2ZR6A

Crystal structure of a mutant pin1 peptidyl-prolyl cis-trans isomerase
Total Genus 39
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
39
sequence length
158
structure length
153
Chain Sequence
KLPPGWEKAMSRSSGRVYYFNHITNASQWERPSGGKNGQGEPARVRCSHLLVKHSQSRRPSSWRQEKITRTKEEALELINGYIQKIKSGEEDFESLASQFSDCSSAKARGDLGAFSRGQMQKPFEDASFALRTGEMSGPVFTDSGIHIILRTE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Peptidyl-prolyl cis-trans isomerase NIMA-interacting 1
publication title Structural studies on PIN1 mutants
rcsb
source organism Homo sapiens
molecule tags Isomerase
total genus 39
structure length 153
sequence length 158
ec nomenclature ec 5.2.1.8: Peptidylprolyl isomerase.
pdb deposition date 2008-08-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00397 WW WW domain
A PF00639 Rotamase PPIC-type PPIASE domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.20.70.10 Mainly Beta Single Sheet Ubiquitin Ligase Nedd4; Chain: W; Ubiquitin Ligase Nedd4; Chain: W; 2zr6A01
3.10.50.40 Alpha Beta Roll Chitinase A; domain 3 Chitinase A; domain 3 2zr6A02
2XP4A 3CNGA 5HW6A 1EG4A 4LAWA 2JX8A 3O5FA 3KAIA 4G2PA 4IPXA 3JXVA 1JNTA 2L4JA 4ODKA 1EG3A 2LGOA 3TC5A 4LAYA 2PPNA 4TW6A 2PV1A 4DRIA 5CQ2A 4O2TA 1N1AA 4TW8A 1PBKA 2MLYA 4JFJA 1QZ2A 2XPAA 4MSPA 3O5IA 1WR7A 4ODNA 4W9QA 1FKKA 1M5YA 1J6YA 1I5HW 3PRBA 4MGVA 2ZQVA 3JYJA 3IKDA 3TCZA 2DJYA 3UI4A 3OOBA 2YSHA 4U85A 1T11A 1FKBA 3CGMA 3UQIA 3LUOA 2M8JA 2XPBA 3RFWA 4QIBA 2M8IA 4TYOA 4GGQA 5HTGA 1KT1A 4REXA 5HWBA 4W9OA 1JVWA 3O5PA 5DIVA 2E45A 1B6CA 5BXJA 4J4OA 2JMFA 4JFKA 1D6OA 2MLZA 1NMWA 4TX0A 4LAVA 3I6CA 3KABA 3PA7A 2YSBA 3O5QA 1BL4A 4IQ2A 1F8AB 2XP9A 3B7XA 1ROTA 1JNSA 2ZR4A 3LE4A 1YW5A 4DIPA 2VN1A 2YSGA 1W26A 5HUAA 2AWGA 2XP8A 2PPOA 2F2DA 3IHZA 1J4RA 3GPKA 4DZ3A 1F40A 2DG3A 4JFIA 4NNRA 5HW8A 1L1PA 2RE3A 4ODQA 2ZQUA 1P5QA 4FN2A 4N19A 2ZQTA 5J6EA 2LKNA 2KFWA 2VCDA 2DK7A 1D7IA 1Q6UA 3IK8A 2RQSA 1D7HA 3O5LA 2JXWA 2KE0A 2MDIA 4DROA 4JFMA 3NI6A 3M85A 5B8IC 5GPGA 3L4HA 1O6WA 2F21A 4JFLA 1FKDA 3KACA 2D9FA 2KXQA 3O5RA 3KCEA 2ITKA 2XP3A 2RUQA 5HKGA 1Y0OA 2FKEA 2BA1A 2KGJA 2M2AA 2KI3A 2LJ4A 4TNSA 2DMVA 3FAPA 3IKGA 1FJDA 1JMQA 5DIUA 1QPLA 2M08A 1FKLA 3O5JA 2Q5AA 3M7NA 3CGNA 4DRMA 2MNTA 2DG9A 4QT2A 3RGCA 4DH0A 4GIVA 4ODLA 1FKHA 4ODOA 3EY6A 5D75A 2LAJA 1J4IA 3O5GA 2Y78A 5HT1A 2ZQSA 1ZCNA 1ZK6A 4E5RA 2N87A 3O5KA 4TW7A 3UI5A 5AHTA 1TCOC 3O5EA 1K9QA 2LPVA 2RUDA 2FAPA 1Q6HA 4DRNA 2DG4A 3KAFA 1FKTA 5DITA 1FKRA 1FD9A 2K8IA 2L2SA 1NMVA 2JV4A 4DRHA 1YATA 4U86A 5I98A 2ZR6A 3UQAA 4DT4A 2PBCA 1NSGA 3JYMA 3MDYB 4IQCA 2MF9A 4ITZA 3NRKA 2XP7A 3KAGA 2ZAJA 2M1IA 2M3OW 2RURA 1D7JA 4DZ2A 3O5OA 3VAWA 1EYMA 1ROUA 4G50A 1K9RA 2KR7A 1BKFA 2UZ5A 3WH0A 2PV3A 4DRQA 4R0XA 2XP6A 4W9PA 3O5DA 1J4HA 1FKSA 1EQ3A 3ODKA 2RUCA 1FKGA 2RSEA 2ZR5A 1WMVA 2PPPA 4DRJA 4U84A 1C9HA 4QT3A 2MPHA 1TK7A 1U79A 1R9HA 4DRPA 1HXVA 4ODRA 2JZVA 1PINA 4C02B 1FKJA 4ODPA 4ODMA 2EZ5W 3KZ7A 3KADA 4J4NA 2XP5A 4JYSA 1FKIA 3KAHA 2MLXA 3NTPA 2DWVA 3PRDA 1KT0A 2KO7A 3UF8A 4LAXA 2YSIA 1FKFA 4BF8A 2IF4A 2DK1A 4FAPA 5HW7A 1Q1CA 2PV2A 3UQBA 1FAPA 3H9RB 4DRKA 3TDBA 2OFNA 3O5MA 1Q6IA 1A7XA 5HWCA 1QPFA 2YSFA 2F4EA 3UI6A
chains in the Genus database with same CATH superfamily
2XP4A 3AROA 4P8XA 2YAJB 4MPKA 3CNGA 1E6ZA 5E62A 5HW6A 1EG4A 3B9AA 4LAWA 2JX8A 3OA5A 3O5FA 5HBFA 3KAIA 1XHGA 4G2PA 4IPXA 3B9EA 1E9LA 3JXVA 1JNTA 2L4JA 4ODKA 4Q7NA 2P4VA 3CHFA 3PR9A 4S3JA 1EG3A 1H0GA 4KR0B 4DWSD 2LGOA 3TC5A 4LAYA 2PPNA 4TW6A 1ZBVA 2PV1A 3GU0A 4DRIA 5CQ2A 4O2TA 1N1AA 4TW8A 1PBKA 2MLYA 4JFJA 1QZ2A 2XPAA 1VF8A 3FS8A 3AS3A 4MSPA 3O5IA 3WIJA 3ARQA 1WR7A 4ODNA 4W9QA 1FKKA 1M5YA 4ZPWR 2B5UB 1J6YA 1I5HW 1W9UA 3PRBA 4MGVA 2ZQVA 3JYJA 3IKDA 1HKJA 3ARXA 4MAVA 3TCZA 4AY1A 1OGGA 2DSUA 2DJYA 3UI4A 4DWSB 4UDMA 3OOBA 2YSHA 4U85A 4Z2KA 1SR0A 1T11A 1FKBA 1OWQA 1UR9A 3CGMA 3CHEA 3AS0A 3UQIA 3LUOA 1WB0A 2M8JA 2DT2A 2XPBA 3RFWA 4QIBA 2M8IA 2DT0A 4TYOA 4GGQA 5HTGA 2O9OA 2DT1A 1KT1A 4REXA 5DEZA 5HWBA 1IX5A 3EIPA 2O92A 4W9OA 4PTMA 1K9TA 1JVWA 4Z2LA 3O5PA 4HBEA 1FLCA 5DIVA 2E45A 1B6CA 4MTVA 5BXJA 1W1PA 3G6LA 4J4OA 1LJYA 2JMFA 4JFKA 1D6OA 2MLZA 2DSZA 1NMWA 3CH9A 4LAVA 1JCHB 4TX0A 1FFRA 3I6CA 3KABA 3PA7A 4WJXA 2A3EA 2YSBA 1CTNA 3O5QA 1WAWA 1BL4A 4IQ2A 4A0TA 4ZPTR 1F8AB 2XP9A 2DSVA 4HBOA 4IT4A 3B7XA 1JNDA 2Y8NB 1ROTA 1JNSA 2ZR4A 4XAKA 3LE4A 1YW5A 4DIPA 2VN1A 2YSGA 1W26A 3WL0A 5HUAA 2AWGA 2XP8A 2PPOA 2F2DA 3IHZA 1J4RA 4R5EA 5JH8A 3GPKA 4DZ3A 1F40A 5DO2A 4Z2IA 2DG3A 4JFIA 4NNRA 3MCBB 5HW8A 5E5WA 1RP5A 5E66A 1L1PA 1LL6A 2RE3A 3G6MA 4ODQA 2ZQUA 1P5QA 4FN2A 4L3NA 2WLZA 4N19A 1RD6A 2ZQTA 5J6EA 1NWSA 2LKNA 3FSBA 2KFWA 1JNEA 2VCDA 2DK7A 1D7IA 4MNMA 1Q6UA 3IK8A 2RQSA 2WM0A 3AS1A 1W9PA 3BXWA 1D7HA 1H0IA 3O5LA 2JXWA 2KE0A 2MDIA 4DROA 4JFMA 4GLXA 1GRJA 5GQBA 3NI6A 3FSCA 2EULA 1LG1A 3M85A 5B8IC 5GPGA 4IT6A 3L4HA 4HARA 4ZS6A 2G8ZA 4WK9A 3FXYA 5DF0A 4URIA 1O6WA 2F21A 1NH6A 4JFLA 5U47A 1FKDA 3KACA 2D9FA 2KXQA 3O5RA 3KCEA 3ARUA 2ITKA 2XP3A 2RUQA 4P8VA 5HKGA 1Y0OA 2WLYA 1E6RA 3MQGA 1TFVA 3AS2A 3ARPA 2FKEA 2BA1A 2KGJA 2M2AA 3ARVA 4L72B 2KI3A 2B31A 2WADA 2LJ4A 1EHNA 2DMVA 4TNSA 3FAPA 3IKGA 1EIBA 1JMQA 5DIUA 1FJDA 3RM8A 3ARTA 1QPLA 2M08A 1HKIA 1FKLA 3O5JA 2Q5AA 1W9VA 3M7NA 3CGNA 2QF8A 4Q22A 4DRMA 2MNTA 2DG9A 4QT2A 4MNJA 3RGCA 4DH0A 1WNOA 4GIVA 4ODLA 4MNLA 1UR8A 3QOKA 1FKHA 4ODOA 2A3AA 3EY6A 5D75A 2LAJA 1J4IA 1GPFA 3O5GA 2PN0A 2Y78A 5HT1A 2ZQSA 2DT3A 1ZCNA 1ZK6A 3GTYX 4E5RA 2N87A 1LQ0A 1W1YA 4WKFA 1ZBCA 1FFQA 3O5KA 4TW7A 3WD1A 3LKXB 5AHTA 1TCOC 3UI5A 3O5EA 1K9QA 2IUZA 3WD0A 2LPVA 1NWUA 3AQUA 2RUDA 1NWTA 2FAPA 1Q6HA 3CHDA 4DRNA 1X6LA 3PQHA 2DG4A 1W1TA 3KAFA 1FKTA 2F23A 5DITA 1OGBA 1FKRA 1FD9A 2K8IA 2L2SA 1EDQA 4W5UA 1NMVA 5GPRA 2JV4A 2DPEA 4P8WA 4DWSA 4DRHA 1E15A 1YATA 4U86A 3ALFA 4KQZA 4NSBA 5I98A 2ZR6A 1LL7A 3UQAA 1HJXA 3B9DA 4DT4A 2PBCA 1NSGA 1SYTA 3JYMA 2QRVA 3MDYB 1LG2A 3WQVA 4IQCA 2MF9A 1HKKA 5E64A 2DSWA 3B8SA 3BMBA 4ITZA 3NRKA 1GUVA 2XP7A 3KAGA 1ZU8A 2ZAJA 2M1IA 4MNKA 2M3OW 2RURA 1D7JA 1ITXA 4Z2HA 1ZB5A 3ARYA 4DZ2A 3O5OA 2YBTA 3RMEA 2AOSA 3VAWA 1EYMA 4S3KA 1ROUA 4G50A 1K9RA 2KR7A 1D2KA 3WQWA 1LL4A 2YBUA 1BKFA 1E44A 2UZ5A 3WH0A 2PV3A 1ZBKA 4DRQA 4R0XA 2XP6A 4W9PA 2WK2A 3O5DA 2FDMA 3WD3A 1J4HA 4ZPVR 1FKSA 1HKMA 2OWOA 1EQ3A 3ODKA 4DWSC 2RUCA 4WKAA 1NWRA 3RM9A 4P8UA 1FKGA 2RSEA 2ZR5A 1ZL1A 1WMVA 3MQHA 2PPPA 4DRJA 4U84A 3LKXA 4QZVB 1C9HA 4QT3A 1E6PA 2A3CA 1W1VA 2MPHA 5E65A 4ML4A 1TK7A 3WL1A 3WD4A 1U79A 1R9HA 4Z2JA 4DRPA 1HXVA 3WKZA 4ODRA 2JZVA 1X6NA 1PINA 1GOIA 4C02B 3CZ8A 1FKJA 3ALGA 4ODPA 4ODMA 4NZCA 3PRAA 2EZ5W 1E6NA 2A3BA 3KZ7A 3KADA 4J4NA 2XP5A 4JYSA 1FKIA 3MCBA 1XRVA 1O6IA 3KAHA 2MLXA 3ARSA 4A0UA 3NTPA 2PI6A 2DWVA 3PRDA 1KT0A 2KO7A 4Z2GA 3UF8A 3ARZA 4LAXA 2YSIA 1TR8A 3W4RA 4WIWA 1FKFA 4BF8A 1HJVA 2IF4A 2DK1A 4FAPA 3WD2A 5HW7A 3ARWA 1Q1CA 2PV2A 2ETNA 2G41A 4WKHA 3UQBA 2WAEA 1ZBWA 1FAPA 3H9RB 3CHCA 4DRKA 2OLHA 3TDBA 3RM4A 2OFNA 3O5MA 1HJWA 3ARRA 1Q6IA 1KFWA 1A7XA 5HWCA 1QPFA 2YSFA 4LGXA 2F4EA 2ESCA 3FY1A 3UI6A
chains in the Genus database with same CATH topology
2XP4A 3AROA 4P8XA 2YAJB 4MPKA 3CNGA 1E6ZA 5E62A 5HW6A 1EG4A 3B9AA 4LAWA 2JX8A 3OA5A 3O5FA 5HBFA 3KAIA 1XHGA 4G2PA 4IPXA 3B9EA 1E9LA 3JXVA 1JNTA 2L4JA 4ODKA 4Q7NA 3CHFA 3PR9A 4S3JA 1EG3A 1H0GA 4KR0B 4DWSD 2LGOA 3TC5A 4LAYA 2PPNA 4TW6A 1ZBVA 2PV1A 4DRIA 5CQ2A 4O2TA 1N1AA 4TW8A 1PBKA 2MLYA 4JFJA 1QZ2A 2XPAA 1VF8A 3FS8A 3AS3A 4MSPA 3O5IA 3WIJA 3ARQA 1WR7A 4ODNA 4W9QA 1FKKA 1M5YA 4ZPWR 1J6YA 1I5HW 1W9UA 3PRBA 4MGVA 2ZQVA 3JYJA 3IKDA 1HKJA 3ARXA 4MAVA 3TCZA 4AY1A 1OGGA 2DSUA 2DJYA 3UI4A 4DWSB 3OOBA 2YSHA 4U85A 4Z2KA 1SR0A 1T11A 1FKBA 1OWQA 1UR9A 3CGMA 3CHEA 3AS0A 3UQIA 3LUOA 1WB0A 2M8JA 2DT2A 2XPBA 3RFWA 4QIBA 2M8IA 2DT0A 4TYOA 4GGQA 5HTGA 2O9OA 2DT1A 1KT1A 4REXA 5DEZA 5HWBA 1IX5A 2O92A 4W9OA 4PTMA 1K9TA 1JVWA 4Z2LA 3O5PA 4HBEA 1FLCA 5DIVA 2E45A 1B6CA 4MTVA 5BXJA 1W1PA 3G6LA 4J4OA 1LJYA 2JMFA 4JFKA 1D6OA 2MLZA 2DSZA 1NMWA 3CH9A 4LAVA 4TX0A 1FFRA 3I6CA 3KABA 3PA7A 4WJXA 2A3EA 2YSBA 1CTNA 3O5QA 1WAWA 1BL4A 4IQ2A 4A0TA 4ZPTR 1F8AB 2XP9A 2DSVA 4HBOA 4IT4A 3B7XA 1JNDA 2Y8NB 1ROTA 1JNSA 2ZR4A 4XAKA 3LE4A 1YW5A 4DIPA 2VN1A 2YSGA 1W26A 3WL0A 5HUAA 2AWGA 2XP8A 2PPOA 2F2DA 3IHZA 1J4RA 4R5EA 5JH8A 3GPKA 4DZ3A 1F40A 5DO2A 4Z2IA 2DG3A 4JFIA 4NNRA 3MCBB 5HW8A 5E5WA 1RP5A 5E66A 1L1PA 1LL6A 2RE3A 3G6MA 4ODQA 2ZQUA 1P5QA 4FN2A 4L3NA 2WLZA 4N19A 1RD6A 2ZQTA 5J6EA 1NWSA 2LKNA 3FSBA 2KFWA 1JNEA 2VCDA 2DK7A 1D7IA 4MNMA 1Q6UA 3IK8A 2RQSA 2WM0A 3AS1A 1W9PA 3BXWA 1D7HA 1H0IA 3O5LA 2JXWA 2KE0A 2MDIA 4DROA 4JFMA 4GLXA 5GQBA 3NI6A 3FSCA 1LG1A 3M85A 5B8IC 5GPGA 4IT6A 3L4HA 4HARA 4ZS6A 2G8ZA 4WK9A 3FXYA 5DF0A 4URIA 1O6WA 2F21A 1NH6A 4JFLA 5U47A 1FKDA 3KACA 2D9FA 2KXQA 3O5RA 3KCEA 3ARUA 2ITKA 2XP3A 2RUQA 4P8VA 5HKGA 1Y0OA 2WLYA 1E6RA 3MQGA 1TFVA 3AS2A 3ARPA 2FKEA 2BA1A 2KGJA 2M2AA 3ARVA 4L72B 2KI3A 2B31A 2WADA 2LJ4A 1EHNA 2DMVA 4TNSA 3FAPA 3IKGA 1EIBA 1JMQA 5DIUA 1FJDA 3RM8A 3ARTA 1QPLA 2M08A 1HKIA 1FKLA 3O5JA 2Q5AA 1W9VA 3M7NA 3CGNA 2QF8A 4Q22A 4DRMA 2MNTA 2DG9A 4QT2A 4MNJA 3RGCA 4DH0A 1WNOA 4GIVA 4ODLA 4MNLA 1UR8A 3QOKA 1FKHA 4ODOA 2A3AA 3EY6A 5D75A 2LAJA 1J4IA 1GPFA 3O5GA 2Y78A 5HT1A 2ZQSA 2DT3A 1ZCNA 1ZK6A 4E5RA 2N87A 1LQ0A 1W1YA 4WKFA 1ZBCA 1FFQA 3O5KA 4TW7A 3WD1A 3LKXB 5AHTA 1TCOC 3UI5A 3O5EA 1K9QA 2IUZA 3WD0A 2LPVA 1NWUA 3AQUA 2RUDA 1NWTA 2FAPA 1Q6HA 3CHDA 4DRNA 1X6LA 3PQHA 2DG4A 1W1TA 3KAFA 1FKTA 5DITA 1OGBA 1FKRA 1FD9A 2K8IA 2L2SA 1EDQA 4W5UA 1NMVA 5GPRA 2JV4A 2DPEA 4P8WA 4DWSA 4DRHA 1E15A 1YATA 4U86A 3ALFA 4KQZA 4NSBA 5I98A 2ZR6A 1LL7A 3UQAA 1HJXA 3B9DA 4DT4A 2PBCA 1NSGA 1SYTA 3JYMA 2QRVA 3MDYB 1LG2A 3WQVA 4IQCA 2MF9A 1HKKA 5E64A 2DSWA 3B8SA 4ITZA 3NRKA 1GUVA 2XP7A 3KAGA 1ZU8A 2ZAJA 2M1IA 4MNKA 2M3OW 2RURA 1D7JA 1ITXA 4Z2HA 1ZB5A 3ARYA 4DZ2A 3O5OA 2YBTA 3RMEA 2AOSA 3VAWA 1EYMA 4S3KA 1ROUA 4G50A 1K9RA 2KR7A 1D2KA 3WQWA 1LL4A 2YBUA 1BKFA 2UZ5A 3WH0A 2PV3A 1ZBKA 4DRQA 4R0XA 2XP6A 4W9PA 2WK2A 3O5DA 2FDMA 3WD3A 1J4HA 4ZPVR 1FKSA 1HKMA 2OWOA 1EQ3A 3ODKA 4DWSC 2RUCA 4WKAA 1NWRA 3RM9A 4P8UA 1FKGA 2RSEA 2ZR5A 1ZL1A 1WMVA 3MQHA 2PPPA 4DRJA 4U84A 3LKXA 4QZVB 1C9HA 4QT3A 1E6PA 2A3CA 1W1VA 2MPHA 5E65A 4ML4A 1TK7A 3WL1A 3WD4A 1U79A 1R9HA 4Z2JA 4DRPA 1HXVA 3WKZA 4ODRA 2JZVA 1X6NA 1PINA 1GOIA 4C02B 3CZ8A 1FKJA 3ALGA 4ODPA 4ODMA 4NZCA 3PRAA 2EZ5W 1E6NA 2A3BA 3KZ7A 3KADA 4J4NA 2XP5A 4JYSA 1FKIA 3MCBA 1XRVA 1O6IA 3KAHA 2MLXA 3ARSA 4A0UA 3NTPA 2PI6A 2DWVA 3PRDA 1KT0A 2KO7A 4Z2GA 3UF8A 3ARZA 4LAXA 2YSIA 1TR8A 3W4RA 4WIWA 1FKFA 4BF8A 1HJVA 2IF4A 2DK1A 4FAPA 3WD2A 5HW7A 3ARWA 1Q1CA 2PV2A 2G41A 4WKHA 3UQBA 2WAEA 1ZBWA 1FAPA 3H9RB 3CHCA 4DRKA 2OLHA 3TDBA 3RM4A 2OFNA 3O5MA 1HJWA 3ARRA 1Q6IA 1KFWA 1A7XA 5HWCA 1QPFA 2YSFA 4LGXA 2F4EA 2ESCA 3FY1A 3UI6A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2XP4 A;  3CNG A;  5HW6 A;  1EG4 A;  4LAW A;  2JX8 A;  3O5F A;  3KAI A;  4G2P A;  4IPX A;  3JXV A;  1JNT A;  2L4J A;  4ODK A;  1EG3 A;  2LGO A;  3TC5 A;  4LAY A;  2PPN A;  4TW6 A;  2PV1 A;  4DRI A;  5CQ2 A;  4O2T A;  1N1A A;  4TW8 A;  1PBK A;  2MLY A;  4JFJ A;  1QZ2 A;  2XPA A;  4MSP A;  3O5I A;  1WR7 A;  4ODN A;  4W9Q A;  1FKK A;  1M5Y A;  1J6Y A;  1I5H W;  3PRB A;  4MGV A;  2ZQV A;  3JYJ A;  3IKD A;  3TCZ A;  2DJY A;  3UI4 A;  3OOB A;  2YSH A;  4U85 A;  1T11 A;  1FKB A;  3CGM A;  3UQI A;  3LUO A;  2M8J A;  2XPB A;  3RFW A;  4QIB A;  2M8I A;  4TYO A;  4GGQ A;  5HTG A;  1KT1 A;  4REX A;  5HWB A;  4W9O A;  1JVW A;  3O5P A;  5DIV A;  2E45 A;  1B6C A;  5BXJ A;  4J4O A;  2JMF A;  4JFK A;  1D6O A;  2MLZ A;  1NMW A;  4TX0 A;  4LAV A;  3I6C A;  3KAB A;  3PA7 A;  2YSB A;  3O5Q A;  1BL4 A;  4IQ2 A;  1F8A B;  2XP9 A;  3B7X A;  1ROT A;  1JNS A;  2ZR4 A;  3LE4 A;  1YW5 A;  4DIP A;  2VN1 A;  2YSG A;  1W26 A;  5HUA A;  2AWG A;  2XP8 A;  2PPO A;  2F2D A;  3IHZ A;  1J4R A;  3GPK A;  4DZ3 A;  1F40 A;  2DG3 A;  4JFI A;  4NNR A;  5HW8 A;  1L1P A;  2RE3 A;  4ODQ A;  2ZQU A;  1P5Q A;  4FN2 A;  4N19 A;  2ZQT A;  5J6E A;  2LKN A;  2KFW A;  2VCD A;  2DK7 A;  1D7I A;  1Q6U A;  3IK8 A;  2RQS A;  1D7H A;  3O5L A;  2JXW A;  2KE0 A;  2MDI A;  4DRO A;  4JFM A;  3NI6 A;  3M85 A;  5B8I C;  5GPG A;  3L4H A;  1O6W A;  2F21 A;  4JFL A;  1FKD A;  3KAC A;  2D9F A;  2KXQ A;  3O5R A;  3KCE A;  2ITK A;  2XP3 A;  2RUQ A;  5HKG A;  1Y0O A;  2FKE A;  2BA1 A;  2KGJ A;  2M2A A;  2KI3 A;  2LJ4 A;  4TNS A;  2DMV A;  3FAP A;  3IKG A;  1FJD A;  1JMQ A;  5DIU A;  1QPL A;  2M08 A;  1FKL A;  3O5J A;  2Q5A A;  3M7N A;  3CGN A;  4DRM A;  2MNT A;  2DG9 A;  4QT2 A;  3RGC A;  4DH0 A;  4GIV A;  4ODL A;  1FKH A;  4ODO A;  3EY6 A;  5D75 A;  2LAJ A;  1J4I A;  3O5G A;  2Y78 A;  5HT1 A;  2ZQS A;  1ZCN A;  1ZK6 A;  4E5R A;  2N87 A;  3O5K A;  4TW7 A;  3UI5 A;  5AHT A;  1TCO C;  3O5E A;  1K9Q A;  2LPV A;  2RUD A;  2FAP A;  1Q6H A;  4DRN A;  2DG4 A;  3KAF A;  1FKT A;  5DIT A;  1FKR A;  1FD9 A;  2K8I A;  2L2S A;  1NMV A;  2JV4 A;  4DRH A;  1YAT A;  4U86 A;  5I98 A;  2ZR6 A;  3UQA A;  4DT4 A;  2PBC A;  1NSG A;  3JYM A;  3MDY B;  4IQC A;  2MF9 A;  4ITZ A;  3NRK A;  2XP7 A;  3KAG A;  2ZAJ A;  2M1I A;  2M3O W;  2RUR A;  1D7J A;  4DZ2 A;  3O5O A;  3VAW A;  1EYM A;  1ROU A;  4G50 A;  1K9R A;  2KR7 A;  1BKF A;  2UZ5 A;  3WH0 A;  2PV3 A;  4DRQ A;  4R0X A;  2XP6 A;  4W9P A;  3O5D A;  1J4H A;  1FKS A;  1EQ3 A;  3ODK A;  2RUC A;  1FKG A;  2RSE A;  2ZR5 A;  1WMV A;  2PPP A;  4DRJ A;  4U84 A;  1C9H A;  4QT3 A;  2MPH A;  1TK7 A;  1U79 A;  1R9H A;  4DRP A;  1HXV A;  4ODR A;  2JZV A;  1PIN A;  4C02 B;  1FKJ A;  4ODP A;  4ODM A;  2EZ5 W;  3KZ7 A;  3KAD A;  4J4N A;  2XP5 A;  4JYS A;  1FKI A;  3KAH A;  2MLX A;  3NTP A;  2DWV A;  3PRD A;  1KT0 A;  2KO7 A;  3UF8 A;  4LAX A;  2YSI A;  1FKF A;  4BF8 A;  2IF4 A;  2DK1 A;  4FAP A;  5HW7 A;  1Q1C A;  2PV2 A;  3UQB A;  1FAP A;  3H9R B;  4DRK A;  3TDB A;  2OFN A;  3O5M A;  1Q6I A;  1A7X A;  5HWC A;  1QPF A;  2YSF A;  2F4E A;  3UI6 A; 
#chains in the Genus database with same CATH topology
 2XP4 A;  3ARO A;  4P8X A;  2YAJ B;  4MPK A;  3CNG A;  1E6Z A;  5E62 A;  5HW6 A;  1EG4 A;  3B9A A;  4LAW A;  2JX8 A;  3OA5 A;  3O5F A;  5HBF A;  3KAI A;  1XHG A;  4G2P A;  4IPX A;  3B9E A;  1E9L A;  3JXV A;  1JNT A;  2L4J A;  4ODK A;  4Q7N A;  2P4V A;  3CHF A;  3PR9 A;  4S3J A;  1EG3 A;  1H0G A;  4KR0 B;  4DWS D;  2LGO A;  3TC5 A;  4LAY A;  2PPN A;  4TW6 A;  1ZBV A;  2PV1 A;  3GU0 A;  4DRI A;  5CQ2 A;  4O2T A;  1N1A A;  4TW8 A;  1PBK A;  2MLY A;  4JFJ A;  1QZ2 A;  2XPA A;  1VF8 A;  3FS8 A;  3AS3 A;  4MSP A;  3O5I A;  3WIJ A;  3ARQ A;  1WR7 A;  4ODN A;  4W9Q A;  1FKK A;  1M5Y A;  4ZPW R;  2B5U B;  1J6Y A;  1I5H W;  1W9U A;  3PRB A;  4MGV A;  2ZQV A;  3JYJ A;  3IKD A;  1HKJ A;  3ARX A;  4MAV A;  3TCZ A;  4AY1 A;  1OGG A;  2DSU A;  2DJY A;  3UI4 A;  4DWS B;  4UDM A;  3OOB A;  2YSH A;  4U85 A;  4Z2K A;  1SR0 A;  1T11 A;  1FKB A;  1OWQ A;  1UR9 A;  3CGM A;  3CHE A;  3AS0 A;  3UQI A;  3LUO A;  1WB0 A;  2M8J A;  2DT2 A;  2XPB A;  3RFW A;  4QIB A;  2M8I A;  2DT0 A;  4TYO A;  4GGQ A;  5HTG A;  2O9O A;  2DT1 A;  1KT1 A;  4REX A;  5DEZ A;  5HWB A;  1IX5 A;  3EIP A;  2O92 A;  4W9O A;  4PTM A;  1K9T A;  1JVW A;  4Z2L A;  3O5P A;  4HBE A;  1FLC A;  5DIV A;  2E45 A;  1B6C A;  4MTV A;  5BXJ A;  1W1P A;  3G6L A;  4J4O A;  1LJY A;  2JMF A;  4JFK A;  1D6O A;  2MLZ A;  2DSZ A;  1NMW A;  3CH9 A;  4LAV A;  1JCH B;  4TX0 A;  1FFR A;  3I6C A;  3KAB A;  3PA7 A;  4WJX A;  2A3E A;  2YSB A;  1CTN A;  3O5Q A;  1WAW A;  1BL4 A;  4IQ2 A;  4A0T A;  4ZPT R;  1F8A B;  2XP9 A;  2DSV A;  4HBO A;  4IT4 A;  3B7X A;  1JND A;  2Y8N B;  1ROT A;  1JNS A;  2ZR4 A;  4XAK A;  3LE4 A;  1YW5 A;  4DIP A;  2VN1 A;  2YSG A;  1W26 A;  3WL0 A;  5HUA A;  2AWG A;  2XP8 A;  2PPO A;  2F2D A;  3IHZ A;  1J4R A;  4R5E A;  5JH8 A;  3GPK A;  4DZ3 A;  1F40 A;  5DO2 A;  4Z2I A;  2DG3 A;  4JFI A;  4NNR A;  3MCB B;  5HW8 A;  5E5W A;  1RP5 A;  5E66 A;  1L1P A;  1LL6 A;  2RE3 A;  3G6M A;  4ODQ A;  2ZQU A;  1P5Q A;  4FN2 A;  4L3N A;  2WLZ A;  4N19 A;  1RD6 A;  2ZQT A;  5J6E A;  1NWS A;  2LKN A;  3FSB A;  2KFW A;  1JNE A;  2VCD A;  2DK7 A;  1D7I A;  4MNM A;  1Q6U A;  3IK8 A;  2RQS A;  2WM0 A;  3AS1 A;  1W9P A;  3BXW A;  1D7H A;  1H0I A;  3O5L A;  2JXW A;  2KE0 A;  2MDI A;  4DRO A;  4JFM A;  4GLX A;  1GRJ A;  5GQB A;  3NI6 A;  3FSC A;  2EUL A;  1LG1 A;  3M85 A;  5B8I C;  5GPG A;  4IT6 A;  3L4H A;  4HAR A;  4ZS6 A;  2G8Z A;  4WK9 A;  3FXY A;  5DF0 A;  4URI A;  1O6W A;  2F21 A;  1NH6 A;  4JFL A;  5U47 A;  1FKD A;  3KAC A;  2D9F A;  2KXQ A;  3O5R A;  3KCE A;  3ARU A;  2ITK A;  2XP3 A;  2RUQ A;  4P8V A;  5HKG A;  1Y0O A;  2WLY A;  1E6R A;  3MQG A;  1TFV A;  3AS2 A;  3ARP A;  2FKE A;  2BA1 A;  2KGJ A;  2M2A A;  3ARV A;  4L72 B;  2KI3 A;  2B31 A;  2WAD A;  2LJ4 A;  1EHN A;  2DMV A;  4TNS A;  3FAP A;  3IKG A;  1EIB A;  1JMQ A;  5DIU A;  1FJD A;  3RM8 A;  3ART A;  1QPL A;  2M08 A;  1HKI A;  1FKL A;  3O5J A;  2Q5A A;  1W9V A;  3M7N A;  3CGN A;  2QF8 A;  4Q22 A;  4DRM A;  2MNT A;  2DG9 A;  4QT2 A;  4MNJ A;  3RGC A;  4DH0 A;  1WNO A;  4GIV A;  4ODL A;  4MNL A;  1UR8 A;  3QOK A;  1FKH A;  4ODO A;  2A3A A;  3EY6 A;  5D75 A;  2LAJ A;  1J4I A;  1GPF A;  3O5G A;  2PN0 A;  2Y78 A;  5HT1 A;  2ZQS A;  2DT3 A;  1ZCN A;  1ZK6 A;  3GTY X;  4E5R A;  2N87 A;  1LQ0 A;  1W1Y A;  4WKF A;  1ZBC A;  1FFQ A;  3O5K A;  4TW7 A;  3WD1 A;  3LKX B;  5AHT A;  1TCO C;  3UI5 A;  3O5E A;  1K9Q A;  2IUZ A;  3WD0 A;  2LPV A;  1NWU A;  3AQU A;  2RUD A;  1NWT A;  2FAP A;  1Q6H A;  3CHD A;  4DRN A;  1X6L A;  3PQH A;  2DG4 A;  1W1T A;  3KAF A;  1FKT A;  2F23 A;  5DIT A;  1OGB A;  1FKR A;  1FD9 A;  2K8I A;  2L2S A;  1EDQ A;  4W5U A;  1NMV A;  5GPR A;  2JV4 A;  2DPE A;  4P8W A;  4DWS A;  4DRH A;  1E15 A;  1YAT A;  4U86 A;  3ALF A;  4KQZ A;  4NSB A;  5I98 A;  2ZR6 A;  1LL7 A;  3UQA A;  1HJX A;  3B9D A;  4DT4 A;  2PBC A;  1NSG A;  1SYT A;  3JYM A;  2QRV A;  3MDY B;  1LG2 A;  3WQV A;  4IQC A;  2MF9 A;  1HKK A;  5E64 A;  2DSW A;  3B8S A;  3BMB A;  4ITZ A;  3NRK A;  1GUV A;  2XP7 A;  3KAG A;  1ZU8 A;  2ZAJ A;  2M1I A;  4MNK A;  2M3O W;  2RUR A;  1D7J A;  1ITX A;  4Z2H A;  1ZB5 A;  3ARY A;  4DZ2 A;  3O5O A;  2YBT A;  3RME A;  2AOS A;  3VAW A;  1EYM A;  4S3K A;  1ROU A;  4G50 A;  1K9R A;  2KR7 A;  1D2K A;  3WQW A;  1LL4 A;  2YBU A;  1BKF A;  1E44 A;  2UZ5 A;  3WH0 A;  2PV3 A;  1ZBK A;  4DRQ A;  4R0X A;  2XP6 A;  4W9P A;  2WK2 A;  3O5D A;  2FDM A;  3WD3 A;  1J4H A;  4ZPV R;  1FKS A;  1HKM A;  2OWO A;  1EQ3 A;  3ODK A;  4DWS C;  2RUC A;  4WKA A;  1NWR A;  3RM9 A;  4P8U A;  1FKG A;  2RSE A;  2ZR5 A;  1ZL1 A;  1WMV A;  3MQH A;  2PPP A;  4DRJ A;  4U84 A;  3LKX A;  4QZV B;  1C9H A;  4QT3 A;  1E6P A;  2A3C A;  1W1V A;  2MPH A;  5E65 A;  4ML4 A;  1TK7 A;  3WL1 A;  3WD4 A;  1U79 A;  1R9H A;  4Z2J A;  4DRP A;  1HXV A;  3WKZ A;  4ODR A;  2JZV A;  1X6N A;  1PIN A;  1GOI A;  4C02 B;  3CZ8 A;  1FKJ A;  3ALG A;  4ODP A;  4ODM A;  4NZC A;  3PRA A;  2EZ5 W;  1E6N A;  2A3B A;  3KZ7 A;  3KAD A;  4J4N A;  2XP5 A;  4JYS A;  1FKI A;  3MCB A;  1XRV A;  1O6I A;  3KAH A;  2MLX A;  3ARS A;  4A0U A;  3NTP A;  2PI6 A;  2DWV A;  3PRD A;  1KT0 A;  2KO7 A;  4Z2G A;  3UF8 A;  3ARZ A;  4LAX A;  2YSI A;  1TR8 A;  3W4R A;  4WIW A;  1FKF A;  4BF8 A;  1HJV A;  2IF4 A;  2DK1 A;  4FAP A;  3WD2 A;  5HW7 A;  3ARW A;  1Q1C A;  2PV2 A;  2ETN A;  2G41 A;  4WKH A;  3UQB A;  2WAE A;  1ZBW A;  1FAP A;  3H9R B;  3CHC A;  4DRK A;  2OLH A;  3TDB A;  3RM4 A;  2OFN A;  3O5M A;  1HJW A;  3ARR A;  1Q6I A;  1KFW A;  1A7X A;  5HWC A;  1QPF A;  2YSF A;  4LGX A;  2F4E A;  2ESC A;  3FY1 A;  3UI6 A; 
#chains in the Genus database with same CATH homology
 2XP4 A;  3ARO A;  4P8X A;  2YAJ B;  4MPK A;  3CNG A;  1E6Z A;  5E62 A;  5HW6 A;  1EG4 A;  3B9A A;  4LAW A;  2JX8 A;  3OA5 A;  3O5F A;  5HBF A;  3KAI A;  1XHG A;  4G2P A;  4IPX A;  3B9E A;  1E9L A;  3JXV A;  1JNT A;  2L4J A;  4ODK A;  4Q7N A;  3CHF A;  3PR9 A;  4S3J A;  1EG3 A;  1H0G A;  4KR0 B;  4DWS D;  2LGO A;  3TC5 A;  4LAY A;  2PPN A;  4TW6 A;  1ZBV A;  2PV1 A;  4DRI A;  5CQ2 A;  4O2T A;  1N1A A;  4TW8 A;  1PBK A;  2MLY A;  4JFJ A;  1QZ2 A;  2XPA A;  1VF8 A;  3FS8 A;  3AS3 A;  4MSP A;  3O5I A;  3WIJ A;  3ARQ A;  1WR7 A;  4ODN A;  4W9Q A;  1FKK A;  1M5Y A;  4ZPW R;  1J6Y A;  1I5H W;  1W9U A;  3PRB A;  4MGV A;  2ZQV A;  3JYJ A;  3IKD A;  1HKJ A;  3ARX A;  4MAV A;  3TCZ A;  4AY1 A;  1OGG A;  2DSU A;  2DJY A;  3UI4 A;  4DWS B;  3OOB A;  2YSH A;  4U85 A;  4Z2K A;  1SR0 A;  1T11 A;  1FKB A;  1OWQ A;  1UR9 A;  3CGM A;  3CHE A;  3AS0 A;  3UQI A;  3LUO A;  1WB0 A;  2M8J A;  2DT2 A;  2XPB A;  3RFW A;  4QIB A;  2M8I A;  2DT0 A;  4TYO A;  4GGQ A;  5HTG A;  2O9O A;  2DT1 A;  1KT1 A;  4REX A;  5DEZ A;  5HWB A;  1IX5 A;  2O92 A;  4W9O A;  4PTM A;  1K9T A;  1JVW A;  4Z2L A;  3O5P A;  4HBE A;  1FLC A;  5DIV A;  2E45 A;  1B6C A;  4MTV A;  5BXJ A;  1W1P A;  3G6L A;  4J4O A;  1LJY A;  2JMF A;  4JFK A;  1D6O A;  2MLZ A;  2DSZ A;  1NMW A;  3CH9 A;  4LAV A;  4TX0 A;  1FFR A;  3I6C A;  3KAB A;  3PA7 A;  4WJX A;  2A3E A;  2YSB A;  1CTN A;  3O5Q A;  1WAW A;  1BL4 A;  4IQ2 A;  4A0T A;  4ZPT R;  1F8A B;  2XP9 A;  2DSV A;  4HBO A;  4IT4 A;  3B7X A;  1JND A;  2Y8N B;  1ROT A;  1JNS A;  2ZR4 A;  4XAK A;  3LE4 A;  1YW5 A;  4DIP A;  2VN1 A;  2YSG A;  1W26 A;  3WL0 A;  5HUA A;  2AWG A;  2XP8 A;  2PPO A;  2F2D A;  3IHZ A;  1J4R A;  4R5E A;  5JH8 A;  3GPK A;  4DZ3 A;  1F40 A;  5DO2 A;  4Z2I A;  2DG3 A;  4JFI A;  4NNR A;  3MCB B;  5HW8 A;  5E5W A;  1RP5 A;  5E66 A;  1L1P A;  1LL6 A;  2RE3 A;  3G6M A;  4ODQ A;  2ZQU A;  1P5Q A;  4FN2 A;  4L3N A;  2WLZ A;  4N19 A;  1RD6 A;  2ZQT A;  5J6E A;  1NWS A;  2LKN A;  3FSB A;  2KFW A;  1JNE A;  2VCD A;  2DK7 A;  1D7I A;  4MNM A;  1Q6U A;  3IK8 A;  2RQS A;  2WM0 A;  3AS1 A;  1W9P A;  3BXW A;  1D7H A;  1H0I A;  3O5L A;  2JXW A;  2KE0 A;  2MDI A;  4DRO A;  4JFM A;  4GLX A;  5GQB A;  3NI6 A;  3FSC A;  1LG1 A;  3M85 A;  5B8I C;  5GPG A;  4IT6 A;  3L4H A;  4HAR A;  4ZS6 A;  2G8Z A;  4WK9 A;  3FXY A;  5DF0 A;  4URI A;  1O6W A;  2F21 A;  1NH6 A;  4JFL A;  5U47 A;  1FKD A;  3KAC A;  2D9F A;  2KXQ A;  3O5R A;  3KCE A;  3ARU A;  2ITK A;  2XP3 A;  2RUQ A;  4P8V A;  5HKG A;  1Y0O A;  2WLY A;  1E6R A;  3MQG A;  1TFV A;  3AS2 A;  3ARP A;  2FKE A;  2BA1 A;  2KGJ A;  2M2A A;  3ARV A;  4L72 B;  2KI3 A;  2B31 A;  2WAD A;  2LJ4 A;  1EHN A;  2DMV A;  4TNS A;  3FAP A;  3IKG A;  1EIB A;  1JMQ A;  5DIU A;  1FJD A;  3RM8 A;  3ART A;  1QPL A;  2M08 A;  1HKI A;  1FKL A;  3O5J A;  2Q5A A;  1W9V A;  3M7N A;  3CGN A;  2QF8 A;  4Q22 A;  4DRM A;  2MNT A;  2DG9 A;  4QT2 A;  4MNJ A;  3RGC A;  4DH0 A;  1WNO A;  4GIV A;  4ODL A;  4MNL A;  1UR8 A;  3QOK A;  1FKH A;  4ODO A;  2A3A A;  3EY6 A;  5D75 A;  2LAJ A;  1J4I A;  1GPF A;  3O5G A;  2Y78 A;  5HT1 A;  2ZQS A;  2DT3 A;  1ZCN A;  1ZK6 A;  4E5R A;  2N87 A;  1LQ0 A;  1W1Y A;  4WKF A;  1ZBC A;  1FFQ A;  3O5K A;  4TW7 A;  3WD1 A;  3LKX B;  5AHT A;  1TCO C;  3UI5 A;  3O5E A;  1K9Q A;  2IUZ A;  3WD0 A;  2LPV A;  1NWU A;  3AQU A;  2RUD A;  1NWT A;  2FAP A;  1Q6H A;  3CHD A;  4DRN A;  1X6L A;  3PQH A;  2DG4 A;  1W1T A;  3KAF A;  1FKT A;  5DIT A;  1OGB A;  1FKR A;  1FD9 A;  2K8I A;  2L2S A;  1EDQ A;  4W5U A;  1NMV A;  5GPR A;  2JV4 A;  2DPE A;  4P8W A;  4DWS A;  4DRH A;  1E15 A;  1YAT A;  4U86 A;  3ALF A;  4KQZ A;  4NSB A;  5I98 A;  2ZR6 A;  1LL7 A;  3UQA A;  1HJX A;  3B9D A;  4DT4 A;  2PBC A;  1NSG A;  1SYT A;  3JYM A;  2QRV A;  3MDY B;  1LG2 A;  3WQV A;  4IQC A;  2MF9 A;  1HKK A;  5E64 A;  2DSW A;  3B8S A;  4ITZ A;  3NRK A;  1GUV A;  2XP7 A;  3KAG A;  1ZU8 A;  2ZAJ A;  2M1I A;  4MNK A;  2M3O W;  2RUR A;  1D7J A;  1ITX A;  4Z2H A;  1ZB5 A;  3ARY A;  4DZ2 A;  3O5O A;  2YBT A;  3RME A;  2AOS A;  3VAW A;  1EYM A;  4S3K A;  1ROU A;  4G50 A;  1K9R A;  2KR7 A;  1D2K A;  3WQW A;  1LL4 A;  2YBU A;  1BKF A;  2UZ5 A;  3WH0 A;  2PV3 A;  1ZBK A;  4DRQ A;  4R0X A;  2XP6 A;  4W9P A;  2WK2 A;  3O5D A;  2FDM A;  3WD3 A;  1J4H A;  4ZPV R;  1FKS A;  1HKM A;  2OWO A;  1EQ3 A;  3ODK A;  4DWS C;  2RUC A;  4WKA A;  1NWR A;  3RM9 A;  4P8U A;  1FKG A;  2RSE A;  2ZR5 A;  1ZL1 A;  1WMV A;  3MQH A;  2PPP A;  4DRJ A;  4U84 A;  3LKX A;  4QZV B;  1C9H A;  4QT3 A;  1E6P A;  2A3C A;  1W1V A;  2MPH A;  5E65 A;  4ML4 A;  1TK7 A;  3WL1 A;  3WD4 A;  1U79 A;  1R9H A;  4Z2J A;  4DRP A;  1HXV A;  3WKZ A;  4ODR A;  2JZV A;  1X6N A;  1PIN A;  1GOI A;  4C02 B;  3CZ8 A;  1FKJ A;  3ALG A;  4ODP A;  4ODM A;  4NZC A;  3PRA A;  2EZ5 W;  1E6N A;  2A3B A;  3KZ7 A;  3KAD A;  4J4N A;  2XP5 A;  4JYS A;  1FKI A;  3MCB A;  1XRV A;  1O6I A;  3KAH A;  2MLX A;  3ARS A;  4A0U A;  3NTP A;  2PI6 A;  2DWV A;  3PRD A;  1KT0 A;  2KO7 A;  4Z2G A;  3UF8 A;  3ARZ A;  4LAX A;  2YSI A;  1TR8 A;  3W4R A;  4WIW A;  1FKF A;  4BF8 A;  1HJV A;  2IF4 A;  2DK1 A;  4FAP A;  3WD2 A;  5HW7 A;  3ARW A;  1Q1C A;  2PV2 A;  2G41 A;  4WKH A;  3UQB A;  2WAE A;  1ZBW A;  1FAP A;  3H9R B;  3CHC A;  4DRK A;  2OLH A;  3TDB A;  3RM4 A;  2OFN A;  3O5M A;  1HJW A;  3ARR A;  1Q6I A;  1KFW A;  1A7X A;  5HWC A;  1QPF A;  2YSF A;  4LGX A;  2F4E A;  2ESC A;  3FY1 A;  3UI6 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...