The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.
Total Genus |
42
|
sequence length |
179
|
structure length |
179
|
Chain Sequence |
MRFVMPGDRIGSAEEYVKGEGVYEEGGELFAAVAGKLIIKDRVAKVESISPIPEIVKGDVVLGRVVDLRNSIALIEVSSKKGENRGPSNRGIGILHVSNVDEGYVKEISEAVGYLDILKARVIGDNLRLSTKEEEMGVLRALCSNCKTEMVREGDILKCPECGRVEKRKISTDYGKGEW
|
The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.
After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.
molecule keywords |
Putative uncharacterized protein AF_0206
|
publication title |
Quantitative analysis of processive RNA degradation by the archaeal RNA exosome
pubmed doi rcsb |
source organism |
Archaeoglobus fulgidus
|
molecule tags |
Hydrolase/rna
|
total genus |
42
|
structure length |
179
|
sequence length |
179
|
chains with identical sequence |
B, C
|
ec nomenclature | |
pdb deposition date | 2010-03-16 |
chain | Pfam Accession Code | Pfam Family Identifier | Pfam Description |
---|---|---|---|
A | PF10447 | EXOSC1 | Exosome component EXOSC1/CSL4 |
A | PF14382 | ECR1_N | Exosome complex exonuclease RRP4 N-terminal region |
cath code
| Class | Architecture | Topology | Homology | Domain |
---|---|---|---|---|---|
Mainly Beta | Single Sheet | Ubiquitin Ligase Nedd4; Chain: W; | Ubiquitin Ligase Nedd4; Chain: W; | ||
Mainly Beta | Beta Barrel | OB fold (Dihydrolipoamide Acetyltransferase, E2P) | OB fold (Dihydrolipoamide Acetyltransferase, E2P) | ||
Mainly Beta | Beta Barrel | OB fold (Dihydrolipoamide Acetyltransferase, E2P) | Nucleic acid-binding proteins |