2ZR6A

Crystal structure of a mutant pin1 peptidyl-prolyl cis-trans isomerase
Total Genus 39
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
39
sequence length
158
structure length
153
Chain Sequence
KLPPGWEKAMSRSSGRVYYFNHITNASQWERPSGGKNGQGEPARVRCSHLLVKHSQSRRPSSWRQEKITRTKEEALELINGYIQKIKSGEEDFESLASQFSDCSSAKARGDLGAFSRGQMQKPFEDASFALRTGEMSGPVFTDSGIHIILRTE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural studies on PIN1 mutants
rcsb
source organism Homo sapiens
molecule tags Isomerase
molecule keywords Peptidyl-prolyl cis-trans isomerase NIMA-interacting 1
total genus 39
structure length 153
sequence length 158
ec nomenclature ec 5.2.1.8: Peptidylprolyl isomerase.
pdb deposition date 2008-08-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00397 WW WW domain
A PF00639 Rotamase PPIC-type PPIASE domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.20.70.10 Mainly Beta Single Sheet Ubiquitin Ligase Nedd4; Chain: W; Ubiquitin Ligase Nedd4; Chain: W; 2zr6A01
3.10.50.40 Alpha Beta Roll Chitinase A; domain 3 Chitinase A; domain 3 2zr6A02
1F8AB 2XP6A 2ZQUA 2ZQTA 1NMWA 3CGMA 4JFLA 4J4OA 2XPBA 2KI3A 2FKEA 1HXVA 1BL4A 3O5PA 4DIPA 1EG3A 3ODKA 2M1IA 2JMFA 3KAHA 3IHZA 3NI6A 2M8IA 2F2DA 3UF8A 3NTPA 3NRKA 2M08A 3UQAA 3TC5A 3I6CA 4JFKA 4ODMA 2IF4A 2LKNA 4IQCA 4TYOA 4TX0A 4DH0A 5CQ2A 2LJ4A 3O5IA 1FJDA 4JFIA 1YATA 2RUQA 1FKJA 3IKDA 3PA7A 3TCZA 4IPXA 4DRPA 4J4NA 1O6WA 2YSIA 2YSFA 4W9PA 2RE3A 1T11A 2VCDA 1F40A 2VN1A 3O5FA 2XP4A 4W9OA 3LE4A 2MDIA 2M3OW 1JMQA 1J4HA 1JVWA 1K9QA 3O5EA 2RURA 2PPPA 2PV3A 3KCEA 4DRHA 4LAWA 2MPHA 1A7XA 1KT0A 2L4JA 3O5QA 1M5YA 2N87A 2LPVA 4FN2A 5DITA 5HWCA 2DWVA 5HW8A 1B6CA 4R0XA 1Q6UA 4BF8A 4JYSA 5HT1A 1ROUA 2XP3A 2JZVA 3PRBA 2XP9A 1N1AA 2DG3A 2Q5AA 1NMVA 2JX8A 1FKGA 1Q6IA 1D7JA 2OFNA 4LAXA 5D75A 4DROA 1EQ3A 1J4IA 2JXWA 5HKGA 2LGOA 2M8JA 4FAPA 4QT3A 3PRDA 2ZAJA 1EYMA 3FAPA 3KACA 2ZQVA 3KABA 5BXJA 2RSEA 4JFJA 1FKIA 1WR7A 1QPFA 4W9QA 3WH0A 3UI5A 5B8IC 2DJYA 4ODOA 4TNSA 3M7NA 2KXQA 1FKBA 3M85A 4DRMA 5DIUA 4E5RA 4MSPA 4QT2A 5J6EA 2JV4A 1U79A 2DK1A 3IK8A 5DIVA 3KAGA 1FKLA 3IKGA 5HUAA 1EG4A 1R9HA 1K9RA 5HW7A 1I5HW 2AWGA 3B7XA 3JYMA 3KADA 4O2TA 4DRQA 2MLYA 1FKFA 2PPNA 1KT1A 1YW5A 4MGVA 3UI4A 1JNSA 2YSBA 4U84A 5I98A 1C9HA 1P5QA 4REXA 3RFWA 1Q6HA 2PV1A 2KO7A 4ODKA 2L2SA 3O5GA 1FAPA 2ZQSA 3RGCA 5AHTA 2K8IA 1PBKA 4C02B 2MF9A 5HWBA 1FKTA 3UQBA 2RQSA 2EZ5W 2YSGA 2PV2A 2YSHA 3VAWA 5HTGA 3H9RB 1W26A 4JFMA 4ODLA 4DZ3A 3MDYB 3O5JA 1FD9A 2DK7A 2ITKA 4DRKA 2XP8A 3LUOA 3KAFA 4ODRA 1FKRA 3TDBA 2UZ5A 3O5KA 2PPOA 2E45A 2PBCA 4LAYA 1BKFA 1FKSA 3O5LA 3EY6A 3O5DA 2Y78A 2KFWA 4ODPA 3UQIA 3KAIA 3CGNA 1D7HA 3O5OA 1FKDA 2ZR6A 2DG9A 2DG4A 3JXVA 2LAJA 3JYJA 4N19A 1D7IA 2F21A 1Y0OA 4G50A 4NNRA 4DRNA 2DMVA 4ODQA 4TW6A 3OOBA 4QIBA 4IQ2A 4DRIA 1J4RA 1D6OA 4DRJA 2KGJA 2XP7A 4DZ2A 1WMVA 1PINA 3L4HA 1TK7A 1FKHA 2KR7A 2MLZA 4GIVA 1ROTA 1ZK6A 2FAPA 2MLXA 4TW8A 2D9FA 2MNTA 3UI6A 3CNGA 3O5MA 1QPLA 1JNTA 1TCOC 1FKKA 3O5RA 2KE0A 5GPGA 1L1PA 2ZR5A 1QZ2A 4ITZA 4DT4A 2M2AA 2ZR4A 2RUCA 3GPKA 4G2PA 4U86A 2XPAA 2BA1A 4U85A 4ODNA 4TW7A 2RUDA 1ZCNA 4GGQA 1Q1CA 1NSGA 1J6YA 2F4EA 2XP5A 3KZ7A 4LAVA 5HW6A
chains in the Genus database with same CATH superfamily
1K9TA 1E44A 2QRVA 3WL0A 3FXYA 2M8IA 1X6LA 4JFKA 4WIWA 4TX0A 5CQ2A 2LJ4A 1FJDA 1YATA 3FS8A 4MNJA 3AS2A 3ARZA 4S3JA 2P4VA 3GTYX 4XAKA 3BXWA 4A0TA 4Z2LA 2MDIA 1JMQA 3AROA 3WQWA 1HKIA 3G6MA 2PPPA 2PV3A 3O5QA 1M5YA 2LPVA 1B6CA 4R0XA 1Q6UA 3B9EA 3CZ8A 2XP9A 1N1AA 3LKXA 2Q5AA 2F23A 2JXWA 3ALGA 2B5UB 1TR8A 3PRDA 3KACA 2RSEA 4JFJA 1FKIA 5JH8A 3WH0A 2O92A 3M85A 4MSPA 2DK1A 1NWUA 4AY1A 1K9RA 4DRQA 2EULA 1LG1A 1JNSA 2ZQSA 3ARSA 3RGCA 5AHTA 2WLYA 3B9DA 5HWBA 2YSHA 3H9RB 4JFMA 1HJWA 3FY1A 1FD9A 1HKMA 2UZ5A 2DT3A 2PPOA 1E6NA 1HKJA 2Y78A 4ODPA 3UQIA 3WL1A 3O5OA 3MCBB 5E65A 2DG4A 2A3BA 1J4RA 2XP7A 5DEZA 4DZ2A 1PINA 1FKHA 4Z2HA 1E6PA 1ROTA 2DSUA 2OWOA 2D9FA 1JNTA 1TCOC 3WIJA 4R5EA 1QZ2A 3WD0A 4DT4A 1SYTA 3AS0A 4G2PA 1WNOA 4Z2GA 2RUDA 1ZCNA 3ARTA 4Z2IA 2F4EA 1FLCA 1TK7A 3KZ7A 4DZ3A 1NWRA 3CGMA 2ZQTA 2WK2A 4J4OA 2KI3A 2DT2A 2FKEA 1HXVA 3ARRA 1BL4A 1WB0A 1EG3A 3ODKA 2M1IA 2JMFA 2M08A 4GLXA 3AS1A 1ZU8A 2IF4A 2LKNA 4IQCA 1JNDA 1LJYA 2RUQA 1FKJA 4QZVB 3IKDA 3PA7A 3TCZA 4DRPA 1RD6A 4J4NA 2B31A 2YSIA 2YSFA 1W9VA 1F40A 3O5FA 2XP4A 1K9QA 3O5EA 2RURA 1E6RA 1KT0A 3W4RA 4FN2A 2N87A 5HWCA 4P8VA 5HW8A 4LAVA 1ROUA 4W5UA 1NMVA 4DROA 2ESCA 4ZS6A 2LGOA 2M8JA 4FAPA 1EYMA 3FAPA 3WD2A 3KABA 4MNMA 4WKHA 1W1VA 1QPFA 1ZBVA 3PR9A 2DJYA 4ODOA 4DRMA 1LL4A 1E6ZA 4E5RA 4QT2A 5J6EA 2JV4A 2OLHA 5HUAA 3IKGA 2AWGA 3ARWA 1XHGA 3UI4A 5I98A 1C9HA 1P5QA 3RFWA 4ODKA 2PV1A 2KO7A 2L2SA 3RM9A 2K8IA 4C02B 2MF9A 2EZ5W 2DPEA 3VAWA 2YAJB 4S3KA 4DRKA 2XP8A 3LUOA 3KAFA 1ZBWA 4ODRA 4Z2JA 4HARA 1W1YA 3WQVA 1FKSA 3O5LA 3JYJA 1D7IA 2F21A 1Y0OA 4G50A 4NNRA 1CTNA 1EDQA 5E62A 3WKZA 4DRJA 3B9AA 2KGJA 1W1TA 1WMVA 2MLZA 2KR7A 3AS3A 4TW8A 1ZK6A 2MLXA 2MNTA 1QPLA 4L3NA 5U47A 2KE0A 2WLZA 5GPGA 1OGBA 4ITZA 2M2AA 2ZR4A 2RUCA 2BA1A 4ODNA 4GGQA 1Q1CA 1NSGA 2XP5A 3AQUA 1NMWA 1GRJA 4WKAA 2DSZA 4DWSA 1D2KA 4DIPA 4P8UA 3ARUA 4DWSC 1IX5A 3KAHA 3IHZA 2G8ZA 4Q22A 2F2DA 3NTPA 1NWTA 1HJXA 4TYOA 4KR0B 4MAVA 2A3CA 1ZBCA 2DT0A 1LL7A 4A0UA 3FSBA 4NZCA 1O6WA 4W9PA 1SR0A 1T11A 2VCDA 1EHNA 2VN1A 3LE4A 3PQHA 1ZL1A 1FFRA 4P8WA 1NWSA 3G6LA 3KCEA 4DRHA 4LAWA 2MPHA 4KQZA 5DITA 5E66A 1HKKA 3ARQA 4HBOA 4ML4A 4BF8A 4JYSA 5HT1A 1H0GA 2XP3A 2JZVA 3PRBA 2DG3A 4GIVA 4LAYA 2OFNA 2JX8A 1W9PA 3PRAA 1GUVA 5D75A 1O6IA 1EQ3A 1KFWA 1NH6A 2QF8A 5HKGA 1OWQA 1OGGA 2DSWA 5GQBA 4QT3A 3ARYA 2A3EA 5BXJA 5DO2A 4TNSA 3M7NA 1E15A 1FKBA 2Y8NB 5E5WA 1ITXA 3KAGA 2PN0A 1FKLA 1R9HA 5HW7A 1I5HW 4IT4A 2MLYA 2PPNA 3QOKA 2YSBA 4WKFA 4REXA 4ZPVR 4LGXA 3ALFA 3O5GA 1FAPA 1PBKA 1FKTA 3ARPA 2RQSA 2PV2A 1W26A 2ITKA 4ZPWR 2E45A 1BKFA 3EY6A 3O5DA 3KAIA 4MTVA 1FKDA 4N19A 2DG9A 3JXVA 2LAJA 2DMVA 3OOBA 1ZBKA 4IQ2A 3RM4A 2FAPA 2AOSA 1EIBA 3B8SA 2ZR5A 4WJXA 3FSCA 2PI6A 2YBUA 3GPKA 1WAWA 2WAEA 3WD1A 4U85A 4TW7A 3LKXB 1HJVA 1X6NA 5HW6A 1F8AB 2XP6A 2ZQUA 1RP5A 2XPBA 5DF0A 3O5PA 4DWSB 3BMBA 3NI6A 3ARVA 3UF8A 3NRKA 3UQAA 3TC5A 1GOIA 3I6CA 4L72B 4ODMA 2WADA 4DH0A 3O5IA 1ZB5A 4JFIA 1W1PA 4Q7NA 4IPXA 1TFVA 3OA5A 1GPFA 4URIA 2RE3A 4W9OA 4WK9A 2M3OW 1J4HA 1JVWA 4MNKA 4UDMA 1A7XA 3EIPA 2L4JA 2A3AA 2DSVA 1LQ0A 2DWVA 1LL6A 3CHCA 4P8XA 2IUZA 1W9UA 4JFLA 1FKGA 4LAXA 1Q6IA 1D7JA 4MPKA 4Z2KA 2ETNA 1J4IA 4PTMA 2O9OA 2ZAJA 5GPRA 3CHEA 2ZQVA 4W9QA 1WR7A 4MNLA 4HBEA 5B8IC 4NSBA 2KXQA 5DIUA 1FFQA 1U79A 3IK8A 5DIVA 3WD4A 1EG4A 3JYMA 3B7XA 4O2TA 3KADA 1FKFA 1KT1A 1YW5A 4MGVA 3MQGA 2DT1A 4U84A 1H0IA 1Q6HA 3UQBA 5HTGA 1JCHB 2YSGA 3WD3A 4ODLA 3MDYB 3O5JA 2DK7A 1FKRA 3TDBA 3O5KA 2PBCA 3MCBA 2KFWA 1E9LA 4IT6A 3CGNA 1D7HA 2FDMA 4ZPTR 3RM8A 4DWSD 2ZR6A 2G41A 4DRNA 5HBFA 4TW6A 3CH9A 4ODQA 1LG2A 4QIBA 2WM0A 4DRIA 1D6OA 3L4HA 3UI5A 3GU0A 1UR9A 3UI6A 3CNGA 3MQHA 3O5MA 1FKKA 1VF8A 3O5RA 1L1PA 1UR8A 3RMEA 1JNEA 2YBTA 4U86A 2XPAA 1XRVA 3CHDA 1J6YA 3ARXA 3CHFA 5E64A
chains in the Genus database with same CATH topology
1K9TA 2QRVA 3WL0A 3FXYA 2M8IA 1X6LA 4JFKA 4WIWA 4TX0A 5CQ2A 2LJ4A 1FJDA 1YATA 3FS8A 4MNJA 3AS2A 3ARZA 4S3JA 4XAKA 3BXWA 4A0TA 4Z2LA 2MDIA 1JMQA 3AROA 3WQWA 1HKIA 3G6MA 2PPPA 2PV3A 3O5QA 1M5YA 2LPVA 1B6CA 4R0XA 1Q6UA 3B9EA 3CZ8A 2XP9A 1N1AA 3LKXA 2Q5AA 2JXWA 3ALGA 1TR8A 3PRDA 3KACA 2RSEA 4JFJA 1FKIA 5JH8A 3WH0A 2O92A 3M85A 4MSPA 2DK1A 1NWUA 4AY1A 1K9RA 4DRQA 1LG1A 1JNSA 2ZQSA 3ARSA 3RGCA 5AHTA 2WLYA 3B9DA 5HWBA 2YSHA 3H9RB 4JFMA 1HJWA 3FY1A 1FD9A 1HKMA 2UZ5A 2DT3A 2PPOA 1E6NA 1HKJA 2Y78A 4ODPA 3UQIA 3WL1A 3O5OA 3MCBB 5E65A 2DG4A 2A3BA 1J4RA 2XP7A 5DEZA 4DZ2A 1PINA 1FKHA 4Z2HA 1E6PA 1ROTA 2DSUA 2OWOA 2D9FA 1JNTA 1TCOC 3WIJA 4R5EA 1QZ2A 3WD0A 4DT4A 3AS0A 1SYTA 4G2PA 1WNOA 4Z2GA 2RUDA 1ZCNA 3ARTA 4Z2IA 2F4EA 1FLCA 1TK7A 3KZ7A 4DZ3A 1NWRA 3CGMA 2ZQTA 2WK2A 4J4OA 2KI3A 2DT2A 2FKEA 1HXVA 3ARRA 1BL4A 1WB0A 1EG3A 3ODKA 2M1IA 2JMFA 2M08A 4GLXA 3AS1A 1ZU8A 2IF4A 2LKNA 4IQCA 1JNDA 1LJYA 2RUQA 1FKJA 4QZVB 3IKDA 3PA7A 3TCZA 4DRPA 1RD6A 4J4NA 2B31A 2YSIA 2YSFA 1W9VA 1F40A 3O5FA 2XP4A 1K9QA 3O5EA 2RURA 1E6RA 1KT0A 3W4RA 4FN2A 2N87A 5HWCA 4P8VA 5HW8A 4LAVA 1ROUA 4W5UA 1NMVA 4DROA 2ESCA 4ZS6A 2LGOA 2M8JA 4FAPA 1EYMA 3FAPA 3WD2A 3KABA 4MNMA 4WKHA 1W1VA 1QPFA 1ZBVA 3PR9A 2DJYA 4ODOA 4DRMA 1LL4A 1E6ZA 4E5RA 4QT2A 5J6EA 2JV4A 2OLHA 5HUAA 3IKGA 2AWGA 3ARWA 1XHGA 3UI4A 5I98A 1C9HA 1P5QA 3RFWA 4ODKA 2PV1A 2KO7A 2L2SA 3RM9A 2K8IA 4C02B 2MF9A 2EZ5W 2DPEA 3VAWA 2YAJB 4S3KA 4DRKA 2XP8A 3LUOA 3KAFA 1ZBWA 4ODRA 4Z2JA 4HARA 1W1YA 3WQVA 1FKSA 3O5LA 3JYJA 1D7IA 2F21A 1Y0OA 4G50A 4NNRA 1CTNA 1EDQA 5E62A 3WKZA 4DRJA 3B9AA 2KGJA 1W1TA 1WMVA 2MLZA 3AS3A 2KR7A 4TW8A 1ZK6A 2MLXA 2MNTA 1QPLA 4L3NA 5U47A 2KE0A 2WLZA 5GPGA 1OGBA 4ITZA 2M2AA 2ZR4A 2RUCA 2BA1A 4ODNA 4GGQA 1Q1CA 1NSGA 2XP5A 3AQUA 1NMWA 4WKAA 2DSZA 4DWSA 1D2KA 4DIPA 4P8UA 3ARUA 4DWSC 1IX5A 3KAHA 3IHZA 2G8ZA 4Q22A 2F2DA 3NTPA 1NWTA 1HJXA 4TYOA 4KR0B 4MAVA 2A3CA 1ZBCA 2DT0A 1LL7A 4A0UA 3FSBA 4NZCA 1O6WA 4W9PA 1SR0A 1T11A 2VCDA 1EHNA 2VN1A 3LE4A 3PQHA 1ZL1A 1FFRA 4P8WA 1NWSA 3G6LA 3KCEA 4DRHA 4LAWA 2MPHA 4KQZA 5DITA 5E66A 1HKKA 3ARQA 4HBOA 4ML4A 4BF8A 4JYSA 5HT1A 1H0GA 2XP3A 2JZVA 3PRBA 2DG3A 4GIVA 4LAYA 2OFNA 2JX8A 1W9PA 3PRAA 1GUVA 5D75A 1O6IA 1EQ3A 1KFWA 1NH6A 2QF8A 5HKGA 1OWQA 1OGGA 2DSWA 5GQBA 4QT3A 3ARYA 2A3EA 5BXJA 5DO2A 4TNSA 3M7NA 1E15A 1FKBA 2Y8NB 5E5WA 1ITXA 3KAGA 1FKLA 1R9HA 5HW7A 1I5HW 4IT4A 2MLYA 2PPNA 3QOKA 2YSBA 4WKFA 4REXA 4ZPVR 4LGXA 3ALFA 3O5GA 1FAPA 1PBKA 1FKTA 3ARPA 2RQSA 2PV2A 1W26A 2ITKA 4ZPWR 2E45A 1BKFA 3EY6A 3O5DA 3KAIA 4MTVA 1FKDA 4N19A 2DG9A 3JXVA 2LAJA 2DMVA 3OOBA 1ZBKA 4IQ2A 3RM4A 2FAPA 2AOSA 1EIBA 3B8SA 2ZR5A 4WJXA 3FSCA 2PI6A 2YBUA 3GPKA 1WAWA 2WAEA 3WD1A 4U85A 4TW7A 3LKXB 1HJVA 1X6NA 5HW6A 1F8AB 2XP6A 2ZQUA 1RP5A 2XPBA 5DF0A 3O5PA 4DWSB 3NI6A 3ARVA 3UF8A 3NRKA 3UQAA 3TC5A 1GOIA 3I6CA 4L72B 4ODMA 2WADA 4DH0A 3O5IA 1ZB5A 4JFIA 1W1PA 4Q7NA 4IPXA 1TFVA 3OA5A 1GPFA 4URIA 2RE3A 4W9OA 4WK9A 2M3OW 1J4HA 1JVWA 4MNKA 1A7XA 2L4JA 2A3AA 2DSVA 1LQ0A 2DWVA 1LL6A 3CHCA 4P8XA 2IUZA 1W9UA 4JFLA 1FKGA 4LAXA 1Q6IA 1D7JA 4MPKA 4Z2KA 1J4IA 4PTMA 2O9OA 2ZAJA 5GPRA 3CHEA 2ZQVA 4W9QA 1WR7A 4MNLA 4HBEA 5B8IC 4NSBA 2KXQA 5DIUA 1FFQA 1U79A 3IK8A 5DIVA 3WD4A 1EG4A 3JYMA 3B7XA 4O2TA 3KADA 1FKFA 1KT1A 1YW5A 4MGVA 3MQGA 2DT1A 4U84A 1H0IA 1Q6HA 3UQBA 5HTGA 2YSGA 3WD3A 4ODLA 3MDYB 3O5JA 2DK7A 1FKRA 3TDBA 3O5KA 2PBCA 3MCBA 2KFWA 1E9LA 4IT6A 3CGNA 1D7HA 2FDMA 4ZPTR 3RM8A 4DWSD 2ZR6A 2G41A 4DRNA 5HBFA 4TW6A 3CH9A 4ODQA 1LG2A 4QIBA 2WM0A 4DRIA 1D6OA 3L4HA 3UI5A 1UR9A 3UI6A 3CNGA 3MQHA 3O5MA 1FKKA 1VF8A 3O5RA 1L1PA 1UR8A 3RMEA 1JNEA 2YBTA 4U86A 2XPAA 1XRVA 3CHDA 1J6YA 3ARXA 3CHFA 5E64A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1F8A B;  2XP6 A;  2ZQU A;  2ZQT A;  1NMW A;  3CGM A;  4JFL A;  4J4O A;  2XPB A;  2KI3 A;  2FKE A;  1HXV A;  1BL4 A;  3O5P A;  4DIP A;  1EG3 A;  3ODK A;  2M1I A;  2JMF A;  3KAH A;  3IHZ A;  3NI6 A;  2M8I A;  2F2D A;  3UF8 A;  3NTP A;  3NRK A;  2M08 A;  3UQA A;  3TC5 A;  3I6C A;  4JFK A;  4ODM A;  2IF4 A;  2LKN A;  4IQC A;  4TYO A;  4TX0 A;  4DH0 A;  5CQ2 A;  2LJ4 A;  3O5I A;  1FJD A;  4JFI A;  1YAT A;  2RUQ A;  1FKJ A;  3IKD A;  3PA7 A;  3TCZ A;  4IPX A;  4DRP A;  4J4N A;  1O6W A;  2YSI A;  2YSF A;  4W9P A;  2RE3 A;  1T11 A;  2VCD A;  1F40 A;  2VN1 A;  3O5F A;  2XP4 A;  4W9O A;  3LE4 A;  2MDI A;  2M3O W;  1JMQ A;  1J4H A;  1JVW A;  1K9Q A;  3O5E A;  2RUR A;  2PPP A;  2PV3 A;  3KCE A;  4DRH A;  4LAW A;  2MPH A;  1A7X A;  1KT0 A;  2L4J A;  3O5Q A;  1M5Y A;  2N87 A;  2LPV A;  4FN2 A;  5DIT A;  5HWC A;  2DWV A;  5HW8 A;  1B6C A;  4R0X A;  1Q6U A;  4BF8 A;  4JYS A;  5HT1 A;  1ROU A;  2XP3 A;  2JZV A;  3PRB A;  2XP9 A;  1N1A A;  2DG3 A;  2Q5A A;  1NMV A;  2JX8 A;  1FKG A;  1Q6I A;  1D7J A;  2OFN A;  4LAX A;  5D75 A;  4DRO A;  1EQ3 A;  1J4I A;  2JXW A;  5HKG A;  2LGO A;  2M8J A;  4FAP A;  4QT3 A;  3PRD A;  2ZAJ A;  1EYM A;  3FAP A;  3KAC A;  2ZQV A;  3KAB A;  5BXJ A;  2RSE A;  4JFJ A;  1FKI A;  1WR7 A;  1QPF A;  4W9Q A;  3WH0 A;  3UI5 A;  5B8I C;  2DJY A;  4ODO A;  4TNS A;  3M7N A;  2KXQ A;  1FKB A;  3M85 A;  4DRM A;  5DIU A;  4E5R A;  4MSP A;  4QT2 A;  5J6E A;  2JV4 A;  1U79 A;  2DK1 A;  3IK8 A;  5DIV A;  3KAG A;  1FKL A;  3IKG A;  5HUA A;  1EG4 A;  1R9H A;  1K9R A;  5HW7 A;  1I5H W;  2AWG A;  3B7X A;  3JYM A;  3KAD A;  4O2T A;  4DRQ A;  2MLY A;  1FKF A;  2PPN A;  1KT1 A;  1YW5 A;  4MGV A;  3UI4 A;  1JNS A;  2YSB A;  4U84 A;  5I98 A;  1C9H A;  1P5Q A;  4REX A;  3RFW A;  1Q6H A;  2PV1 A;  2KO7 A;  4ODK A;  2L2S A;  3O5G A;  1FAP A;  2ZQS A;  3RGC A;  5AHT A;  2K8I A;  1PBK A;  4C02 B;  2MF9 A;  5HWB A;  1FKT A;  3UQB A;  2RQS A;  2EZ5 W;  2YSG A;  2PV2 A;  2YSH A;  3VAW A;  5HTG A;  3H9R B;  1W26 A;  4JFM A;  4ODL A;  4DZ3 A;  3MDY B;  3O5J A;  1FD9 A;  2DK7 A;  2ITK A;  4DRK A;  2XP8 A;  3LUO A;  3KAF A;  4ODR A;  1FKR A;  3TDB A;  2UZ5 A;  3O5K A;  2PPO A;  2E45 A;  2PBC A;  4LAY A;  1BKF A;  1FKS A;  3O5L A;  3EY6 A;  3O5D A;  2Y78 A;  2KFW A;  4ODP A;  3UQI A;  3KAI A;  3CGN A;  1D7H A;  3O5O A;  1FKD A;  2ZR6 A;  2DG9 A;  2DG4 A;  3JXV A;  2LAJ A;  3JYJ A;  4N19 A;  1D7I A;  2F21 A;  1Y0O A;  4G50 A;  4NNR A;  4DRN A;  2DMV A;  4ODQ A;  4TW6 A;  3OOB A;  4QIB A;  4IQ2 A;  4DRI A;  1J4R A;  1D6O A;  4DRJ A;  2KGJ A;  2XP7 A;  4DZ2 A;  1WMV A;  1PIN A;  3L4H A;  1TK7 A;  1FKH A;  2KR7 A;  2MLZ A;  4GIV A;  1ROT A;  1ZK6 A;  2FAP A;  2MLX A;  4TW8 A;  2D9F A;  2MNT A;  3UI6 A;  3CNG A;  3O5M A;  1QPL A;  1JNT A;  1TCO C;  1FKK A;  3O5R A;  2KE0 A;  5GPG A;  1L1P A;  2ZR5 A;  1QZ2 A;  4ITZ A;  4DT4 A;  2M2A A;  2ZR4 A;  2RUC A;  3GPK A;  4G2P A;  4U86 A;  2XPA A;  2BA1 A;  4U85 A;  4ODN A;  4TW7 A;  2RUD A;  1ZCN A;  4GGQ A;  1Q1C A;  1NSG A;  1J6Y A;  2F4E A;  2XP5 A;  3KZ7 A;  4LAV A;  5HW6 A; 
#chains in the Genus database with same CATH topology
 1K9T A;  1E44 A;  2QRV A;  3WL0 A;  3FXY A;  2M8I A;  1X6L A;  4JFK A;  4WIW A;  4TX0 A;  5CQ2 A;  2LJ4 A;  1FJD A;  1YAT A;  3FS8 A;  4MNJ A;  3AS2 A;  3ARZ A;  4S3J A;  2P4V A;  3GTY X;  4XAK A;  3BXW A;  4A0T A;  4Z2L A;  2MDI A;  1JMQ A;  3ARO A;  3WQW A;  1HKI A;  3G6M A;  2PPP A;  2PV3 A;  3O5Q A;  1M5Y A;  2LPV A;  1B6C A;  4R0X A;  1Q6U A;  3B9E A;  3CZ8 A;  2XP9 A;  1N1A A;  3LKX A;  2Q5A A;  2F23 A;  2JXW A;  3ALG A;  2B5U B;  1TR8 A;  3PRD A;  3KAC A;  2RSE A;  4JFJ A;  1FKI A;  5JH8 A;  3WH0 A;  2O92 A;  3M85 A;  4MSP A;  2DK1 A;  1NWU A;  4AY1 A;  1K9R A;  4DRQ A;  2EUL A;  1LG1 A;  1JNS A;  2ZQS A;  3ARS A;  3RGC A;  5AHT A;  2WLY A;  3B9D A;  5HWB A;  2YSH A;  3H9R B;  4JFM A;  1HJW A;  3FY1 A;  1FD9 A;  1HKM A;  2UZ5 A;  2DT3 A;  2PPO A;  1E6N A;  1HKJ A;  2Y78 A;  4ODP A;  3UQI A;  3WL1 A;  3O5O A;  3MCB B;  5E65 A;  2DG4 A;  2A3B A;  1J4R A;  2XP7 A;  5DEZ A;  4DZ2 A;  1PIN A;  1FKH A;  4Z2H A;  1E6P A;  1ROT A;  2DSU A;  2OWO A;  2D9F A;  1JNT A;  1TCO C;  3WIJ A;  4R5E A;  1QZ2 A;  3WD0 A;  4DT4 A;  1SYT A;  3AS0 A;  4G2P A;  1WNO A;  4Z2G A;  2RUD A;  1ZCN A;  3ART A;  4Z2I A;  2F4E A;  1FLC A;  1TK7 A;  3KZ7 A;  4DZ3 A;  1NWR A;  3CGM A;  2ZQT A;  2WK2 A;  4J4O A;  2KI3 A;  2DT2 A;  2FKE A;  1HXV A;  3ARR A;  1BL4 A;  1WB0 A;  1EG3 A;  3ODK A;  2M1I A;  2JMF A;  2M08 A;  4GLX A;  3AS1 A;  1ZU8 A;  2IF4 A;  2LKN A;  4IQC A;  1JND A;  1LJY A;  2RUQ A;  1FKJ A;  4QZV B;  3IKD A;  3PA7 A;  3TCZ A;  4DRP A;  1RD6 A;  4J4N A;  2B31 A;  2YSI A;  2YSF A;  1W9V A;  1F40 A;  3O5F A;  2XP4 A;  1K9Q A;  3O5E A;  2RUR A;  1E6R A;  1KT0 A;  3W4R A;  4FN2 A;  2N87 A;  5HWC A;  4P8V A;  5HW8 A;  4LAV A;  1ROU A;  4W5U A;  1NMV A;  4DRO A;  2ESC A;  4ZS6 A;  2LGO A;  2M8J A;  4FAP A;  1EYM A;  3FAP A;  3WD2 A;  3KAB A;  4MNM A;  4WKH A;  1W1V A;  1QPF A;  1ZBV A;  3PR9 A;  2DJY A;  4ODO A;  4DRM A;  1LL4 A;  1E6Z A;  4E5R A;  4QT2 A;  5J6E A;  2JV4 A;  2OLH A;  5HUA A;  3IKG A;  2AWG A;  3ARW A;  1XHG A;  3UI4 A;  5I98 A;  1C9H A;  1P5Q A;  3RFW A;  4ODK A;  2PV1 A;  2KO7 A;  2L2S A;  3RM9 A;  2K8I A;  4C02 B;  2MF9 A;  2EZ5 W;  2DPE A;  3VAW A;  2YAJ B;  4S3K A;  4DRK A;  2XP8 A;  3LUO A;  3KAF A;  1ZBW A;  4ODR A;  4Z2J A;  4HAR A;  1W1Y A;  3WQV A;  1FKS A;  3O5L A;  3JYJ A;  1D7I A;  2F21 A;  1Y0O A;  4G50 A;  4NNR A;  1CTN A;  1EDQ A;  5E62 A;  3WKZ A;  4DRJ A;  3B9A A;  2KGJ A;  1W1T A;  1WMV A;  2MLZ A;  2KR7 A;  3AS3 A;  4TW8 A;  1ZK6 A;  2MLX A;  2MNT A;  1QPL A;  4L3N A;  5U47 A;  2KE0 A;  2WLZ A;  5GPG A;  1OGB A;  4ITZ A;  2M2A A;  2ZR4 A;  2RUC A;  2BA1 A;  4ODN A;  4GGQ A;  1Q1C A;  1NSG A;  2XP5 A;  3AQU A;  1NMW A;  1GRJ A;  4WKA A;  2DSZ A;  4DWS A;  1D2K A;  4DIP A;  4P8U A;  3ARU A;  4DWS C;  1IX5 A;  3KAH A;  3IHZ A;  2G8Z A;  4Q22 A;  2F2D A;  3NTP A;  1NWT A;  1HJX A;  4TYO A;  4KR0 B;  4MAV A;  2A3C A;  1ZBC A;  2DT0 A;  1LL7 A;  4A0U A;  3FSB A;  4NZC A;  1O6W A;  4W9P A;  1SR0 A;  1T11 A;  2VCD A;  1EHN A;  2VN1 A;  3LE4 A;  3PQH A;  1ZL1 A;  1FFR A;  4P8W A;  1NWS A;  3G6L A;  3KCE A;  4DRH A;  4LAW A;  2MPH A;  4KQZ A;  5DIT A;  5E66 A;  1HKK A;  3ARQ A;  4HBO A;  4ML4 A;  4BF8 A;  4JYS A;  5HT1 A;  1H0G A;  2XP3 A;  2JZV A;  3PRB A;  2DG3 A;  4GIV A;  4LAY A;  2OFN A;  2JX8 A;  1W9P A;  3PRA A;  1GUV A;  5D75 A;  1O6I A;  1EQ3 A;  1KFW A;  1NH6 A;  2QF8 A;  5HKG A;  1OWQ A;  1OGG A;  2DSW A;  5GQB A;  4QT3 A;  3ARY A;  2A3E A;  5BXJ A;  5DO2 A;  4TNS A;  3M7N A;  1E15 A;  1FKB A;  2Y8N B;  5E5W A;  1ITX A;  3KAG A;  2PN0 A;  1FKL A;  1R9H A;  5HW7 A;  1I5H W;  4IT4 A;  2MLY A;  2PPN A;  3QOK A;  2YSB A;  4WKF A;  4REX A;  4ZPV R;  4LGX A;  3ALF A;  3O5G A;  1FAP A;  1PBK A;  1FKT A;  3ARP A;  2RQS A;  2PV2 A;  1W26 A;  2ITK A;  4ZPW R;  2E45 A;  1BKF A;  3EY6 A;  3O5D A;  3KAI A;  4MTV A;  1FKD A;  4N19 A;  2DG9 A;  3JXV A;  2LAJ A;  2DMV A;  3OOB A;  1ZBK A;  4IQ2 A;  3RM4 A;  2FAP A;  2AOS A;  1EIB A;  3B8S A;  2ZR5 A;  4WJX A;  3FSC A;  2PI6 A;  2YBU A;  3GPK A;  1WAW A;  2WAE A;  3WD1 A;  4U85 A;  4TW7 A;  3LKX B;  1HJV A;  1X6N A;  5HW6 A;  1F8A B;  2XP6 A;  2ZQU A;  1RP5 A;  2XPB A;  5DF0 A;  3O5P A;  4DWS B;  3BMB A;  3NI6 A;  3ARV A;  3UF8 A;  3NRK A;  3UQA A;  3TC5 A;  1GOI A;  3I6C A;  4L72 B;  4ODM A;  2WAD A;  4DH0 A;  3O5I A;  1ZB5 A;  4JFI A;  1W1P A;  4Q7N A;  4IPX A;  1TFV A;  3OA5 A;  1GPF A;  4URI A;  2RE3 A;  4W9O A;  4WK9 A;  2M3O W;  1J4H A;  1JVW A;  4MNK A;  4UDM A;  1A7X A;  3EIP A;  2L4J A;  2A3A A;  2DSV A;  1LQ0 A;  2DWV A;  1LL6 A;  3CHC A;  4P8X A;  2IUZ A;  1W9U A;  4JFL A;  1FKG A;  4LAX A;  1Q6I A;  1D7J A;  4MPK A;  4Z2K A;  2ETN A;  1J4I A;  4PTM A;  2O9O A;  2ZAJ A;  5GPR A;  3CHE A;  2ZQV A;  4W9Q A;  1WR7 A;  4MNL A;  4HBE A;  5B8I C;  4NSB A;  2KXQ A;  5DIU A;  1FFQ A;  1U79 A;  3IK8 A;  5DIV A;  3WD4 A;  1EG4 A;  3JYM A;  3B7X A;  4O2T A;  3KAD A;  1FKF A;  1KT1 A;  1YW5 A;  4MGV A;  3MQG A;  2DT1 A;  4U84 A;  1H0I A;  1Q6H A;  3UQB A;  5HTG A;  1JCH B;  2YSG A;  3WD3 A;  4ODL A;  3MDY B;  3O5J A;  2DK7 A;  1FKR A;  3TDB A;  3O5K A;  2PBC A;  3MCB A;  2KFW A;  1E9L A;  4IT6 A;  3CGN A;  1D7H A;  2FDM A;  4ZPT R;  3RM8 A;  4DWS D;  2ZR6 A;  2G41 A;  4DRN A;  5HBF A;  4TW6 A;  3CH9 A;  4ODQ A;  1LG2 A;  4QIB A;  2WM0 A;  4DRI A;  1D6O A;  3L4H A;  3UI5 A;  3GU0 A;  1UR9 A;  3UI6 A;  3CNG A;  3MQH A;  3O5M A;  1FKK A;  1VF8 A;  3O5R A;  1L1P A;  1UR8 A;  3RME A;  1JNE A;  2YBT A;  4U86 A;  2XPA A;  1XRV A;  3CHD A;  1J6Y A;  3ARX A;  3CHF A;  5E64 A; 
#chains in the Genus database with same CATH homology
 1K9T A;  2QRV A;  3WL0 A;  3FXY A;  2M8I A;  1X6L A;  4JFK A;  4WIW A;  4TX0 A;  5CQ2 A;  2LJ4 A;  1FJD A;  1YAT A;  3FS8 A;  4MNJ A;  3AS2 A;  3ARZ A;  4S3J A;  4XAK A;  3BXW A;  4A0T A;  4Z2L A;  2MDI A;  1JMQ A;  3ARO A;  3WQW A;  1HKI A;  3G6M A;  2PPP A;  2PV3 A;  3O5Q A;  1M5Y A;  2LPV A;  1B6C A;  4R0X A;  1Q6U A;  3B9E A;  3CZ8 A;  2XP9 A;  1N1A A;  3LKX A;  2Q5A A;  2JXW A;  3ALG A;  1TR8 A;  3PRD A;  3KAC A;  2RSE A;  4JFJ A;  1FKI A;  5JH8 A;  3WH0 A;  2O92 A;  3M85 A;  4MSP A;  2DK1 A;  1NWU A;  4AY1 A;  1K9R A;  4DRQ A;  1LG1 A;  1JNS A;  2ZQS A;  3ARS A;  3RGC A;  5AHT A;  2WLY A;  3B9D A;  5HWB A;  2YSH A;  3H9R B;  4JFM A;  1HJW A;  3FY1 A;  1FD9 A;  1HKM A;  2UZ5 A;  2DT3 A;  2PPO A;  1E6N A;  1HKJ A;  2Y78 A;  4ODP A;  3UQI A;  3WL1 A;  3O5O A;  3MCB B;  5E65 A;  2DG4 A;  2A3B A;  1J4R A;  2XP7 A;  5DEZ A;  4DZ2 A;  1PIN A;  1FKH A;  4Z2H A;  1E6P A;  1ROT A;  2DSU A;  2OWO A;  2D9F A;  1JNT A;  1TCO C;  3WIJ A;  4R5E A;  1QZ2 A;  3WD0 A;  4DT4 A;  3AS0 A;  1SYT A;  4G2P A;  1WNO A;  4Z2G A;  2RUD A;  1ZCN A;  3ART A;  4Z2I A;  2F4E A;  1FLC A;  1TK7 A;  3KZ7 A;  4DZ3 A;  1NWR A;  3CGM A;  2ZQT A;  2WK2 A;  4J4O A;  2KI3 A;  2DT2 A;  2FKE A;  1HXV A;  3ARR A;  1BL4 A;  1WB0 A;  1EG3 A;  3ODK A;  2M1I A;  2JMF A;  2M08 A;  4GLX A;  3AS1 A;  1ZU8 A;  2IF4 A;  2LKN A;  4IQC A;  1JND A;  1LJY A;  2RUQ A;  1FKJ A;  4QZV B;  3IKD A;  3PA7 A;  3TCZ A;  4DRP A;  1RD6 A;  4J4N A;  2B31 A;  2YSI A;  2YSF A;  1W9V A;  1F40 A;  3O5F A;  2XP4 A;  1K9Q A;  3O5E A;  2RUR A;  1E6R A;  1KT0 A;  3W4R A;  4FN2 A;  2N87 A;  5HWC A;  4P8V A;  5HW8 A;  4LAV A;  1ROU A;  4W5U A;  1NMV A;  4DRO A;  2ESC A;  4ZS6 A;  2LGO A;  2M8J A;  4FAP A;  1EYM A;  3FAP A;  3WD2 A;  3KAB A;  4MNM A;  4WKH A;  1W1V A;  1QPF A;  1ZBV A;  3PR9 A;  2DJY A;  4ODO A;  4DRM A;  1LL4 A;  1E6Z A;  4E5R A;  4QT2 A;  5J6E A;  2JV4 A;  2OLH A;  5HUA A;  3IKG A;  2AWG A;  3ARW A;  1XHG A;  3UI4 A;  5I98 A;  1C9H A;  1P5Q A;  3RFW A;  4ODK A;  2PV1 A;  2KO7 A;  2L2S A;  3RM9 A;  2K8I A;  4C02 B;  2MF9 A;  2EZ5 W;  2DPE A;  3VAW A;  2YAJ B;  4S3K A;  4DRK A;  2XP8 A;  3LUO A;  3KAF A;  1ZBW A;  4ODR A;  4Z2J A;  4HAR A;  1W1Y A;  3WQV A;  1FKS A;  3O5L A;  3JYJ A;  1D7I A;  2F21 A;  1Y0O A;  4G50 A;  4NNR A;  1CTN A;  1EDQ A;  5E62 A;  3WKZ A;  4DRJ A;  3B9A A;  2KGJ A;  1W1T A;  1WMV A;  2MLZ A;  3AS3 A;  2KR7 A;  4TW8 A;  1ZK6 A;  2MLX A;  2MNT A;  1QPL A;  4L3N A;  5U47 A;  2KE0 A;  2WLZ A;  5GPG A;  1OGB A;  4ITZ A;  2M2A A;  2ZR4 A;  2RUC A;  2BA1 A;  4ODN A;  4GGQ A;  1Q1C A;  1NSG A;  2XP5 A;  3AQU A;  1NMW A;  4WKA A;  2DSZ A;  4DWS A;  1D2K A;  4DIP A;  4P8U A;  3ARU A;  4DWS C;  1IX5 A;  3KAH A;  3IHZ A;  2G8Z A;  4Q22 A;  2F2D A;  3NTP A;  1NWT A;  1HJX A;  4TYO A;  4KR0 B;  4MAV A;  2A3C A;  1ZBC A;  2DT0 A;  1LL7 A;  4A0U A;  3FSB A;  4NZC A;  1O6W A;  4W9P A;  1SR0 A;  1T11 A;  2VCD A;  1EHN A;  2VN1 A;  3LE4 A;  3PQH A;  1ZL1 A;  1FFR A;  4P8W A;  1NWS A;  3G6L A;  3KCE A;  4DRH A;  4LAW A;  2MPH A;  4KQZ A;  5DIT A;  5E66 A;  1HKK A;  3ARQ A;  4HBO A;  4ML4 A;  4BF8 A;  4JYS A;  5HT1 A;  1H0G A;  2XP3 A;  2JZV A;  3PRB A;  2DG3 A;  4GIV A;  4LAY A;  2OFN A;  2JX8 A;  1W9P A;  3PRA A;  1GUV A;  5D75 A;  1O6I A;  1EQ3 A;  1KFW A;  1NH6 A;  2QF8 A;  5HKG A;  1OWQ A;  1OGG A;  2DSW A;  5GQB A;  4QT3 A;  3ARY A;  2A3E A;  5BXJ A;  5DO2 A;  4TNS A;  3M7N A;  1E15 A;  1FKB A;  2Y8N B;  5E5W A;  1ITX A;  3KAG A;  1FKL A;  1R9H A;  5HW7 A;  1I5H W;  4IT4 A;  2MLY A;  2PPN A;  3QOK A;  2YSB A;  4WKF A;  4REX A;  4ZPV R;  4LGX A;  3ALF A;  3O5G A;  1FAP A;  1PBK A;  1FKT A;  3ARP A;  2RQS A;  2PV2 A;  1W26 A;  2ITK A;  4ZPW R;  2E45 A;  1BKF A;  3EY6 A;  3O5D A;  3KAI A;  4MTV A;  1FKD A;  4N19 A;  2DG9 A;  3JXV A;  2LAJ A;  2DMV A;  3OOB A;  1ZBK A;  4IQ2 A;  3RM4 A;  2FAP A;  2AOS A;  1EIB A;  3B8S A;  2ZR5 A;  4WJX A;  3FSC A;  2PI6 A;  2YBU A;  3GPK A;  1WAW A;  2WAE A;  3WD1 A;  4U85 A;  4TW7 A;  3LKX B;  1HJV A;  1X6N A;  5HW6 A;  1F8A B;  2XP6 A;  2ZQU A;  1RP5 A;  2XPB A;  5DF0 A;  3O5P A;  4DWS B;  3NI6 A;  3ARV A;  3UF8 A;  3NRK A;  3UQA A;  3TC5 A;  1GOI A;  3I6C A;  4L72 B;  4ODM A;  2WAD A;  4DH0 A;  3O5I A;  1ZB5 A;  4JFI A;  1W1P A;  4Q7N A;  4IPX A;  1TFV A;  3OA5 A;  1GPF A;  4URI A;  2RE3 A;  4W9O A;  4WK9 A;  2M3O W;  1J4H A;  1JVW A;  4MNK A;  1A7X A;  2L4J A;  2A3A A;  2DSV A;  1LQ0 A;  2DWV A;  1LL6 A;  3CHC A;  4P8X A;  2IUZ A;  1W9U A;  4JFL A;  1FKG A;  4LAX A;  1Q6I A;  1D7J A;  4MPK A;  4Z2K A;  1J4I A;  4PTM A;  2O9O A;  2ZAJ A;  5GPR A;  3CHE A;  2ZQV A;  4W9Q A;  1WR7 A;  4MNL A;  4HBE A;  5B8I C;  4NSB A;  2KXQ A;  5DIU A;  1FFQ A;  1U79 A;  3IK8 A;  5DIV A;  3WD4 A;  1EG4 A;  3JYM A;  3B7X A;  4O2T A;  3KAD A;  1FKF A;  1KT1 A;  1YW5 A;  4MGV A;  3MQG A;  2DT1 A;  4U84 A;  1H0I A;  1Q6H A;  3UQB A;  5HTG A;  2YSG A;  3WD3 A;  4ODL A;  3MDY B;  3O5J A;  2DK7 A;  1FKR A;  3TDB A;  3O5K A;  2PBC A;  3MCB A;  2KFW A;  1E9L A;  4IT6 A;  3CGN A;  1D7H A;  2FDM A;  4ZPT R;  3RM8 A;  4DWS D;  2ZR6 A;  2G41 A;  4DRN A;  5HBF A;  4TW6 A;  3CH9 A;  4ODQ A;  1LG2 A;  4QIB A;  2WM0 A;  4DRI A;  1D6O A;  3L4H A;  3UI5 A;  1UR9 A;  3UI6 A;  3CNG A;  3MQH A;  3O5M A;  1FKK A;  1VF8 A;  3O5R A;  1L1P A;  1UR8 A;  3RME A;  1JNE A;  2YBT A;  4U86 A;  2XPA A;  1XRV A;  3CHD A;  1J6Y A;  3ARX A;  3CHF A;  5E64 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...