2ZR6A

Crystal structure of a mutant pin1 peptidyl-prolyl cis-trans isomerase
Total Genus 39
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
39
sequence length
158
structure length
153
Chain Sequence
KLPPGWEKAMSRSSGRVYYFNHITNASQWERPSGGKNGQGEPARVRCSHLLVKHSQSRRPSSWRQEKITRTKEEALELINGYIQKIKSGEEDFESLASQFSDCSSAKARGDLGAFSRGQMQKPFEDASFALRTGEMSGPVFTDSGIHIILRTE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural studies on PIN1 mutants
rcsb
source organism Homo sapiens
molecule tags Isomerase
molecule keywords Peptidyl-prolyl cis-trans isomerase NIMA-interacting 1
total genus 39
structure length 153
sequence length 158
ec nomenclature ec 5.2.1.8: Peptidylprolyl isomerase.
pdb deposition date 2008-08-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00397 WW WW domain
A PF00639 Rotamase PPIC-type PPIASE domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.20.70.10 Mainly Beta Single Sheet Ubiquitin Ligase Nedd4; Chain: W; Ubiquitin Ligase Nedd4; Chain: W; 2zr6A01
3.10.50.40 Alpha Beta Roll Chitinase A; domain 3 Chitinase A; domain 3 2zr6A02
1Y0OA 2DJYA 4NNRA 2M1IA 2PV1A 3KAHA 1D7HA 3O5EA 1WMVA 3PA7A 4DT4A 1FKSA 2XP4A 1BKFA 3O5LA 4TX0A 1FKDA 3O5OA 1T11A 5D75A 2JXWA 3UI5A 4O2TA 3IHZA 3H9RB 2DK7A 5I98A 3CGNA 2XP5A 3JYMA 5B8IC 4IQ2A 1ROTA 3TCZA 2M08A 3PRDA 1PINA 2FKEA 2PBCA 3NRKA 4ODOA 1FJDA 3UI6A 2F2DA 4ODMA 2KFWA 2MPHA 4LAYA 2ZQSA 2ZQUA 2MLYA 1A7XA 2PPOA 3B7XA 1QPLA 3IKDA 1PBKA 1JMQA 1QPFA 4LAWA 3EY6A 4GIVA 2JX8A 4ODNA 1D7JA 2PV3A 3LUOA 1QZ2A 3UQIA 1NMWA 4DH0A 2KR7A 2MLXA 4W9PA 4DRNA 1FKGA 3KABA 3KACA 1EQ3A 2N87A 4ODPA 4ITZA 3PRBA 3UQAA 5HUAA 2FAPA 2Q5AA 2ZR5A 1EYMA 4IPXA 2LAJA 2RQSA 1K9RA 1BL4A 4DZ2A 3WH0A 1YATA 3IKGA 4ODQA 1FKIA 2M8JA 3O5IA 4DZ3A 1FKRA 1JNSA 5GPGA 1J4IA 3O5PA 4TNSA 5HT1A 4ODKA 3CNGA 1FKJA 4MGVA 4W9QA 4DRIA 2XP9A 2XPAA 2D9FA 2ZQVA 4DRMA 3KADA 2LJ4A 3CGMA 5HWCA 3KAGA 1J4HA 2LGOA 4JFJA 2MDIA 5HW8A 1YW5A 3FAPA 1FKTA 3ODKA 1KT1A 4R0XA 1FD9A 2RUCA 3O5QA 2UZ5A 5DITA 4DROA 2YSIA 1JNTA 2KE0A 3O5FA 4JFMA 1NMVA 1FKKA 2Y78A 5HW7A 2E45A 3M85A 3O5GA 1ZCNA 4LAXA 4C02B 4ODLA 4DRPA 3UF8A 1ROUA 4J4NA 3O5MA 4DRQA 2RURA 3LE4A 2XPBA 2KI3A 4QT3A 4DIPA 2DG9A 2IF4A 1TCOC 1R9HA 2YSGA 2VN1A 1N1AA 2DG3A 1Q1CA 3RFWA 4G2PA 2M2AA 2KO7A 4E5RA 2ZAJA 3RGCA 4J4OA 4N19A 3KCEA 4TYOA 5HWBA 2M8IA 3O5KA 2PPPA 2JZVA 2DWVA 2PV2A 5J6EA 1NSGA 2VCDA 4FAPA 4G50A 4U84A 3OOBA 3GPKA 2KGJA 2M3OW 1FKBA 2XP6A 1M5YA 3O5RA 4ODRA 1U79A 3L4HA 1KT0A 2XP3A 2L2SA 2LKNA 4W9OA 4JFIA 5HKGA 1EG3A 2F4EA 1F40A 1I5HW 1F8AB 1C9HA 2XP7A 3IK8A 1FKLA 1FKFA 1ZK6A 3UQBA 2MNTA 4REXA 4JYSA 4TW7A 2YSFA 4JFLA 1O6WA 1W26A 4QT2A 1K9QA 1P5QA 4DRJA 1J4RA 1J6YA 5AHTA 4DRHA 2JV4A 1HXVA 2AWGA 2ZR6A 3KAIA 1EG4A 2YSBA 3NTPA 5HTGA 1L1PA 2L4JA 5DIVA 2MF9A 3O5JA 4U85A 2DMVA 1FAPA 3KZ7A 3KAFA 3O5DA 4FN2A 3MDYB 3TC5A 5BXJA 2ZR4A 1D6OA 2OFNA 1TK7A 1JVWA 2DG4A 2BA1A 2RUQA 2DK1A 2MLZA 2KXQA 4GGQA 4BF8A 3TDBA 4JFKA 1B6CA 4TW8A 5CQ2A 4U86A 4QIBA 2RSEA 2YSHA 4TW6A 2ITKA 2LPVA 2JMFA 2XP8A 5DIUA 3VAWA 2RUDA 3JYJA 2F21A 1D7IA 4LAVA 2ZQTA 1FKHA 1Q6UA 2EZ5W 3I6CA 3JXVA 4IQCA 3UI4A 5HW6A 3NI6A 2RE3A 2PPNA 3M7NA 4MSPA 2K8IA 4DRKA 1Q6HA 1Q6IA 1WR7A
chains in the Genus database with same CATH superfamily
2M1IA 2PV1A 3KAHA 2XP4A 1GOIA 3UI5A 3LKXB 3WD1A 3JYMA 5B8IC 2Y8NB 4IQ2A 3TCZA 3NRKA 1FJDA 3UI6A 1E9LA 2PPOA 1JMQA 1NWUA 2ETNA 5E5WA 1ZBVA 2JX8A 1D7JA 3UQIA 2KR7A 5E64A 3KABA 1FKGA 2DSZA 3KACA 4ODPA 4ITZA 3WL0A 4URIA 2AOSA 1SR0A 1X6NA 5DF0A 2RQSA 1ZL1A 1BL4A 2WAEA 4DZ2A 2YBUA 3IKGA 1CTNA 2QRVA 4DZ3A 1HJVA 5GPGA 1E6ZA 1J4IA 5HT1A 1W1TA 1K9TA 2DSUA 2IUZA 5GPRA 3KAGA 1NWSA 4JFJA 1FFRA 4R0XA 1FKTA 3ODKA 1KT1A 3O5QA 2YSIA 3O5FA 3QOKA 1LG1A 1FKKA 4LAXA 3O5GA 3UF8A 1ROUA 4QT3A 4DIPA 3PRAA 1R9HA 2YSGA 1E6PA 3CHFA 4G2PA 1EDQA 2M2AA 4WKAA 4E5RA 2ZAJA 2YBTA 4WJXA 3RGCA 3KCEA 4ZPTR 4Z2GA 2DWVA 1E44A 4U84A 4AY1A 3FS8A 2M3OW 3B9AA 4W9OA 4ODRA 1LL6A 2XP3A 1F40A 4MAVA 4JFIA 5HBFA 3FSBA 1ZK6A 3ARWA 4JFLA 4QT2A 2A3AA 4DRJA 5AHTA 4KR0B 4Z2HA 1EIBA 2MF9A 3RM8A 4U85A 1KFWA 4HBOA 3O5DA 2G8ZA 3MCBA 2DG4A 2OFNA 4GGQA 2RUQA 4TYOA 2DK1A 1JCHB 1B6CA 1GRJA 4QIBA 3WKZA 2ITKA 3ARVA 1NWTA 4Q22A 1FKHA 1OGBA 2WM0A 3B9DA 4HARA 1Q6HA 1HJWA 2DJYA 2WK2A 4DT4A 3PA7A 1WMVA 1BKFA 1FKDA 3O5OA 1T11A 3H9RB 3CGNA 1H0GA 2FKEA 3PQHA 4ODMA 2KFWA 4LAYA 2ZQSA 2ZQUA 1GPFA 2B5UB 3EY6A 4GIVA 4ML4A 4ODNA 2PV3A 3OA5A 4DRNA 1EQ3A 1XHGA 3PRBA 1E6NA 2Q5AA 2LAJA 1K9RA 4ODQA 1FKIA 2M8JA 3WD0A 1FKRA 3O5PA 4TNSA 1UR8A 1FKJA 4DRMA 4MGVA 2ZQVA 5E62A 2LJ4A 1ZU8A 1ZBKA 1J4HA 4WK9A 1YW5A 3B9EA 2RUCA 1HKKA 2E45A 3M85A 4GLXA 4KQZA 3G6LA 4J4NA 2OLHA 3LE4A 2KI3A 1OWQA 2FDMA 2DG9A 2VN1A 1TCOC 2DG3A 1Q1CA 1W1PA 3ARZA 4J4OA 1FFQA 5HWBA 2M8IA 2PPPA 2PV2A 4Z2IA 2XP6A 4QZVB 1I5HW 3IK8A 1LQ0A 5JH8A 1FKLA 1W26A 1K9QA 1P5QA 1J4RA 2JV4A 5U47A 2ZR6A 3WIJA 1EG4A 3WQVA 5DIVA 3CH9A 4FN2A 3KAFA 3RM4A 1LL4A 3MDYB 2ZR4A 2QF8A 2P4VA 1ZBWA 4S3JA 3TDBA 3ALFA 4JFKA 4TW8A 5CQ2A 4L72B 4U86A 2RSEA 1X6LA 4TW6A 2LPVA 2JMFA 2XP8A 3FSCA 3AROA 5DIUA 3ARYA 4R5EA 3CHDA 4NZCA 3UI4A 5HW6A 4A0UA 2DT2A 4C02B 3WQWA 3O5JA 4DWSD 1D7HA 3ALGA 4TX0A 3O5LA 2JXWA 1LJYA 4ZPVR 3IHZA 2O9OA 2DT0A 3PR9A 1WB0A 1ROTA 1ZBCA 4ODOA 2YAJB 2F2DA 1VF8A 2MPHA 3AS2A 1FLCA 3B7XA 2DSVA 3AS0A 3CZ8A 4LAWA 4PTMA 2DT3A 3ARXA 1NMWA 4MTVA 4DWSA 4W9PA 3FXYA 2ZR5A 4IPXA 4UDMA 4XAKA 3ARRA 3WH0A 3O5IA 4DWSB 1JNSA 3AQUA 4ODKA 3CNGA 2XP9A 2XPAA 5HWCA 1HJXA 2LGOA 3GTYX 5DITA 4DROA 3LKXA 1JNTA 3ARSA 4JFMA 5HW7A 2Y78A 2OWOA 4DRQA 3MQHA 3O5MA 2RURA 2A3BA 1N1AA 2B31A 1NWRA 3WD4A 4N19A 1LG2A 2JZVA 4P8VA 5DO2A 5J6EA 1NSGA 2VCDA 4FAPA 3OOBA 4MNMA 4Z2LA 1M5YA 3RFWA 1U79A 2L2SA 5HKGA 4Z2JA 4LGXA 1EG3A 2F4EA 2O92A 3WD2A 1F8AB 1C9HA 3FY1A 1FKFA 3UQBA 2MNTA 4JYSA 4TW7A 2YSFA 3BMBA 1O6WA 2PN0A 2AWGA 3BXWA 2WLYA 1TFVA 4L3NA 4ZS6A 4W5UA 2DMVA 4DWSC 3KZ7A 1ITXA 3TC5A 1RD6A 5BXJA 1D6OA 4DRPA 2BA1A 1D2KA 1W1YA 3MQGA 1O6IA 2YSHA 1NH6A 1WAWA 3ARPA 4MNJA 2F21A 4LAVA 2ZQTA 1LL7A 1WNOA 1Q6UA 3I6CA 3JXVA 5DEZA 1HKMA 4ZPWR 3GU0A 2RE3A 3M7NA 4MSPA 2K8IA 4P8WA 4DRKA 1Q6IA 2WADA 1WR7A 1Y0OA 4NNRA 3AS1A 1SYTA 3B8SA 3O5EA 1FKSA 2F23A 5D75A 4O2TA 2DK7A 5I98A 2XP5A 3EIPA 3G6MA 2M08A 3PRDA 1PINA 2PBCA 1W9PA 2WLZA 5E66A 1ZB5A 2MLYA 5GQBA 1A7XA 4IT4A 1QPLA 3IKDA 1PBKA 1QPFA 1HKIA 4P8UA 3LUOA 4DH0A 1QZ2A 3WL1A 2MLXA 1RP5A 3W4RA 3UQAA 5HUAA 2FAPA 3ARUA 1EYMA 1YATA 3ARTA 4DRIA 4W9QA 2D9FA 3KADA 3CGMA 2ESCA 1JNDA 4MNLA 1OGGA 2MDIA 4WKFA 5HW8A 4MNKA 3FAPA 1FD9A 2UZ5A 5E65A 2KE0A 1NMVA 1ZCNA 4ODLA 2XPBA 1E6RA 2IF4A 4MPKA 3RM9A 3AS3A 2PI6A 2KO7A 3CHEA 1XRVA 3O5KA 1UR9A 4A0TA 4G50A 3GPKA 4Z2KA 2KGJA 1FKBA 3O5RA 3CHCA 3L4HA 1KT0A 2LKNA 2XP7A 1IX5A 1W9VA 4REXA 1W9UA 4S3KA 1EHNA 1H0IA 4WKHA 1J6YA 4DRHA 1HXVA 3KAIA 3NTPA 2YSBA 4IT6A 2A3CA 5HTGA 1L1PA 2L4JA 3WD3A 3ARQA 1HKJA 2DT1A 1FAPA 1TR8A 1GUVA 4Q7NA 1TK7A 1JVWA 2MLZA 2KXQA 2A3EA 4BF8A 1E15A 1JNEA 3RMEA 3VAWA 2RUDA 3JYJA 1D7IA 4P8XA 2DSWA 2EZ5W 2G41A 4IQCA 2DPEA 4WIWA 3NI6A 2PPNA 1W1VA 4HBEA 2EULA 3MCBB 4NSBA 2N87A
chains in the Genus database with same CATH topology
2M1IA 2PV1A 3KAHA 2XP4A 1GOIA 3UI5A 3LKXB 3WD1A 3JYMA 5B8IC 2Y8NB 4IQ2A 3TCZA 3NRKA 1FJDA 3UI6A 1E9LA 2PPOA 1JMQA 1NWUA 5E5WA 1ZBVA 2JX8A 1D7JA 3UQIA 2KR7A 5E64A 3KABA 1FKGA 2DSZA 3KACA 4ODPA 4ITZA 3WL0A 4URIA 2AOSA 1SR0A 1X6NA 5DF0A 2RQSA 1ZL1A 1BL4A 2WAEA 4DZ2A 2YBUA 3IKGA 1CTNA 2QRVA 4DZ3A 1HJVA 5GPGA 1E6ZA 1J4IA 5HT1A 1W1TA 1K9TA 2DSUA 2IUZA 5GPRA 3KAGA 1NWSA 4JFJA 1FFRA 4R0XA 1FKTA 3ODKA 1KT1A 3O5QA 2YSIA 3O5FA 3QOKA 1LG1A 1FKKA 4LAXA 3O5GA 3UF8A 1ROUA 4QT3A 4DIPA 3PRAA 1R9HA 2YSGA 1E6PA 3CHFA 4G2PA 1EDQA 2M2AA 4WKAA 4E5RA 2ZAJA 2YBTA 4WJXA 3RGCA 3KCEA 4ZPTR 4Z2GA 2DWVA 4U84A 4AY1A 3FS8A 2M3OW 3B9AA 4W9OA 4ODRA 1LL6A 2XP3A 1F40A 4MAVA 4JFIA 5HBFA 3FSBA 1ZK6A 3ARWA 4JFLA 4QT2A 2A3AA 4DRJA 5AHTA 4KR0B 4Z2HA 1EIBA 2MF9A 3RM8A 4U85A 1KFWA 4HBOA 3O5DA 2G8ZA 3MCBA 2DG4A 2OFNA 4GGQA 2RUQA 4TYOA 2DK1A 1B6CA 4QIBA 3WKZA 2ITKA 3ARVA 1NWTA 4Q22A 1FKHA 1OGBA 2WM0A 3B9DA 4HARA 1Q6HA 1HJWA 2DJYA 2WK2A 4DT4A 3PA7A 1WMVA 1BKFA 1FKDA 3O5OA 1T11A 3H9RB 3CGNA 1H0GA 2FKEA 3PQHA 4ODMA 2KFWA 4LAYA 2ZQSA 2ZQUA 1GPFA 3EY6A 4GIVA 4ML4A 4ODNA 2PV3A 3OA5A 4DRNA 1EQ3A 1XHGA 3PRBA 1E6NA 2Q5AA 2LAJA 1K9RA 4ODQA 1FKIA 2M8JA 3WD0A 1FKRA 3O5PA 4TNSA 1UR8A 1FKJA 4DRMA 4MGVA 2ZQVA 5E62A 2LJ4A 1ZU8A 1ZBKA 1J4HA 4WK9A 1YW5A 3B9EA 2RUCA 1HKKA 2E45A 3M85A 4GLXA 4KQZA 3G6LA 4J4NA 2OLHA 3LE4A 2KI3A 1OWQA 2FDMA 2DG9A 2VN1A 1TCOC 2DG3A 1Q1CA 1W1PA 3ARZA 4J4OA 1FFQA 5HWBA 2M8IA 2PPPA 2PV2A 4Z2IA 2XP6A 4QZVB 1I5HW 3IK8A 1LQ0A 5JH8A 1FKLA 1W26A 1K9QA 1P5QA 1J4RA 2JV4A 5U47A 2ZR6A 3WIJA 1EG4A 3WQVA 5DIVA 3CH9A 4FN2A 3KAFA 3RM4A 1LL4A 3MDYB 2ZR4A 2QF8A 1ZBWA 4S3JA 3TDBA 3ALFA 4JFKA 4TW8A 5CQ2A 4L72B 4U86A 2RSEA 1X6LA 4TW6A 2LPVA 2JMFA 2XP8A 3FSCA 3AROA 5DIUA 3ARYA 4R5EA 3CHDA 4NZCA 3UI4A 5HW6A 4A0UA 2DT2A 4C02B 3WQWA 3O5JA 4DWSD 1D7HA 3ALGA 4TX0A 3O5LA 2JXWA 1LJYA 4ZPVR 3IHZA 2O9OA 2DT0A 3PR9A 1WB0A 1ROTA 1ZBCA 4ODOA 2YAJB 2F2DA 1VF8A 2MPHA 3AS2A 1FLCA 3B7XA 2DSVA 3AS0A 3CZ8A 4LAWA 4PTMA 2DT3A 3ARXA 1NMWA 4MTVA 4DWSA 4W9PA 3FXYA 2ZR5A 4IPXA 4XAKA 3ARRA 3WH0A 3O5IA 4DWSB 1JNSA 3AQUA 4ODKA 3CNGA 2XP9A 2XPAA 5HWCA 1HJXA 2LGOA 5DITA 4DROA 3LKXA 1JNTA 3ARSA 4JFMA 5HW7A 2Y78A 2OWOA 4DRQA 3MQHA 3O5MA 2RURA 2A3BA 1N1AA 2B31A 1NWRA 3WD4A 4N19A 1LG2A 2JZVA 4P8VA 5DO2A 5J6EA 1NSGA 2VCDA 4FAPA 3OOBA 4MNMA 4Z2LA 1M5YA 3RFWA 1U79A 2L2SA 5HKGA 4Z2JA 4LGXA 1EG3A 2F4EA 2O92A 3WD2A 1F8AB 1C9HA 3FY1A 1FKFA 3UQBA 2MNTA 4JYSA 4TW7A 2YSFA 1O6WA 2AWGA 3BXWA 2WLYA 1TFVA 4L3NA 4ZS6A 4W5UA 2DMVA 4DWSC 3KZ7A 1ITXA 3TC5A 1RD6A 5BXJA 1D6OA 4DRPA 2BA1A 1D2KA 1W1YA 3MQGA 1O6IA 2YSHA 1NH6A 1WAWA 3ARPA 4MNJA 2F21A 4LAVA 2ZQTA 1LL7A 1WNOA 1Q6UA 3I6CA 3JXVA 5DEZA 1HKMA 4ZPWR 2RE3A 3M7NA 4MSPA 2K8IA 4P8WA 4DRKA 1Q6IA 2WADA 1WR7A 1Y0OA 4NNRA 3AS1A 1SYTA 3B8SA 3O5EA 1FKSA 5D75A 4O2TA 2DK7A 5I98A 2XP5A 3G6MA 2M08A 3PRDA 1PINA 2PBCA 1W9PA 2WLZA 5E66A 1ZB5A 2MLYA 5GQBA 1A7XA 4IT4A 1QPLA 3IKDA 1PBKA 1QPFA 1HKIA 4P8UA 3LUOA 4DH0A 1QZ2A 3WL1A 2MLXA 1RP5A 3W4RA 3UQAA 5HUAA 2FAPA 3ARUA 1EYMA 1YATA 3ARTA 4DRIA 4W9QA 2D9FA 3KADA 3CGMA 2ESCA 1JNDA 4MNLA 1OGGA 2MDIA 4WKFA 5HW8A 4MNKA 3FAPA 1FD9A 2UZ5A 5E65A 2KE0A 1NMVA 1ZCNA 4ODLA 2XPBA 1E6RA 2IF4A 4MPKA 3RM9A 3AS3A 2PI6A 2KO7A 3CHEA 1XRVA 3O5KA 1UR9A 4A0TA 4G50A 3GPKA 4Z2KA 2KGJA 1FKBA 3O5RA 3CHCA 3L4HA 1KT0A 2LKNA 2XP7A 1IX5A 1W9VA 4REXA 1W9UA 4S3KA 1EHNA 1H0IA 4WKHA 1J6YA 4DRHA 1HXVA 3KAIA 3NTPA 2YSBA 4IT6A 2A3CA 5HTGA 1L1PA 2L4JA 3WD3A 3ARQA 1HKJA 2DT1A 1FAPA 1TR8A 1GUVA 4Q7NA 1TK7A 1JVWA 2MLZA 2KXQA 2A3EA 4BF8A 1E15A 1JNEA 3RMEA 3VAWA 2RUDA 3JYJA 1D7IA 4P8XA 2DSWA 2EZ5W 2G41A 4IQCA 2DPEA 4WIWA 3NI6A 2PPNA 1W1VA 4HBEA 3MCBB 4NSBA 2N87A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1Y0O A;  2DJY A;  4NNR A;  2M1I A;  2PV1 A;  3KAH A;  1D7H A;  3O5E A;  1WMV A;  3PA7 A;  4DT4 A;  1FKS A;  2XP4 A;  1BKF A;  3O5L A;  4TX0 A;  1FKD A;  3O5O A;  1T11 A;  5D75 A;  2JXW A;  3UI5 A;  4O2T A;  3IHZ A;  3H9R B;  2DK7 A;  5I98 A;  3CGN A;  2XP5 A;  3JYM A;  5B8I C;  4IQ2 A;  1ROT A;  3TCZ A;  2M08 A;  3PRD A;  1PIN A;  2FKE A;  2PBC A;  3NRK A;  4ODO A;  1FJD A;  3UI6 A;  2F2D A;  4ODM A;  2KFW A;  2MPH A;  4LAY A;  2ZQS A;  2ZQU A;  2MLY A;  1A7X A;  2PPO A;  3B7X A;  1QPL A;  3IKD A;  1PBK A;  1JMQ A;  1QPF A;  4LAW A;  3EY6 A;  4GIV A;  2JX8 A;  4ODN A;  1D7J A;  2PV3 A;  3LUO A;  1QZ2 A;  3UQI A;  1NMW A;  4DH0 A;  2KR7 A;  2MLX A;  4W9P A;  4DRN A;  1FKG A;  3KAB A;  3KAC A;  1EQ3 A;  2N87 A;  4ODP A;  4ITZ A;  3PRB A;  3UQA A;  5HUA A;  2FAP A;  2Q5A A;  2ZR5 A;  1EYM A;  4IPX A;  2LAJ A;  2RQS A;  1K9R A;  1BL4 A;  4DZ2 A;  3WH0 A;  1YAT A;  3IKG A;  4ODQ A;  1FKI A;  2M8J A;  3O5I A;  4DZ3 A;  1FKR A;  1JNS A;  5GPG A;  1J4I A;  3O5P A;  4TNS A;  5HT1 A;  4ODK A;  3CNG A;  1FKJ A;  4MGV A;  4W9Q A;  4DRI A;  2XP9 A;  2XPA A;  2D9F A;  2ZQV A;  4DRM A;  3KAD A;  2LJ4 A;  3CGM A;  5HWC A;  3KAG A;  1J4H A;  2LGO A;  4JFJ A;  2MDI A;  5HW8 A;  1YW5 A;  3FAP A;  1FKT A;  3ODK A;  1KT1 A;  4R0X A;  1FD9 A;  2RUC A;  3O5Q A;  2UZ5 A;  5DIT A;  4DRO A;  2YSI A;  1JNT A;  2KE0 A;  3O5F A;  4JFM A;  1NMV A;  1FKK A;  2Y78 A;  5HW7 A;  2E45 A;  3M85 A;  3O5G A;  1ZCN A;  4LAX A;  4C02 B;  4ODL A;  4DRP A;  3UF8 A;  1ROU A;  4J4N A;  3O5M A;  4DRQ A;  2RUR A;  3LE4 A;  2XPB A;  2KI3 A;  4QT3 A;  4DIP A;  2DG9 A;  2IF4 A;  1TCO C;  1R9H A;  2YSG A;  2VN1 A;  1N1A A;  2DG3 A;  1Q1C A;  3RFW A;  4G2P A;  2M2A A;  2KO7 A;  4E5R A;  2ZAJ A;  3RGC A;  4J4O A;  4N19 A;  3KCE A;  4TYO A;  5HWB A;  2M8I A;  3O5K A;  2PPP A;  2JZV A;  2DWV A;  2PV2 A;  5J6E A;  1NSG A;  2VCD A;  4FAP A;  4G50 A;  4U84 A;  3OOB A;  3GPK A;  2KGJ A;  2M3O W;  1FKB A;  2XP6 A;  1M5Y A;  3O5R A;  4ODR A;  1U79 A;  3L4H A;  1KT0 A;  2XP3 A;  2L2S A;  2LKN A;  4W9O A;  4JFI A;  5HKG A;  1EG3 A;  2F4E A;  1F40 A;  1I5H W;  1F8A B;  1C9H A;  2XP7 A;  3IK8 A;  1FKL A;  1FKF A;  1ZK6 A;  3UQB A;  2MNT A;  4REX A;  4JYS A;  4TW7 A;  2YSF A;  4JFL A;  1O6W A;  1W26 A;  4QT2 A;  1K9Q A;  1P5Q A;  4DRJ A;  1J4R A;  1J6Y A;  5AHT A;  4DRH A;  2JV4 A;  1HXV A;  2AWG A;  2ZR6 A;  3KAI A;  1EG4 A;  2YSB A;  3NTP A;  5HTG A;  1L1P A;  2L4J A;  5DIV A;  2MF9 A;  3O5J A;  4U85 A;  2DMV A;  1FAP A;  3KZ7 A;  3KAF A;  3O5D A;  4FN2 A;  3MDY B;  3TC5 A;  5BXJ A;  2ZR4 A;  1D6O A;  2OFN A;  1TK7 A;  1JVW A;  2DG4 A;  2BA1 A;  2RUQ A;  2DK1 A;  2MLZ A;  2KXQ A;  4GGQ A;  4BF8 A;  3TDB A;  4JFK A;  1B6C A;  4TW8 A;  5CQ2 A;  4U86 A;  4QIB A;  2RSE A;  2YSH A;  4TW6 A;  2ITK A;  2LPV A;  2JMF A;  2XP8 A;  5DIU A;  3VAW A;  2RUD A;  3JYJ A;  2F21 A;  1D7I A;  4LAV A;  2ZQT A;  1FKH A;  1Q6U A;  2EZ5 W;  3I6C A;  3JXV A;  4IQC A;  3UI4 A;  5HW6 A;  3NI6 A;  2RE3 A;  2PPN A;  3M7N A;  4MSP A;  2K8I A;  4DRK A;  1Q6H A;  1Q6I A;  1WR7 A; 
#chains in the Genus database with same CATH topology
 2M1I A;  2PV1 A;  3KAH A;  2XP4 A;  1GOI A;  3UI5 A;  3LKX B;  3WD1 A;  3JYM A;  5B8I C;  2Y8N B;  4IQ2 A;  3TCZ A;  3NRK A;  1FJD A;  3UI6 A;  1E9L A;  2PPO A;  1JMQ A;  1NWU A;  2ETN A;  5E5W A;  1ZBV A;  2JX8 A;  1D7J A;  3UQI A;  2KR7 A;  5E64 A;  3KAB A;  1FKG A;  2DSZ A;  3KAC A;  4ODP A;  4ITZ A;  3WL0 A;  4URI A;  2AOS A;  1SR0 A;  1X6N A;  5DF0 A;  2RQS A;  1ZL1 A;  1BL4 A;  2WAE A;  4DZ2 A;  2YBU A;  3IKG A;  1CTN A;  2QRV A;  4DZ3 A;  1HJV A;  5GPG A;  1E6Z A;  1J4I A;  5HT1 A;  1W1T A;  1K9T A;  2DSU A;  2IUZ A;  5GPR A;  3KAG A;  1NWS A;  4JFJ A;  1FFR A;  4R0X A;  1FKT A;  3ODK A;  1KT1 A;  3O5Q A;  2YSI A;  3O5F A;  3QOK A;  1LG1 A;  1FKK A;  4LAX A;  3O5G A;  3UF8 A;  1ROU A;  4QT3 A;  4DIP A;  3PRA A;  1R9H A;  2YSG A;  1E6P A;  3CHF A;  4G2P A;  1EDQ A;  2M2A A;  4WKA A;  4E5R A;  2ZAJ A;  2YBT A;  4WJX A;  3RGC A;  3KCE A;  4ZPT R;  4Z2G A;  2DWV A;  1E44 A;  4U84 A;  4AY1 A;  3FS8 A;  2M3O W;  3B9A A;  4W9O A;  4ODR A;  1LL6 A;  2XP3 A;  1F40 A;  4MAV A;  4JFI A;  5HBF A;  3FSB A;  1ZK6 A;  3ARW A;  4JFL A;  4QT2 A;  2A3A A;  4DRJ A;  5AHT A;  4KR0 B;  4Z2H A;  1EIB A;  2MF9 A;  3RM8 A;  4U85 A;  1KFW A;  4HBO A;  3O5D A;  2G8Z A;  3MCB A;  2DG4 A;  2OFN A;  4GGQ A;  2RUQ A;  4TYO A;  2DK1 A;  1JCH B;  1B6C A;  1GRJ A;  4QIB A;  3WKZ A;  2ITK A;  3ARV A;  1NWT A;  4Q22 A;  1FKH A;  1OGB A;  2WM0 A;  3B9D A;  4HAR A;  1Q6H A;  1HJW A;  2DJY A;  2WK2 A;  4DT4 A;  3PA7 A;  1WMV A;  1BKF A;  1FKD A;  3O5O A;  1T11 A;  3H9R B;  3CGN A;  1H0G A;  2FKE A;  3PQH A;  4ODM A;  2KFW A;  4LAY A;  2ZQS A;  2ZQU A;  1GPF A;  2B5U B;  3EY6 A;  4GIV A;  4ML4 A;  4ODN A;  2PV3 A;  3OA5 A;  4DRN A;  1EQ3 A;  1XHG A;  3PRB A;  1E6N A;  2Q5A A;  2LAJ A;  1K9R A;  4ODQ A;  1FKI A;  2M8J A;  3WD0 A;  1FKR A;  3O5P A;  4TNS A;  1UR8 A;  1FKJ A;  4DRM A;  4MGV A;  2ZQV A;  5E62 A;  2LJ4 A;  1ZU8 A;  1ZBK A;  1J4H A;  4WK9 A;  1YW5 A;  3B9E A;  2RUC A;  1HKK A;  2E45 A;  3M85 A;  4GLX A;  4KQZ A;  3G6L A;  4J4N A;  2OLH A;  3LE4 A;  2KI3 A;  1OWQ A;  2FDM A;  2DG9 A;  2VN1 A;  1TCO C;  2DG3 A;  1Q1C A;  1W1P A;  3ARZ A;  4J4O A;  1FFQ A;  5HWB A;  2M8I A;  2PPP A;  2PV2 A;  4Z2I A;  2XP6 A;  4QZV B;  1I5H W;  3IK8 A;  1LQ0 A;  5JH8 A;  1FKL A;  1W26 A;  1K9Q A;  1P5Q A;  1J4R A;  2JV4 A;  5U47 A;  2ZR6 A;  3WIJ A;  1EG4 A;  3WQV A;  5DIV A;  3CH9 A;  4FN2 A;  3KAF A;  3RM4 A;  1LL4 A;  3MDY B;  2ZR4 A;  2QF8 A;  2P4V A;  1ZBW A;  4S3J A;  3TDB A;  3ALF A;  4JFK A;  4TW8 A;  5CQ2 A;  4L72 B;  4U86 A;  2RSE A;  1X6L A;  4TW6 A;  2LPV A;  2JMF A;  2XP8 A;  3FSC A;  3ARO A;  5DIU A;  3ARY A;  4R5E A;  3CHD A;  4NZC A;  3UI4 A;  5HW6 A;  4A0U A;  2DT2 A;  4C02 B;  3WQW A;  3O5J A;  4DWS D;  1D7H A;  3ALG A;  4TX0 A;  3O5L A;  2JXW A;  1LJY A;  4ZPV R;  3IHZ A;  2O9O A;  2DT0 A;  3PR9 A;  1WB0 A;  1ROT A;  1ZBC A;  4ODO A;  2YAJ B;  2F2D A;  1VF8 A;  2MPH A;  3AS2 A;  1FLC A;  3B7X A;  2DSV A;  3AS0 A;  3CZ8 A;  4LAW A;  4PTM A;  2DT3 A;  3ARX A;  1NMW A;  4MTV A;  4DWS A;  4W9P A;  3FXY A;  2ZR5 A;  4IPX A;  4UDM A;  4XAK A;  3ARR A;  3WH0 A;  3O5I A;  4DWS B;  1JNS A;  3AQU A;  4ODK A;  3CNG A;  2XP9 A;  2XPA A;  5HWC A;  1HJX A;  2LGO A;  3GTY X;  5DIT A;  4DRO A;  3LKX A;  1JNT A;  3ARS A;  4JFM A;  5HW7 A;  2Y78 A;  2OWO A;  4DRQ A;  3MQH A;  3O5M A;  2RUR A;  2A3B A;  1N1A A;  2B31 A;  1NWR A;  3WD4 A;  4N19 A;  1LG2 A;  2JZV A;  4P8V A;  5DO2 A;  5J6E A;  1NSG A;  2VCD A;  4FAP A;  3OOB A;  4MNM A;  4Z2L A;  1M5Y A;  3RFW A;  1U79 A;  2L2S A;  5HKG A;  4Z2J A;  4LGX A;  1EG3 A;  2F4E A;  2O92 A;  3WD2 A;  1F8A B;  1C9H A;  3FY1 A;  1FKF A;  3UQB A;  2MNT A;  4JYS A;  4TW7 A;  2YSF A;  3BMB A;  1O6W A;  2PN0 A;  2AWG A;  3BXW A;  2WLY A;  1TFV A;  4L3N A;  4ZS6 A;  4W5U A;  2DMV A;  4DWS C;  3KZ7 A;  1ITX A;  3TC5 A;  1RD6 A;  5BXJ A;  1D6O A;  4DRP A;  2BA1 A;  1D2K A;  1W1Y A;  3MQG A;  1O6I A;  2YSH A;  1NH6 A;  1WAW A;  3ARP A;  4MNJ A;  2F21 A;  4LAV A;  2ZQT A;  1LL7 A;  1WNO A;  1Q6U A;  3I6C A;  3JXV A;  5DEZ A;  1HKM A;  4ZPW R;  3GU0 A;  2RE3 A;  3M7N A;  4MSP A;  2K8I A;  4P8W A;  4DRK A;  1Q6I A;  2WAD A;  1WR7 A;  1Y0O A;  4NNR A;  3AS1 A;  1SYT A;  3B8S A;  3O5E A;  1FKS A;  2F23 A;  5D75 A;  4O2T A;  2DK7 A;  5I98 A;  2XP5 A;  3EIP A;  3G6M A;  2M08 A;  3PRD A;  1PIN A;  2PBC A;  1W9P A;  2WLZ A;  5E66 A;  1ZB5 A;  2MLY A;  5GQB A;  1A7X A;  4IT4 A;  1QPL A;  3IKD A;  1PBK A;  1QPF A;  1HKI A;  4P8U A;  3LUO A;  4DH0 A;  1QZ2 A;  3WL1 A;  2MLX A;  1RP5 A;  3W4R A;  3UQA A;  5HUA A;  2FAP A;  3ARU A;  1EYM A;  1YAT A;  3ART A;  4DRI A;  4W9Q A;  2D9F A;  3KAD A;  3CGM A;  2ESC A;  1JND A;  4MNL A;  1OGG A;  2MDI A;  4WKF A;  5HW8 A;  4MNK A;  3FAP A;  1FD9 A;  2UZ5 A;  5E65 A;  2KE0 A;  1NMV A;  1ZCN A;  4ODL A;  2XPB A;  1E6R A;  2IF4 A;  4MPK A;  3RM9 A;  3AS3 A;  2PI6 A;  2KO7 A;  3CHE A;  1XRV A;  3O5K A;  1UR9 A;  4A0T A;  4G50 A;  3GPK A;  4Z2K A;  2KGJ A;  1FKB A;  3O5R A;  3CHC A;  3L4H A;  1KT0 A;  2LKN A;  2XP7 A;  1IX5 A;  1W9V A;  4REX A;  1W9U A;  4S3K A;  1EHN A;  1H0I A;  4WKH A;  1J6Y A;  4DRH A;  1HXV A;  3KAI A;  3NTP A;  2YSB A;  4IT6 A;  2A3C A;  5HTG A;  1L1P A;  2L4J A;  3WD3 A;  3ARQ A;  1HKJ A;  2DT1 A;  1FAP A;  1TR8 A;  1GUV A;  4Q7N A;  1TK7 A;  1JVW A;  2MLZ A;  2KXQ A;  2A3E A;  4BF8 A;  1E15 A;  1JNE A;  3RME A;  3VAW A;  2RUD A;  3JYJ A;  1D7I A;  4P8X A;  2DSW A;  2EZ5 W;  2G41 A;  4IQC A;  2DPE A;  4WIW A;  3NI6 A;  2PPN A;  1W1V A;  4HBE A;  2EUL A;  3MCB B;  4NSB A;  2N87 A; 
#chains in the Genus database with same CATH homology
 2M1I A;  2PV1 A;  3KAH A;  2XP4 A;  1GOI A;  3UI5 A;  3LKX B;  3WD1 A;  3JYM A;  5B8I C;  2Y8N B;  4IQ2 A;  3TCZ A;  3NRK A;  1FJD A;  3UI6 A;  1E9L A;  2PPO A;  1JMQ A;  1NWU A;  5E5W A;  1ZBV A;  2JX8 A;  1D7J A;  3UQI A;  2KR7 A;  5E64 A;  3KAB A;  1FKG A;  2DSZ A;  3KAC A;  4ODP A;  4ITZ A;  3WL0 A;  4URI A;  2AOS A;  1SR0 A;  1X6N A;  5DF0 A;  2RQS A;  1ZL1 A;  1BL4 A;  2WAE A;  4DZ2 A;  2YBU A;  3IKG A;  1CTN A;  2QRV A;  4DZ3 A;  1HJV A;  5GPG A;  1E6Z A;  1J4I A;  5HT1 A;  1W1T A;  1K9T A;  2DSU A;  2IUZ A;  5GPR A;  3KAG A;  1NWS A;  4JFJ A;  1FFR A;  4R0X A;  1FKT A;  3ODK A;  1KT1 A;  3O5Q A;  2YSI A;  3O5F A;  3QOK A;  1LG1 A;  1FKK A;  4LAX A;  3O5G A;  3UF8 A;  1ROU A;  4QT3 A;  4DIP A;  3PRA A;  1R9H A;  2YSG A;  1E6P A;  3CHF A;  4G2P A;  1EDQ A;  2M2A A;  4WKA A;  4E5R A;  2ZAJ A;  2YBT A;  4WJX A;  3RGC A;  3KCE A;  4ZPT R;  4Z2G A;  2DWV A;  4U84 A;  4AY1 A;  3FS8 A;  2M3O W;  3B9A A;  4W9O A;  4ODR A;  1LL6 A;  2XP3 A;  1F40 A;  4MAV A;  4JFI A;  5HBF A;  3FSB A;  1ZK6 A;  3ARW A;  4JFL A;  4QT2 A;  2A3A A;  4DRJ A;  5AHT A;  4KR0 B;  4Z2H A;  1EIB A;  2MF9 A;  3RM8 A;  4U85 A;  1KFW A;  4HBO A;  3O5D A;  2G8Z A;  3MCB A;  2DG4 A;  2OFN A;  4GGQ A;  2RUQ A;  4TYO A;  2DK1 A;  1B6C A;  4QIB A;  3WKZ A;  2ITK A;  3ARV A;  1NWT A;  4Q22 A;  1FKH A;  1OGB A;  2WM0 A;  3B9D A;  4HAR A;  1Q6H A;  1HJW A;  2DJY A;  2WK2 A;  4DT4 A;  3PA7 A;  1WMV A;  1BKF A;  1FKD A;  3O5O A;  1T11 A;  3H9R B;  3CGN A;  1H0G A;  2FKE A;  3PQH A;  4ODM A;  2KFW A;  4LAY A;  2ZQS A;  2ZQU A;  1GPF A;  3EY6 A;  4GIV A;  4ML4 A;  4ODN A;  2PV3 A;  3OA5 A;  4DRN A;  1EQ3 A;  1XHG A;  3PRB A;  1E6N A;  2Q5A A;  2LAJ A;  1K9R A;  4ODQ A;  1FKI A;  2M8J A;  3WD0 A;  1FKR A;  3O5P A;  4TNS A;  1UR8 A;  1FKJ A;  4DRM A;  4MGV A;  2ZQV A;  5E62 A;  2LJ4 A;  1ZU8 A;  1ZBK A;  1J4H A;  4WK9 A;  1YW5 A;  3B9E A;  2RUC A;  1HKK A;  2E45 A;  3M85 A;  4GLX A;  4KQZ A;  3G6L A;  4J4N A;  2OLH A;  3LE4 A;  2KI3 A;  1OWQ A;  2FDM A;  2DG9 A;  2VN1 A;  1TCO C;  2DG3 A;  1Q1C A;  1W1P A;  3ARZ A;  4J4O A;  1FFQ A;  5HWB A;  2M8I A;  2PPP A;  2PV2 A;  4Z2I A;  2XP6 A;  4QZV B;  1I5H W;  3IK8 A;  1LQ0 A;  5JH8 A;  1FKL A;  1W26 A;  1K9Q A;  1P5Q A;  1J4R A;  2JV4 A;  5U47 A;  2ZR6 A;  3WIJ A;  1EG4 A;  3WQV A;  5DIV A;  3CH9 A;  4FN2 A;  3KAF A;  3RM4 A;  1LL4 A;  3MDY B;  2ZR4 A;  2QF8 A;  1ZBW A;  4S3J A;  3TDB A;  3ALF A;  4JFK A;  4TW8 A;  5CQ2 A;  4L72 B;  4U86 A;  2RSE A;  1X6L A;  4TW6 A;  2LPV A;  2JMF A;  2XP8 A;  3FSC A;  3ARO A;  5DIU A;  3ARY A;  4R5E A;  3CHD A;  4NZC A;  3UI4 A;  5HW6 A;  4A0U A;  2DT2 A;  4C02 B;  3WQW A;  3O5J A;  4DWS D;  1D7H A;  3ALG A;  4TX0 A;  3O5L A;  2JXW A;  1LJY A;  4ZPV R;  3IHZ A;  2O9O A;  2DT0 A;  3PR9 A;  1WB0 A;  1ROT A;  1ZBC A;  4ODO A;  2YAJ B;  2F2D A;  1VF8 A;  2MPH A;  3AS2 A;  1FLC A;  3B7X A;  2DSV A;  3AS0 A;  3CZ8 A;  4LAW A;  4PTM A;  2DT3 A;  3ARX A;  1NMW A;  4MTV A;  4DWS A;  4W9P A;  3FXY A;  2ZR5 A;  4IPX A;  4XAK A;  3ARR A;  3WH0 A;  3O5I A;  4DWS B;  1JNS A;  3AQU A;  4ODK A;  3CNG A;  2XP9 A;  2XPA A;  5HWC A;  1HJX A;  2LGO A;  5DIT A;  4DRO A;  3LKX A;  1JNT A;  3ARS A;  4JFM A;  5HW7 A;  2Y78 A;  2OWO A;  4DRQ A;  3MQH A;  3O5M A;  2RUR A;  2A3B A;  1N1A A;  2B31 A;  1NWR A;  3WD4 A;  4N19 A;  1LG2 A;  2JZV A;  4P8V A;  5DO2 A;  5J6E A;  1NSG A;  2VCD A;  4FAP A;  3OOB A;  4MNM A;  4Z2L A;  1M5Y A;  3RFW A;  1U79 A;  2L2S A;  5HKG A;  4Z2J A;  4LGX A;  1EG3 A;  2F4E A;  2O92 A;  3WD2 A;  1F8A B;  1C9H A;  3FY1 A;  1FKF A;  3UQB A;  2MNT A;  4JYS A;  4TW7 A;  2YSF A;  1O6W A;  2AWG A;  3BXW A;  2WLY A;  1TFV A;  4L3N A;  4ZS6 A;  4W5U A;  2DMV A;  4DWS C;  3KZ7 A;  1ITX A;  3TC5 A;  1RD6 A;  5BXJ A;  1D6O A;  4DRP A;  2BA1 A;  1D2K A;  1W1Y A;  3MQG A;  1O6I A;  2YSH A;  1NH6 A;  1WAW A;  3ARP A;  4MNJ A;  2F21 A;  4LAV A;  2ZQT A;  1LL7 A;  1WNO A;  1Q6U A;  3I6C A;  3JXV A;  5DEZ A;  1HKM A;  4ZPW R;  2RE3 A;  3M7N A;  4MSP A;  2K8I A;  4P8W A;  4DRK A;  1Q6I A;  2WAD A;  1WR7 A;  1Y0O A;  4NNR A;  3AS1 A;  1SYT A;  3B8S A;  3O5E A;  1FKS A;  5D75 A;  4O2T A;  2DK7 A;  5I98 A;  2XP5 A;  3G6M A;  2M08 A;  3PRD A;  1PIN A;  2PBC A;  1W9P A;  2WLZ A;  5E66 A;  1ZB5 A;  2MLY A;  5GQB A;  1A7X A;  4IT4 A;  1QPL A;  3IKD A;  1PBK A;  1QPF A;  1HKI A;  4P8U A;  3LUO A;  4DH0 A;  1QZ2 A;  3WL1 A;  2MLX A;  1RP5 A;  3W4R A;  3UQA A;  5HUA A;  2FAP A;  3ARU A;  1EYM A;  1YAT A;  3ART A;  4DRI A;  4W9Q A;  2D9F A;  3KAD A;  3CGM A;  2ESC A;  1JND A;  4MNL A;  1OGG A;  2MDI A;  4WKF A;  5HW8 A;  4MNK A;  3FAP A;  1FD9 A;  2UZ5 A;  5E65 A;  2KE0 A;  1NMV A;  1ZCN A;  4ODL A;  2XPB A;  1E6R A;  2IF4 A;  4MPK A;  3RM9 A;  3AS3 A;  2PI6 A;  2KO7 A;  3CHE A;  1XRV A;  3O5K A;  1UR9 A;  4A0T A;  4G50 A;  3GPK A;  4Z2K A;  2KGJ A;  1FKB A;  3O5R A;  3CHC A;  3L4H A;  1KT0 A;  2LKN A;  2XP7 A;  1IX5 A;  1W9V A;  4REX A;  1W9U A;  4S3K A;  1EHN A;  1H0I A;  4WKH A;  1J6Y A;  4DRH A;  1HXV A;  3KAI A;  3NTP A;  2YSB A;  4IT6 A;  2A3C A;  5HTG A;  1L1P A;  2L4J A;  3WD3 A;  3ARQ A;  1HKJ A;  2DT1 A;  1FAP A;  1TR8 A;  1GUV A;  4Q7N A;  1TK7 A;  1JVW A;  2MLZ A;  2KXQ A;  2A3E A;  4BF8 A;  1E15 A;  1JNE A;  3RME A;  3VAW A;  2RUD A;  3JYJ A;  1D7I A;  4P8X A;  2DSW A;  2EZ5 W;  2G41 A;  4IQC A;  2DPE A;  4WIW A;  3NI6 A;  2PPN A;  1W1V A;  4HBE A;  3MCB B;  4NSB A;  2N87 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...