2M8IA 1JMCA 5FJ8H 5DNFA 2ZJPA 2ITKA 4Y7NB 2D0PA 5D3IB 1K0RA 3PIP3 1W6JA 4HCSA 3NQTA 5C4JH 1EFID 3Q22A 4A3CH 5C5LA 2EYLA 3RMHA 2ZQTA 5D65A 4A3DH 4PMWA 4U68A 5J39A 2JA5B 3E6ZX 1IKMA 2UXDQ 1FJGQ 3EROA 3WWVA 3FRPB 4TRDA 1EFWA 4B3TL 4JI7L 4UP8A 2HCCA 4OGQC 5IGBA 1CKOA 3L9AX 1QZGA 1KAAA 3OWEB 2FJ2A 1BO0A 5JPMC 3TC5A 1I6VC 1QVGA 1NSNS 1AZQA 1SSOA 3QOJA 2A68D 4CJ0B 2KECA 4A3LH 5A2QL 5EGTA 5E62A 2KENA 5M3MB 2KCCA 1Q86C 2B2TA 1SN8A 1QB5D 3HRZC 4LF9L 4B3RL 1EY5A 3I4OA 3LE4A 1X3PA 3AMUA 3PO2B 4MN3A 1Y8NB 2K32A 4K8JA 1G291 3RD4A 3AYHB 1PDQA 5EBDA 1X55A 3H09A 2ZJQA 3BZDB 4GN5A 2EY1A 2YU9H 3TDQA 1EL0A 2OXPA 1GO3E 2LY7A 1BUVT 3T1HQ 1BDOA 1SRUA 4IPGA 2WFWA 2XGTA 4RGMA 1AN8A 5EPLA 5G3LD 2F0UA 1ZYRC 4DV2L 1VMCA 1X32A 3HOXB 1HHVA 1JE5A 1GXDC 3HKZE 4YHHL 3GTJH 4DV1L 4RKLA 2XWBB 1LV9A 1XMQL 2XPBA 1EY9A 4L63B 4MTNA 2JA8G 3A5UA 1NMFA 1F9QA 5FLXL 4AYBE 1HR0Q 3M4QA 1Q7YC 1EUJA 2L4JA 1G2SA 3UE0A 1WTVA 5C4XB 3DEPA 4JBWA 1F9RA 3S1NB 2I5MX 2R7DA 1G6ZA 1JOOA 4DK0A 5CQ2A 1TR5A 3LGJA 2EY2A 4H0LC 3K5OA 3TS2A 4LMQD 4R8IA 4JI2Q 3GTMB 4KHZA 1NCVA 2PNRC 4ILWA 2IHEA 5T1GA 5I6YA 5FLXc 5IYDG 2HQEA 2DNEA 2F0VA 1SFOH 1UE7A 1VF7A 1Q81C 3MVVA 5C3EG 2DK1A 3STBC 4LF6Q 4I65A 3BZKA 4YIJA 1VQ4A 4DR3Q 3HG9A 4BWGB 1IW7D 1EEFD 1RHPA 1SXTA 3LNNA 4HIKA 2VNUD 4BBRH 1V1PA 2PW7A 1JC7A 5LMUL 4BA1I 2YTYA 3I72A 4ZLTF 1X3QA 2UXBQ 4GN4B 2PI2A 1A3UA 1A2TA 2NBFA 1YITA 3CRKC 4I7ZC 5C0XI 4L5SA 3RZOB 1PRTD 3IL8A 4B9WA 2CKZB 1I6HH 2OTLA 2ZTEA 1WTPA 1WYDA 1QE6A 2E76C 3UDGA 2ZTCA 2F0NA 2LXJA 4G4KA 3T56B 4X65Q 4NXML 1JICA 2WV6D 3M7NA 2I5LX 2GVBA 4DK6C 1JMQA 2CVRA 4WJWA 3RLFA 1TS4A 2RKSA 1VQKA 4GOPC 3GTPB 3K58A 1D1IA 3UE1A 3S2HH 2LSSA 1B8AA 3CC2A 3D0FA 3CPFA 4DR7Q 4JBMA 3CF5A 2F0DA 1VQPA 3ERSX 4EGVA 1AW7A 3J80i 1SJHD 1H9SA 2X6GA 5FKAC 4FP5D 4Q5VA 1PVOA 4QIBA 2RBMA 1F77A 1MSHA 3FSCA 4RCOA 3CCVA 3M4OH 4M1UB 4IPHA 4DF7A 4IOCA 1H95A 2EYHA 1SYBA 1TK7A 2Q2UA 4KV6A 3EVQA 3HOYH 4DR4Q 1PA6A 1HUNA 4IFDJ 3SE0A 3VR4A 2JA8H 1TWHH 1B70B 2NVQB 3S24A 2Q5AA 3DLLA 3S1QH 1A3TA 4IALA 3S17B 2KEEA 1ASZA 2A6EC 1EU3A 4DU9A 3AFPA 1Z6HA 1SNCA 4GN3B 3NBIA 1LT6D 3W2DA 4C3HH 1VQCA 3T1YL 3QOLA 2BH8A 3BS1A 4EVOA 1NTGA 3L7ZC 1NY4A 3H91A 3CP0A 1EIYB 1ESRA 3VYUA 2R92G 2EZ5W 4DUZQ 4XQNA 3MTSA 1SYFA 4KKUA 2WKDA