2ZR6A

Crystal structure of a mutant pin1 peptidyl-prolyl cis-trans isomerase
Total Genus 39
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
39
sequence length
158
structure length
153
Chain Sequence
KLPPGWEKAMSRSSGRVYYFNHITNASQWERPSGGKNGQGEPARVRCSHLLVKHSQSRRPSSWRQEKITRTKEEALELINGYIQKIKSGEEDFESLASQFSDCSSAKARGDLGAFSRGQMQKPFEDASFALRTGEMSGPVFTDSGIHIILRTE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Peptidyl-prolyl cis-trans isomerase NIMA-interacting 1
publication title Structural studies on PIN1 mutants
rcsb
source organism Homo sapiens
molecule tags Isomerase
total genus 39
structure length 153
sequence length 158
ec nomenclature ec 5.2.1.8: Peptidylprolyl isomerase.
pdb deposition date 2008-08-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00397 WW WW domain
A PF00639 Rotamase PPIC-type PPIASE domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.20.70.10 Mainly Beta Single Sheet Ubiquitin Ligase Nedd4; Chain: W; Ubiquitin Ligase Nedd4; Chain: W; 2zr6A01
3.10.50.40 Alpha Beta Roll Chitinase A; domain 3 Chitinase A; domain 3 2zr6A02
3EY6A 4E5RA 2XP6A 3H9RB 4C02B 4J4OA 1YW5A 1D7HA 4ODOA 4JFIA 4GGQA 2PV1A 2XP9A 4IPXA 3VAWA 2MLXA 5HUAA 2JMFA 4DZ3A 5CQ2A 1FKDA 3UQBA 2ZR6A 3KZ7A 1FKBA 2XP4A 3KAFA 4DRIA 3TCZA 2Y78A 2YSIA 1QPFA 1R9HA 5HW7A 5AHTA 5DIVA 1A7XA 4TX0A 2XP8A 3PRDA 2M08A 1ROUA 4LAWA 5I98A 2YSGA 1KT0A 4IQ2A 1J4IA 2M2AA 2ZR4A 3O5EA 1FKHA 4QT3A 3M85A 5HW8A 2N87A 2LAJA 1FD9A 4ODKA 4TNSA 4DRQA 4DRNA 4ODMA 5GPGA 3UF8A 2IF4A 3O5LA 3NTPA 2MF9A 1NMWA 3O5DA 3KCEA 1JNTA 2MLZA 4MGVA 2RUQA 2VCDA 4IQCA 4W9QA 2ZAJA 1PBKA 1JMQA 4JFMA 2RUDA 2FAPA 2DK1A 4ITZA 3UQIA 1YATA 4DZ2A 1FKRA 3KADA 1U79A 3TC5A 2KI3A 4U85A 5BXJA 1TK7A 3KACA 4W9PA 1W26A 1D7JA 1M5YA 2KE0A 2JX8A 2XP5A 2L2SA 5HWCA 3OOBA 3O5GA 4LAXA 1EYMA 5DIUA 2MLYA 1FKKA 2RUCA 1JNSA 1FKFA 2LKNA 3KAGA 3CGNA 1FKIA 3CNGA 2YSBA 3RFWA 3LE4A 4DROA 1NSGA 4NNRA 3UI5A 2M8JA 2YSHA 4FN2A 3PRBA 3ODKA 5D75A 1Q6IA 3UI6A 1J4HA 4JFLA 2DG4A 3NRKA 5HW6A 1O6WA 3TDBA 3JYMA 3PA7A 2MDIA 3JXVA 2KGJA 5HKGA 4ODNA 2DJYA 2XP3A 1EG4A 3KAHA 1WMVA 2YSFA 2VN1A 2KR7A 3MDYB 2ZQUA 1FKJA 2OFNA 1FKLA 1QZ2A 2LPVA 3CGMA 2K8IA 4GIVA 4U84A 3O5QA 4TYOA 1NMVA 4QIBA 1J6YA 1Q1CA 2E45A 4J4NA 2PV2A 3FAPA 4ODPA 2XPAA 1FKTA 2RURA 2JZVA 2D9FA 3I6CA 1I5HW 5DITA 2Q5AA 1K9RA 2MNTA 3UQAA 1BL4A 1P5QA 4U86A 3M7NA 4DRPA 4DIPA 1K9QA 4BF8A 1ZK6A 2M8IA 4LAYA 1PINA 1ROTA 2RSEA 2AWGA 2KXQA 2DMVA 4JFKA 2PPOA 1Q6UA 4QT2A 4O2TA 2F4EA 4REXA 4R0XA 1D7IA 3KAIA 2UZ5A 1JVWA 2ZQTA 1FKSA 3O5PA 3RGCA 2RE3A 2M1IA 1L1PA 4G50A 3O5OA 2PPNA 1EG3A 3WH0A 2PV3A 4TW8A 3O5KA 2RQSA 2XPBA 4JYSA 4DRKA 4TW6A 2DG3A 3L4HA 2ZR5A 2PPPA 2LJ4A 2ZQVA 3IHZA 4DH0A 3KABA 2F21A 2MPHA 4FAPA 2ITKA 4MSPA 4DRJA 5HT1A 4ODRA 4JFJA 2KFWA 3JYJA 2JXWA 2L4JA 2DG9A 3IKDA 4DRHA 5J6EA 2LGOA 1FJDA 1FAPA 1F40A 1TCOC 1QPLA 4DT4A 3GPKA 3O5IA 1KT1A 4G2PA 2FKEA 5B8IC 4N19A 2ZQSA 1HXVA 1Q6HA 3O5FA 1F8AB 2DWVA 2XP7A 1C9HA 2DK7A 5HWBA 2M3OW 2EZ5W 3IK8A 1N1AA 1D6OA 5HTGA 2PBCA 1WR7A 3O5JA 4DRMA 3IKGA 4TW7A 1BKFA 3O5RA 4ODQA 3NI6A 1EQ3A 1J4RA 4W9OA 2JV4A 1FKGA 4ODLA 1B6CA 2BA1A 2KO7A 3B7XA 4LAVA 3LUOA 2F2DA 3O5MA 1T11A 1Y0OA 3UI4A 1ZCNA
chains in the Genus database with same CATH superfamily
3EY6A 4E5RA 1WB0A 2DSWA 2XP6A 4NZCA 3H9RB 4C02B 4J4OA 1YW5A 3AS0A 1ZBVA 1D7HA 3AS2A 4ODOA 1XRVA 1H0GA 4Z2JA 4JFIA 4GGQA 4Z2LA 2PV1A 2XP9A 4IPXA 3VAWA 2MLXA 4MTVA 1E6NA 3G6MA 1LL7A 4Z2KA 5HUAA 2JMFA 1HJXA 4DZ3A 5CQ2A 1FKDA 3UQBA 3WD4A 2ZR6A 1ZBCA 3KZ7A 4P8WA 1FKBA 1EHNA 3ARYA 5E5WA 2XP4A 1ZBWA 3KAFA 4DRIA 3TCZA 2Y78A 2YSIA 1VF8A 3FSBA 3LKXA 1LG1A 1QPFA 1R9HA 5HW7A 5AHTA 5DIVA 1HJVA 1A7XA 4TX0A 3ARXA 2XP8A 3PRDA 2M08A 1HJWA 1ROUA 4LAWA 5I98A 2YSGA 1KT0A 1E6RA 3ARTA 3ARSA 3CZ8A 4IQ2A 4WJXA 1J4IA 1W1YA 2ZR4A 2M2AA 3O5EA 1FKHA 4QT3A 3M85A 4MNLA 1H0IA 5HW8A 1LG2A 2N87A 2LAJA 1FD9A 4ODKA 4MAVA 4TNSA 1E44A 2G8ZA 4DRQA 4DRNA 4ODMA 5GPGA 3UF8A 2IF4A 1GPFA 3O5LA 3NTPA 1NWUA 2MF9A 3MQGA 1NMWA 3O5DA 3KCEA 1JNTA 4HBEA 2MLZA 2PI6A 4MGVA 2RUQA 5HBFA 1ZBKA 3WD2A 2VCDA 3BXWA 4IQCA 4W9QA 2ZAJA 4WK9A 3EIPA 4DWSD 1UR9A 1PBKA 3W4RA 1JMQA 1RP5A 4JFMA 3RM8A 2RUDA 3PR9A 2FAPA 5U47A 2DK1A 1GRJA 4ITZA 3UQIA 1YATA 4MPKA 5GPRA 4DZ2A 4AY1A 1WAWA 4A0TA 1FKRA 3KADA 4MNJA 1U79A 1JNDA 3TC5A 2KI3A 4U85A 1IX5A 1LL6A 5BXJA 1TK7A 4IT4A 3WL0A 3KACA 3ARRA 4W9PA 1W26A 1D7JA 1OWQA 1M5YA 3MCBB 2KE0A 3GTYX 4URIA 2O9OA 5GQBA 2JX8A 2XP5A 1O6IA 3B9EA 2DT3A 2L2SA 5HWCA 3OOBA 3QOKA 3O5GA 3ARPA 1LJYA 2FDMA 3ARQA 4LAXA 1EYMA 2ESCA 1E6ZA 1HKJA 4S3JA 5DIUA 2MLYA 5JH8A 1FKKA 2RUCA 4MNMA 1XHGA 4W5UA 1JNSA 1FKFA 3B9AA 2LKNA 2IUZA 3KAGA 3CGNA 1FKIA 3CNGA 2YSBA 4A0UA 3RFWA 3LE4A 4DROA 1NSGA 4ZS6A 4Z2HA 2AOSA 4KR0B 3WD1A 4NNRA 3FS8A 3UI5A 2M8JA 2YSHA 2B31A 4FN2A 1NWTA 1NH6A 3PRBA 4P8VA 2DSUA 4HBOA 3ODKA 5D75A 2QF8A 1Q6IA 3UI6A 3ARUA 3AQUA 4LGXA 1J4HA 4JFLA 2DG4A 2YBUA 1EIBA 3NRKA 3B9DA 5HW6A 1O6WA 3TDBA 2DT2A 2G41A 3JYMA 3PA7A 3ARWA 1ZB5A 2B5UB 2MDIA 3JXVA 5E62A 2KGJA 5HKGA 4ODNA 3CHEA 1OGGA 2DJYA 2XP3A 2WM0A 1EG4A 3KAHA 2DT0A 3RMEA 1ZU8A 1WMVA 4Q7NA 2WLYA 2YSFA 3WIJA 2VN1A 4UDMA 2KR7A 3MDYB 2ZQUA 1W9PA 3ARZA 1FKJA 1GOIA 1HKMA 2OFNA 4Q22A 1FKLA 2P4VA 1QZ2A 2LPVA 3CGMA 2K8IA 4GIVA 4U84A 1NWSA 3O5QA 4TYOA 1X6NA 1NMVA 4QIBA 1J6YA 1Q1CA 2F23A 2E45A 2A3EA 4J4NA 2PV2A 4L72B 3FAPA 4ODPA 2XPAA 1FKTA 4MNKA 2RURA 2JZVA 2D9FA 3AROA 3I6CA 1I5HW 5DITA 2Q5AA 1TFVA 3MCBA 1ITXA 1FFRA 3WD3A 1K9RA 2MNTA 3UQAA 4GLXA 1BL4A 1RD6A 1P5QA 4U86A 3M7NA 4DWSB 3WQVA 1FFQA 4DRPA 4DIPA 1K9QA 3WL1A 1LQ0A 1E15A 4BF8A 1ZK6A 2M8IA 3AS1A 3ALFA 4LAYA 1PINA 5E66A 1ROTA 2WAEA 4S3KA 1E6PA 1W1TA 2RSEA 1EDQA 2EULA 2AWGA 2KXQA 2DMVA 4JFKA 1W1VA 1Q6UA 3PQHA 2PPOA 4QT2A 4O2TA 3WQWA 2DSVA 3RM9A 2F4EA 4REXA 4R0XA 1D7IA 4PTMA 1K9TA 1HKKA 1CTNA 3PRAA 4KQZA 3KAIA 2UZ5A 1JVWA 2ZQTA 2OWOA 1FKSA 3O5PA 3RGCA 3FSCA 2WK2A 3ARVA 2RE3A 2M1IA 1L1PA 1JCHB 4G50A 4Z2GA 4ZPWR 3OA5A 2A3AA 3O5OA 1TR8A 2PPNA 1EG3A 3B8SA 3WH0A 2PV3A 4TW8A 3O5KA 2RQSA 1WNOA 2XPBA 4JYSA 4DRKA 2YBTA 4ML4A 4HARA 4TW6A 3BMBA 2DG3A 3L4HA 2ZR5A 2PPPA 2LJ4A 2ZQVA 1FLCA 3IHZA 4DH0A 3KABA 2F21A 2MPHA 4FAPA 2ITKA 3GU0A 2DSZA 1NWRA 1W9UA 4MSPA 4DRJA 5HT1A 4ODRA 4JFJA 3ALGA 2KFWA 1OGBA 3JYJA 1LL4A 2JXWA 5DO2A 2L4JA 1W1PA 2YAJB 3MQHA 1X6LA 2DG9A 3IKDA 4DRHA 5E64A 2OLHA 2O92A 4NSBA 4R5EA 3LKXB 5J6EA 2WLZA 4DWSC 3WKZA 2LGOA 1FJDA 4WIWA 1FAPA 2A3CA 1F40A 1TCOC 1QPLA 2ETNA 3FY1A 1GUVA 3CHDA 4DT4A 5DF0A 3GPKA 3O5IA 4DWSA 4Z2IA 1KT1A 3CHFA 4G2PA 1SR0A 2FKEA 2DT1A 5B8IC 4N19A 4QZVB 2ZQSA 1HXVA 1Q6HA 3O5FA 1F8AB 2DWVA 2XP7A 1KFWA 4WKAA 1C9HA 2DK7A 1ZL1A 5HWBA 4ZPTR 1HKIA 2M3OW 4WKHA 3CH9A 5DEZA 4XAKA 5E65A 2EZ5W 1JNEA 3IK8A 1N1AA 1D6OA 2QRVA 5HTGA 2PBCA 1WR7A 3O5JA 4P8XA 3WD0A 4DRMA 3IKGA 2Y8NB 4TW7A 1BKFA 1SYTA 3O5RA 4ODQA 3NI6A 4L3NA 1D2KA 1J4RA 1EQ3A 4W9OA 4WKFA 2WADA 3CHCA 2JV4A 1FKGA 3FXYA 4ODLA 3RM4A 1B6CA 4IT6A 3AS3A 2BA1A 2KO7A 1UR8A 3B7XA 4LAVA 3LUOA 2F2DA 3G6LA 1W9VA 3O5MA 1T11A 2DPEA 2PN0A 1Y0OA 2A3BA 3UI4A 4ZPVR 1E9LA 4P8UA 1ZCNA
chains in the Genus database with same CATH topology
3EY6A 4E5RA 1WB0A 2DSWA 2XP6A 4NZCA 3H9RB 4C02B 4J4OA 1YW5A 3AS0A 1ZBVA 1D7HA 3AS2A 4ODOA 1XRVA 1H0GA 4Z2JA 4JFIA 4GGQA 4Z2LA 2PV1A 2XP9A 4IPXA 3VAWA 2MLXA 4MTVA 1E6NA 3G6MA 1LL7A 4Z2KA 5HUAA 2JMFA 1HJXA 4DZ3A 5CQ2A 1FKDA 3UQBA 3WD4A 2ZR6A 1ZBCA 3KZ7A 4P8WA 1FKBA 1EHNA 3ARYA 5E5WA 2XP4A 1ZBWA 3KAFA 4DRIA 3TCZA 2Y78A 2YSIA 1VF8A 3FSBA 3LKXA 1LG1A 1QPFA 1R9HA 5HW7A 5AHTA 5DIVA 1HJVA 1A7XA 4TX0A 3ARXA 2XP8A 3PRDA 2M08A 1HJWA 1ROUA 4LAWA 5I98A 2YSGA 1KT0A 1E6RA 3ARTA 3ARSA 3CZ8A 4IQ2A 4WJXA 1J4IA 1W1YA 2ZR4A 2M2AA 3O5EA 1FKHA 4QT3A 3M85A 4MNLA 1H0IA 5HW8A 1LG2A 2N87A 2LAJA 1FD9A 4ODKA 4MAVA 4TNSA 2G8ZA 4DRQA 4DRNA 4ODMA 5GPGA 3UF8A 2IF4A 1GPFA 3O5LA 3NTPA 1NWUA 2MF9A 3MQGA 1NMWA 3O5DA 3KCEA 1JNTA 4HBEA 2MLZA 2PI6A 4MGVA 2RUQA 5HBFA 1ZBKA 3WD2A 2VCDA 3BXWA 4IQCA 4W9QA 2ZAJA 4WK9A 4DWSD 1UR9A 1PBKA 3W4RA 1JMQA 1RP5A 4JFMA 3RM8A 2RUDA 3PR9A 2FAPA 5U47A 2DK1A 4ITZA 3UQIA 1YATA 4MPKA 5GPRA 4DZ2A 4AY1A 1WAWA 4A0TA 1FKRA 3KADA 4MNJA 1U79A 1JNDA 3TC5A 2KI3A 4U85A 1IX5A 1LL6A 5BXJA 1TK7A 4IT4A 3WL0A 3KACA 3ARRA 4W9PA 1W26A 1D7JA 1OWQA 1M5YA 3MCBB 2KE0A 4URIA 2O9OA 5GQBA 2JX8A 2XP5A 1O6IA 3B9EA 2DT3A 2L2SA 5HWCA 3OOBA 3QOKA 3O5GA 3ARPA 1LJYA 2FDMA 3ARQA 4LAXA 1EYMA 2ESCA 1E6ZA 1HKJA 4S3JA 5DIUA 2MLYA 5JH8A 1FKKA 2RUCA 4MNMA 1XHGA 4W5UA 1JNSA 1FKFA 3B9AA 2LKNA 2IUZA 3KAGA 3CGNA 1FKIA 3CNGA 2YSBA 4A0UA 3RFWA 3LE4A 4DROA 1NSGA 4ZS6A 4Z2HA 2AOSA 4KR0B 3WD1A 4NNRA 3FS8A 3UI5A 2M8JA 2YSHA 2B31A 4FN2A 1NWTA 1NH6A 3PRBA 4P8VA 2DSUA 4HBOA 3ODKA 5D75A 2QF8A 1Q6IA 3UI6A 3ARUA 3AQUA 4LGXA 1J4HA 4JFLA 2DG4A 2YBUA 1EIBA 3NRKA 3B9DA 5HW6A 1O6WA 3TDBA 2DT2A 2G41A 3JYMA 3PA7A 3ARWA 1ZB5A 2MDIA 3JXVA 5E62A 2KGJA 5HKGA 4ODNA 3CHEA 1OGGA 2DJYA 2XP3A 2WM0A 1EG4A 3KAHA 2DT0A 3RMEA 1ZU8A 1WMVA 4Q7NA 2WLYA 2YSFA 3WIJA 2VN1A 2KR7A 3MDYB 2ZQUA 1W9PA 3ARZA 1FKJA 1GOIA 1HKMA 2OFNA 4Q22A 1FKLA 1QZ2A 2LPVA 3CGMA 2K8IA 4GIVA 4U84A 1NWSA 3O5QA 4TYOA 1X6NA 1NMVA 4QIBA 1J6YA 1Q1CA 2E45A 2A3EA 4J4NA 2PV2A 4L72B 3FAPA 4ODPA 2XPAA 1FKTA 4MNKA 2RURA 2JZVA 2D9FA 3AROA 3I6CA 1I5HW 5DITA 2Q5AA 1TFVA 3MCBA 1ITXA 1FFRA 3WD3A 1K9RA 2MNTA 3UQAA 4GLXA 1BL4A 1RD6A 1P5QA 4U86A 3M7NA 4DWSB 3WQVA 1FFQA 4DRPA 4DIPA 1K9QA 3WL1A 1LQ0A 1E15A 4BF8A 1ZK6A 2M8IA 3AS1A 3ALFA 4LAYA 1PINA 5E66A 1ROTA 2WAEA 4S3KA 1E6PA 1W1TA 2RSEA 1EDQA 2AWGA 2KXQA 2DMVA 4JFKA 1W1VA 1Q6UA 3PQHA 2PPOA 4QT2A 4O2TA 3WQWA 2DSVA 3RM9A 2F4EA 4REXA 4R0XA 1D7IA 4PTMA 1K9TA 1HKKA 1CTNA 3PRAA 4KQZA 3KAIA 2UZ5A 1JVWA 2ZQTA 2OWOA 1FKSA 3O5PA 3RGCA 3FSCA 2WK2A 3ARVA 2RE3A 2M1IA 1L1PA 4G50A 4Z2GA 4ZPWR 3OA5A 2A3AA 3O5OA 1TR8A 2PPNA 1EG3A 3B8SA 3WH0A 2PV3A 4TW8A 3O5KA 2RQSA 1WNOA 2XPBA 4JYSA 4DRKA 2YBTA 4ML4A 4HARA 4TW6A 2DG3A 3L4HA 2ZR5A 2PPPA 2LJ4A 2ZQVA 1FLCA 3IHZA 4DH0A 3KABA 2F21A 2MPHA 4FAPA 2ITKA 2DSZA 1NWRA 1W9UA 4MSPA 4DRJA 5HT1A 4ODRA 4JFJA 3ALGA 2KFWA 1OGBA 3JYJA 1LL4A 2JXWA 5DO2A 2L4JA 1W1PA 2YAJB 3MQHA 1X6LA 2DG9A 3IKDA 4DRHA 5E64A 2OLHA 2O92A 4NSBA 4R5EA 3LKXB 5J6EA 2WLZA 4DWSC 3WKZA 2LGOA 1FJDA 4WIWA 1FAPA 2A3CA 1F40A 1TCOC 1QPLA 3FY1A 1GUVA 3CHDA 4DT4A 5DF0A 3GPKA 3O5IA 4DWSA 4Z2IA 1KT1A 3CHFA 4G2PA 1SR0A 2FKEA 2DT1A 5B8IC 4N19A 4QZVB 2ZQSA 1HXVA 1Q6HA 3O5FA 1F8AB 2DWVA 2XP7A 1KFWA 4WKAA 1C9HA 2DK7A 1ZL1A 5HWBA 4ZPTR 1HKIA 2M3OW 4WKHA 3CH9A 5DEZA 4XAKA 5E65A 2EZ5W 1JNEA 3IK8A 1N1AA 1D6OA 2QRVA 5HTGA 2PBCA 1WR7A 3O5JA 4P8XA 3WD0A 4DRMA 3IKGA 2Y8NB 4TW7A 1BKFA 1SYTA 3O5RA 4ODQA 3NI6A 4L3NA 1D2KA 1J4RA 1EQ3A 4W9OA 4WKFA 2WADA 3CHCA 2JV4A 1FKGA 3FXYA 4ODLA 3RM4A 1B6CA 4IT6A 3AS3A 2BA1A 2KO7A 1UR8A 3B7XA 4LAVA 3LUOA 2F2DA 3G6LA 1W9VA 3O5MA 1T11A 2DPEA 1Y0OA 2A3BA 3UI4A 4ZPVR 1E9LA 4P8UA 1ZCNA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3EY6 A;  4E5R A;  2XP6 A;  3H9R B;  4C02 B;  4J4O A;  1YW5 A;  1D7H A;  4ODO A;  4JFI A;  4GGQ A;  2PV1 A;  2XP9 A;  4IPX A;  3VAW A;  2MLX A;  5HUA A;  2JMF A;  4DZ3 A;  5CQ2 A;  1FKD A;  3UQB A;  2ZR6 A;  3KZ7 A;  1FKB A;  2XP4 A;  3KAF A;  4DRI A;  3TCZ A;  2Y78 A;  2YSI A;  1QPF A;  1R9H A;  5HW7 A;  5AHT A;  5DIV A;  1A7X A;  4TX0 A;  2XP8 A;  3PRD A;  2M08 A;  1ROU A;  4LAW A;  5I98 A;  2YSG A;  1KT0 A;  4IQ2 A;  1J4I A;  2M2A A;  2ZR4 A;  3O5E A;  1FKH A;  4QT3 A;  3M85 A;  5HW8 A;  2N87 A;  2LAJ A;  1FD9 A;  4ODK A;  4TNS A;  4DRQ A;  4DRN A;  4ODM A;  5GPG A;  3UF8 A;  2IF4 A;  3O5L A;  3NTP A;  2MF9 A;  1NMW A;  3O5D A;  3KCE A;  1JNT A;  2MLZ A;  4MGV A;  2RUQ A;  2VCD A;  4IQC A;  4W9Q A;  2ZAJ A;  1PBK A;  1JMQ A;  4JFM A;  2RUD A;  2FAP A;  2DK1 A;  4ITZ A;  3UQI A;  1YAT A;  4DZ2 A;  1FKR A;  3KAD A;  1U79 A;  3TC5 A;  2KI3 A;  4U85 A;  5BXJ A;  1TK7 A;  3KAC A;  4W9P A;  1W26 A;  1D7J A;  1M5Y A;  2KE0 A;  2JX8 A;  2XP5 A;  2L2S A;  5HWC A;  3OOB A;  3O5G A;  4LAX A;  1EYM A;  5DIU A;  2MLY A;  1FKK A;  2RUC A;  1JNS A;  1FKF A;  2LKN A;  3KAG A;  3CGN A;  1FKI A;  3CNG A;  2YSB A;  3RFW A;  3LE4 A;  4DRO A;  1NSG A;  4NNR A;  3UI5 A;  2M8J A;  2YSH A;  4FN2 A;  3PRB A;  3ODK A;  5D75 A;  1Q6I A;  3UI6 A;  1J4H A;  4JFL A;  2DG4 A;  3NRK A;  5HW6 A;  1O6W A;  3TDB A;  3JYM A;  3PA7 A;  2MDI A;  3JXV A;  2KGJ A;  5HKG A;  4ODN A;  2DJY A;  2XP3 A;  1EG4 A;  3KAH A;  1WMV A;  2YSF A;  2VN1 A;  2KR7 A;  3MDY B;  2ZQU A;  1FKJ A;  2OFN A;  1FKL A;  1QZ2 A;  2LPV A;  3CGM A;  2K8I A;  4GIV A;  4U84 A;  3O5Q A;  4TYO A;  1NMV A;  4QIB A;  1J6Y A;  1Q1C A;  2E45 A;  4J4N A;  2PV2 A;  3FAP A;  4ODP A;  2XPA A;  1FKT A;  2RUR A;  2JZV A;  2D9F A;  3I6C A;  1I5H W;  5DIT A;  2Q5A A;  1K9R A;  2MNT A;  3UQA A;  1BL4 A;  1P5Q A;  4U86 A;  3M7N A;  4DRP A;  4DIP A;  1K9Q A;  4BF8 A;  1ZK6 A;  2M8I A;  4LAY A;  1PIN A;  1ROT A;  2RSE A;  2AWG A;  2KXQ A;  2DMV A;  4JFK A;  2PPO A;  1Q6U A;  4QT2 A;  4O2T A;  2F4E A;  4REX A;  4R0X A;  1D7I A;  3KAI A;  2UZ5 A;  1JVW A;  2ZQT A;  1FKS A;  3O5P A;  3RGC A;  2RE3 A;  2M1I A;  1L1P A;  4G50 A;  3O5O A;  2PPN A;  1EG3 A;  3WH0 A;  2PV3 A;  4TW8 A;  3O5K A;  2RQS A;  2XPB A;  4JYS A;  4DRK A;  4TW6 A;  2DG3 A;  3L4H A;  2ZR5 A;  2PPP A;  2LJ4 A;  2ZQV A;  3IHZ A;  4DH0 A;  3KAB A;  2F21 A;  2MPH A;  4FAP A;  2ITK A;  4MSP A;  4DRJ A;  5HT1 A;  4ODR A;  4JFJ A;  2KFW A;  3JYJ A;  2JXW A;  2L4J A;  2DG9 A;  3IKD A;  4DRH A;  5J6E A;  2LGO A;  1FJD A;  1FAP A;  1F40 A;  1TCO C;  1QPL A;  4DT4 A;  3GPK A;  3O5I A;  1KT1 A;  4G2P A;  2FKE A;  5B8I C;  4N19 A;  2ZQS A;  1HXV A;  1Q6H A;  3O5F A;  1F8A B;  2DWV A;  2XP7 A;  1C9H A;  2DK7 A;  5HWB A;  2M3O W;  2EZ5 W;  3IK8 A;  1N1A A;  1D6O A;  5HTG A;  2PBC A;  1WR7 A;  3O5J A;  4DRM A;  3IKG A;  4TW7 A;  1BKF A;  3O5R A;  4ODQ A;  3NI6 A;  1EQ3 A;  1J4R A;  4W9O A;  2JV4 A;  1FKG A;  4ODL A;  1B6C A;  2BA1 A;  2KO7 A;  3B7X A;  4LAV A;  3LUO A;  2F2D A;  3O5M A;  1T11 A;  1Y0O A;  3UI4 A;  1ZCN A; 
#chains in the Genus database with same CATH topology
 3EY6 A;  4E5R A;  1WB0 A;  2DSW A;  2XP6 A;  4NZC A;  3H9R B;  4C02 B;  4J4O A;  1YW5 A;  3AS0 A;  1ZBV A;  1D7H A;  3AS2 A;  4ODO A;  1XRV A;  1H0G A;  4Z2J A;  4JFI A;  4GGQ A;  4Z2L A;  2PV1 A;  2XP9 A;  4IPX A;  3VAW A;  2MLX A;  4MTV A;  1E6N A;  3G6M A;  1LL7 A;  4Z2K A;  5HUA A;  2JMF A;  1HJX A;  4DZ3 A;  5CQ2 A;  1FKD A;  3UQB A;  3WD4 A;  2ZR6 A;  1ZBC A;  3KZ7 A;  4P8W A;  1FKB A;  1EHN A;  3ARY A;  5E5W A;  2XP4 A;  1ZBW A;  3KAF A;  4DRI A;  3TCZ A;  2Y78 A;  2YSI A;  1VF8 A;  3FSB A;  3LKX A;  1LG1 A;  1QPF A;  1R9H A;  5HW7 A;  5AHT A;  5DIV A;  1HJV A;  1A7X A;  4TX0 A;  3ARX A;  2XP8 A;  3PRD A;  2M08 A;  1HJW A;  1ROU A;  4LAW A;  5I98 A;  2YSG A;  1KT0 A;  1E6R A;  3ART A;  3ARS A;  3CZ8 A;  4IQ2 A;  4WJX A;  1J4I A;  1W1Y A;  2ZR4 A;  2M2A A;  3O5E A;  1FKH A;  4QT3 A;  3M85 A;  4MNL A;  1H0I A;  5HW8 A;  1LG2 A;  2N87 A;  2LAJ A;  1FD9 A;  4ODK A;  4MAV A;  4TNS A;  1E44 A;  2G8Z A;  4DRQ A;  4DRN A;  4ODM A;  5GPG A;  3UF8 A;  2IF4 A;  1GPF A;  3O5L A;  3NTP A;  1NWU A;  2MF9 A;  3MQG A;  1NMW A;  3O5D A;  3KCE A;  1JNT A;  4HBE A;  2MLZ A;  2PI6 A;  4MGV A;  2RUQ A;  5HBF A;  1ZBK A;  3WD2 A;  2VCD A;  3BXW A;  4IQC A;  4W9Q A;  2ZAJ A;  4WK9 A;  3EIP A;  4DWS D;  1UR9 A;  1PBK A;  3W4R A;  1JMQ A;  1RP5 A;  4JFM A;  3RM8 A;  2RUD A;  3PR9 A;  2FAP A;  5U47 A;  2DK1 A;  1GRJ A;  4ITZ A;  3UQI A;  1YAT A;  4MPK A;  5GPR A;  4DZ2 A;  4AY1 A;  1WAW A;  4A0T A;  1FKR A;  3KAD A;  4MNJ A;  1U79 A;  1JND A;  3TC5 A;  2KI3 A;  4U85 A;  1IX5 A;  1LL6 A;  5BXJ A;  1TK7 A;  4IT4 A;  3WL0 A;  3KAC A;  3ARR A;  4W9P A;  1W26 A;  1D7J A;  1OWQ A;  1M5Y A;  3MCB B;  2KE0 A;  3GTY X;  4URI A;  2O9O A;  5GQB A;  2JX8 A;  2XP5 A;  1O6I A;  3B9E A;  2DT3 A;  2L2S A;  5HWC A;  3OOB A;  3QOK A;  3O5G A;  3ARP A;  1LJY A;  2FDM A;  3ARQ A;  4LAX A;  1EYM A;  2ESC A;  1E6Z A;  1HKJ A;  4S3J A;  5DIU A;  2MLY A;  5JH8 A;  1FKK A;  2RUC A;  4MNM A;  1XHG A;  4W5U A;  1JNS A;  1FKF A;  3B9A A;  2LKN A;  2IUZ A;  3KAG A;  3CGN A;  1FKI A;  3CNG A;  2YSB A;  4A0U A;  3RFW A;  3LE4 A;  4DRO A;  1NSG A;  4ZS6 A;  4Z2H A;  2AOS A;  4KR0 B;  3WD1 A;  4NNR A;  3FS8 A;  3UI5 A;  2M8J A;  2YSH A;  2B31 A;  4FN2 A;  1NWT A;  1NH6 A;  3PRB A;  4P8V A;  2DSU A;  4HBO A;  3ODK A;  5D75 A;  2QF8 A;  1Q6I A;  3UI6 A;  3ARU A;  3AQU A;  4LGX A;  1J4H A;  4JFL A;  2DG4 A;  2YBU A;  1EIB A;  3NRK A;  3B9D A;  5HW6 A;  1O6W A;  3TDB A;  2DT2 A;  2G41 A;  3JYM A;  3PA7 A;  3ARW A;  1ZB5 A;  2B5U B;  2MDI A;  3JXV A;  5E62 A;  2KGJ A;  5HKG A;  4ODN A;  3CHE A;  1OGG A;  2DJY A;  2XP3 A;  2WM0 A;  1EG4 A;  3KAH A;  2DT0 A;  3RME A;  1ZU8 A;  1WMV A;  4Q7N A;  2WLY A;  2YSF A;  3WIJ A;  2VN1 A;  4UDM A;  2KR7 A;  3MDY B;  2ZQU A;  1W9P A;  3ARZ A;  1FKJ A;  1GOI A;  1HKM A;  2OFN A;  4Q22 A;  1FKL A;  2P4V A;  1QZ2 A;  2LPV A;  3CGM A;  2K8I A;  4GIV A;  4U84 A;  1NWS A;  3O5Q A;  4TYO A;  1X6N A;  1NMV A;  4QIB A;  1J6Y A;  1Q1C A;  2F23 A;  2E45 A;  2A3E A;  4J4N A;  2PV2 A;  4L72 B;  3FAP A;  4ODP A;  2XPA A;  1FKT A;  4MNK A;  2RUR A;  2JZV A;  2D9F A;  3ARO A;  3I6C A;  1I5H W;  5DIT A;  2Q5A A;  1TFV A;  3MCB A;  1ITX A;  1FFR A;  3WD3 A;  1K9R A;  2MNT A;  3UQA A;  4GLX A;  1BL4 A;  1RD6 A;  1P5Q A;  4U86 A;  3M7N A;  4DWS B;  3WQV A;  1FFQ A;  4DRP A;  4DIP A;  1K9Q A;  3WL1 A;  1LQ0 A;  1E15 A;  4BF8 A;  1ZK6 A;  2M8I A;  3AS1 A;  3ALF A;  4LAY A;  1PIN A;  5E66 A;  1ROT A;  2WAE A;  4S3K A;  1E6P A;  1W1T A;  2RSE A;  1EDQ A;  2EUL A;  2AWG A;  2KXQ A;  2DMV A;  4JFK A;  1W1V A;  1Q6U A;  3PQH A;  2PPO A;  4QT2 A;  4O2T A;  3WQW A;  2DSV A;  3RM9 A;  2F4E A;  4REX A;  4R0X A;  1D7I A;  4PTM A;  1K9T A;  1HKK A;  1CTN A;  3PRA A;  4KQZ A;  3KAI A;  2UZ5 A;  1JVW A;  2ZQT A;  2OWO A;  1FKS A;  3O5P A;  3RGC A;  3FSC A;  2WK2 A;  3ARV A;  2RE3 A;  2M1I A;  1L1P A;  1JCH B;  4G50 A;  4Z2G A;  4ZPW R;  3OA5 A;  2A3A A;  3O5O A;  1TR8 A;  2PPN A;  1EG3 A;  3B8S A;  3WH0 A;  2PV3 A;  4TW8 A;  3O5K A;  2RQS A;  1WNO A;  2XPB A;  4JYS A;  4DRK A;  2YBT A;  4ML4 A;  4HAR A;  4TW6 A;  3BMB A;  2DG3 A;  3L4H A;  2ZR5 A;  2PPP A;  2LJ4 A;  2ZQV A;  1FLC A;  3IHZ A;  4DH0 A;  3KAB A;  2F21 A;  2MPH A;  4FAP A;  2ITK A;  3GU0 A;  2DSZ A;  1NWR A;  1W9U A;  4MSP A;  4DRJ A;  5HT1 A;  4ODR A;  4JFJ A;  3ALG A;  2KFW A;  1OGB A;  3JYJ A;  1LL4 A;  2JXW A;  5DO2 A;  2L4J A;  1W1P A;  2YAJ B;  3MQH A;  1X6L A;  2DG9 A;  3IKD A;  4DRH A;  5E64 A;  2OLH A;  2O92 A;  4NSB A;  4R5E A;  3LKX B;  5J6E A;  2WLZ A;  4DWS C;  3WKZ A;  2LGO A;  1FJD A;  4WIW A;  1FAP A;  2A3C A;  1F40 A;  1TCO C;  1QPL A;  2ETN A;  3FY1 A;  1GUV A;  3CHD A;  4DT4 A;  5DF0 A;  3GPK A;  3O5I A;  4DWS A;  4Z2I A;  1KT1 A;  3CHF A;  4G2P A;  1SR0 A;  2FKE A;  2DT1 A;  5B8I C;  4N19 A;  4QZV B;  2ZQS A;  1HXV A;  1Q6H A;  3O5F A;  1F8A B;  2DWV A;  2XP7 A;  1KFW A;  4WKA A;  1C9H A;  2DK7 A;  1ZL1 A;  5HWB A;  4ZPT R;  1HKI A;  2M3O W;  4WKH A;  3CH9 A;  5DEZ A;  4XAK A;  5E65 A;  2EZ5 W;  1JNE A;  3IK8 A;  1N1A A;  1D6O A;  2QRV A;  5HTG A;  2PBC A;  1WR7 A;  3O5J A;  4P8X A;  3WD0 A;  4DRM A;  3IKG A;  2Y8N B;  4TW7 A;  1BKF A;  1SYT A;  3O5R A;  4ODQ A;  3NI6 A;  4L3N A;  1D2K A;  1J4R A;  1EQ3 A;  4W9O A;  4WKF A;  2WAD A;  3CHC A;  2JV4 A;  1FKG A;  3FXY A;  4ODL A;  3RM4 A;  1B6C A;  4IT6 A;  3AS3 A;  2BA1 A;  2KO7 A;  1UR8 A;  3B7X A;  4LAV A;  3LUO A;  2F2D A;  3G6L A;  1W9V A;  3O5M A;  1T11 A;  2DPE A;  2PN0 A;  1Y0O A;  2A3B A;  3UI4 A;  4ZPV R;  1E9L A;  4P8U A;  1ZCN A; 
#chains in the Genus database with same CATH homology
 3EY6 A;  4E5R A;  1WB0 A;  2DSW A;  2XP6 A;  4NZC A;  3H9R B;  4C02 B;  4J4O A;  1YW5 A;  3AS0 A;  1ZBV A;  1D7H A;  3AS2 A;  4ODO A;  1XRV A;  1H0G A;  4Z2J A;  4JFI A;  4GGQ A;  4Z2L A;  2PV1 A;  2XP9 A;  4IPX A;  3VAW A;  2MLX A;  4MTV A;  1E6N A;  3G6M A;  1LL7 A;  4Z2K A;  5HUA A;  2JMF A;  1HJX A;  4DZ3 A;  5CQ2 A;  1FKD A;  3UQB A;  3WD4 A;  2ZR6 A;  1ZBC A;  3KZ7 A;  4P8W A;  1FKB A;  1EHN A;  3ARY A;  5E5W A;  2XP4 A;  1ZBW A;  3KAF A;  4DRI A;  3TCZ A;  2Y78 A;  2YSI A;  1VF8 A;  3FSB A;  3LKX A;  1LG1 A;  1QPF A;  1R9H A;  5HW7 A;  5AHT A;  5DIV A;  1HJV A;  1A7X A;  4TX0 A;  3ARX A;  2XP8 A;  3PRD A;  2M08 A;  1HJW A;  1ROU A;  4LAW A;  5I98 A;  2YSG A;  1KT0 A;  1E6R A;  3ART A;  3ARS A;  3CZ8 A;  4IQ2 A;  4WJX A;  1J4I A;  1W1Y A;  2ZR4 A;  2M2A A;  3O5E A;  1FKH A;  4QT3 A;  3M85 A;  4MNL A;  1H0I A;  5HW8 A;  1LG2 A;  2N87 A;  2LAJ A;  1FD9 A;  4ODK A;  4MAV A;  4TNS A;  2G8Z A;  4DRQ A;  4DRN A;  4ODM A;  5GPG A;  3UF8 A;  2IF4 A;  1GPF A;  3O5L A;  3NTP A;  1NWU A;  2MF9 A;  3MQG A;  1NMW A;  3O5D A;  3KCE A;  1JNT A;  4HBE A;  2MLZ A;  2PI6 A;  4MGV A;  2RUQ A;  5HBF A;  1ZBK A;  3WD2 A;  2VCD A;  3BXW A;  4IQC A;  4W9Q A;  2ZAJ A;  4WK9 A;  4DWS D;  1UR9 A;  1PBK A;  3W4R A;  1JMQ A;  1RP5 A;  4JFM A;  3RM8 A;  2RUD A;  3PR9 A;  2FAP A;  5U47 A;  2DK1 A;  4ITZ A;  3UQI A;  1YAT A;  4MPK A;  5GPR A;  4DZ2 A;  4AY1 A;  1WAW A;  4A0T A;  1FKR A;  3KAD A;  4MNJ A;  1U79 A;  1JND A;  3TC5 A;  2KI3 A;  4U85 A;  1IX5 A;  1LL6 A;  5BXJ A;  1TK7 A;  4IT4 A;  3WL0 A;  3KAC A;  3ARR A;  4W9P A;  1W26 A;  1D7J A;  1OWQ A;  1M5Y A;  3MCB B;  2KE0 A;  4URI A;  2O9O A;  5GQB A;  2JX8 A;  2XP5 A;  1O6I A;  3B9E A;  2DT3 A;  2L2S A;  5HWC A;  3OOB A;  3QOK A;  3O5G A;  3ARP A;  1LJY A;  2FDM A;  3ARQ A;  4LAX A;  1EYM A;  2ESC A;  1E6Z A;  1HKJ A;  4S3J A;  5DIU A;  2MLY A;  5JH8 A;  1FKK A;  2RUC A;  4MNM A;  1XHG A;  4W5U A;  1JNS A;  1FKF A;  3B9A A;  2LKN A;  2IUZ A;  3KAG A;  3CGN A;  1FKI A;  3CNG A;  2YSB A;  4A0U A;  3RFW A;  3LE4 A;  4DRO A;  1NSG A;  4ZS6 A;  4Z2H A;  2AOS A;  4KR0 B;  3WD1 A;  4NNR A;  3FS8 A;  3UI5 A;  2M8J A;  2YSH A;  2B31 A;  4FN2 A;  1NWT A;  1NH6 A;  3PRB A;  4P8V A;  2DSU A;  4HBO A;  3ODK A;  5D75 A;  2QF8 A;  1Q6I A;  3UI6 A;  3ARU A;  3AQU A;  4LGX A;  1J4H A;  4JFL A;  2DG4 A;  2YBU A;  1EIB A;  3NRK A;  3B9D A;  5HW6 A;  1O6W A;  3TDB A;  2DT2 A;  2G41 A;  3JYM A;  3PA7 A;  3ARW A;  1ZB5 A;  2MDI A;  3JXV A;  5E62 A;  2KGJ A;  5HKG A;  4ODN A;  3CHE A;  1OGG A;  2DJY A;  2XP3 A;  2WM0 A;  1EG4 A;  3KAH A;  2DT0 A;  3RME A;  1ZU8 A;  1WMV A;  4Q7N A;  2WLY A;  2YSF A;  3WIJ A;  2VN1 A;  2KR7 A;  3MDY B;  2ZQU A;  1W9P A;  3ARZ A;  1FKJ A;  1GOI A;  1HKM A;  2OFN A;  4Q22 A;  1FKL A;  1QZ2 A;  2LPV A;  3CGM A;  2K8I A;  4GIV A;  4U84 A;  1NWS A;  3O5Q A;  4TYO A;  1X6N A;  1NMV A;  4QIB A;  1J6Y A;  1Q1C A;  2E45 A;  2A3E A;  4J4N A;  2PV2 A;  4L72 B;  3FAP A;  4ODP A;  2XPA A;  1FKT A;  4MNK A;  2RUR A;  2JZV A;  2D9F A;  3ARO A;  3I6C A;  1I5H W;  5DIT A;  2Q5A A;  1TFV A;  3MCB A;  1ITX A;  1FFR A;  3WD3 A;  1K9R A;  2MNT A;  3UQA A;  4GLX A;  1BL4 A;  1RD6 A;  1P5Q A;  4U86 A;  3M7N A;  4DWS B;  3WQV A;  1FFQ A;  4DRP A;  4DIP A;  1K9Q A;  3WL1 A;  1LQ0 A;  1E15 A;  4BF8 A;  1ZK6 A;  2M8I A;  3AS1 A;  3ALF A;  4LAY A;  1PIN A;  5E66 A;  1ROT A;  2WAE A;  4S3K A;  1E6P A;  1W1T A;  2RSE A;  1EDQ A;  2AWG A;  2KXQ A;  2DMV A;  4JFK A;  1W1V A;  1Q6U A;  3PQH A;  2PPO A;  4QT2 A;  4O2T A;  3WQW A;  2DSV A;  3RM9 A;  2F4E A;  4REX A;  4R0X A;  1D7I A;  4PTM A;  1K9T A;  1HKK A;  1CTN A;  3PRA A;  4KQZ A;  3KAI A;  2UZ5 A;  1JVW A;  2ZQT A;  2OWO A;  1FKS A;  3O5P A;  3RGC A;  3FSC A;  2WK2 A;  3ARV A;  2RE3 A;  2M1I A;  1L1P A;  4G50 A;  4Z2G A;  4ZPW R;  3OA5 A;  2A3A A;  3O5O A;  1TR8 A;  2PPN A;  1EG3 A;  3B8S A;  3WH0 A;  2PV3 A;  4TW8 A;  3O5K A;  2RQS A;  1WNO A;  2XPB A;  4JYS A;  4DRK A;  2YBT A;  4ML4 A;  4HAR A;  4TW6 A;  2DG3 A;  3L4H A;  2ZR5 A;  2PPP A;  2LJ4 A;  2ZQV A;  1FLC A;  3IHZ A;  4DH0 A;  3KAB A;  2F21 A;  2MPH A;  4FAP A;  2ITK A;  2DSZ A;  1NWR A;  1W9U A;  4MSP A;  4DRJ A;  5HT1 A;  4ODR A;  4JFJ A;  3ALG A;  2KFW A;  1OGB A;  3JYJ A;  1LL4 A;  2JXW A;  5DO2 A;  2L4J A;  1W1P A;  2YAJ B;  3MQH A;  1X6L A;  2DG9 A;  3IKD A;  4DRH A;  5E64 A;  2OLH A;  2O92 A;  4NSB A;  4R5E A;  3LKX B;  5J6E A;  2WLZ A;  4DWS C;  3WKZ A;  2LGO A;  1FJD A;  4WIW A;  1FAP A;  2A3C A;  1F40 A;  1TCO C;  1QPL A;  3FY1 A;  1GUV A;  3CHD A;  4DT4 A;  5DF0 A;  3GPK A;  3O5I A;  4DWS A;  4Z2I A;  1KT1 A;  3CHF A;  4G2P A;  1SR0 A;  2FKE A;  2DT1 A;  5B8I C;  4N19 A;  4QZV B;  2ZQS A;  1HXV A;  1Q6H A;  3O5F A;  1F8A B;  2DWV A;  2XP7 A;  1KFW A;  4WKA A;  1C9H A;  2DK7 A;  1ZL1 A;  5HWB A;  4ZPT R;  1HKI A;  2M3O W;  4WKH A;  3CH9 A;  5DEZ A;  4XAK A;  5E65 A;  2EZ5 W;  1JNE A;  3IK8 A;  1N1A A;  1D6O A;  2QRV A;  5HTG A;  2PBC A;  1WR7 A;  3O5J A;  4P8X A;  3WD0 A;  4DRM A;  3IKG A;  2Y8N B;  4TW7 A;  1BKF A;  1SYT A;  3O5R A;  4ODQ A;  3NI6 A;  4L3N A;  1D2K A;  1J4R A;  1EQ3 A;  4W9O A;  4WKF A;  2WAD A;  3CHC A;  2JV4 A;  1FKG A;  3FXY A;  4ODL A;  3RM4 A;  1B6C A;  4IT6 A;  3AS3 A;  2BA1 A;  2KO7 A;  1UR8 A;  3B7X A;  4LAV A;  3LUO A;  2F2D A;  3G6L A;  1W9V A;  3O5M A;  1T11 A;  2DPE A;  1Y0O A;  2A3B A;  3UI4 A;  4ZPV R;  1E9L A;  4P8U A;  1ZCN A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...