2ZR6A

Crystal structure of a mutant pin1 peptidyl-prolyl cis-trans isomerase
Total Genus 39
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
39
sequence length
158
structure length
153
Chain Sequence
KLPPGWEKAMSRSSGRVYYFNHITNASQWERPSGGKNGQGEPARVRCSHLLVKHSQSRRPSSWRQEKITRTKEEALELINGYIQKIKSGEEDFESLASQFSDCSSAKARGDLGAFSRGQMQKPFEDASFALRTGEMSGPVFTDSGIHIILRTE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Isomerase
molecule keywords Peptidyl-prolyl cis-trans isomerase NIMA-interacting 1
publication title Structural studies on PIN1 mutants
rcsb
source organism Homo sapiens
total genus 39
structure length 153
sequence length 158
ec nomenclature ec 5.2.1.8: Peptidylprolyl isomerase.
pdb deposition date 2008-08-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00397 WW WW domain
A PF00639 Rotamase PPIC-type PPIASE domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.20.70.10 Mainly Beta Single Sheet Ubiquitin Ligase Nedd4; Chain: W; Ubiquitin Ligase Nedd4; Chain: W; 2zr6A01
3.10.50.40 Alpha Beta Roll Chitinase A; domain 3 Chitinase A; domain 3 2zr6A02
3EY6A 3H9RB 3CGNA 4ITZA 4JFLA 4DROA 2BA1A 2DJYA 5BXJA 2YSHA 2M2AA 1K9RA 4TX0A 4QIBA 1WMVA 1N1AA 2YSGA 2KGJA 4TNSA 3IKDA 2E45A 5HUAA 4FAPA 2DMVA 2MLZA 3L4HA 3M7NA 4DRIA 1FKIA 2XP8A 2ZQTA 3RFWA 5HW6A 5CQ2A 3LE4A 3TCZA 1FKRA 2KO7A 5HKGA 2JX8A 3KAIA 5HT1A 4J4OA 3TC5A 4JFMA 1FKSA 3FAPA 4N19A 2RE3A 2ZAJA 2M8IA 3O5KA 1BL4A 2XP6A 2JZVA 1ROUA 1Y0OA 5B8IC 2ZR6A 1FKTA 1FD9A 5HW7A 4LAXA 4C02B 1Q1CA 2N87A 2LPVA 4JFJA 5HWBA 3NRKA 2DG3A 2OFNA 5J6EA 4G50A 1PINA 4NNRA 2L2SA 2VCDA 2M8JA 1T11A 2MF9A 2PPNA 2KXQA 5D75A 1J4IA 1KT1A 4QT2A 2PV2A 4W9QA 1JMQA 3IHZA 2JMFA 1J4HA 2YSIA 1JNSA 1B6CA 1Q6HA 3CNGA 5HW8A 4DRNA 1PBKA 3PRDA 4IQ2A 2AWGA 4JYSA 1R9HA 2MNTA 2IF4A 4LAWA 4DZ3A 2EZ5W 2RUCA 1K9QA 4ODQA 4ODMA 1FKKA 2M1IA 3O5MA 3O5IA 2RUDA 2XP5A 1TK7A 1YW5A 1D7HA 3KAGA 4IQCA 2F21A 1C9HA 4REXA 4ODKA 4W9PA 1EYMA 4DRJA 3O5GA 3UI4A 1FKHA 1NMWA 2K8IA 4DZ2A 1J4RA 2JXWA 3M85A 1L1PA 3GPKA 1A7XA 2L4JA 4DT4A 3NTPA 3UI5A 2MLYA 5DIVA 4TW7A 2YSBA 4ODLA 2ZR5A 2LKNA 5AHTA 4TW8A 3UQBA 2ZQSA 1FKLA 3UQIA 1HXVA 3VAWA 1QPLA 2F2DA 4U86A 2KI3A 2JV4A 4E5RA 4U85A 1U79A 1NMVA 2PPOA 1EQ3A 2XP7A 4ODNA 4MSPA 1FKJA 1M5YA 4GGQA 5HTGA 3KCEA 3NI6A 3O5QA 2DK7A 4LAYA 3O5RA 4R0XA 2XPBA 5DIUA 2M08A 1FJDA 2DG4A 2MPHA 3JYJA 4O2TA 1W26A 4DH0A 1FKGA 2RURA 1ZK6A 4TW6A 1QPFA 4MGVA 1QZ2A 4JFKA 2LGOA 2DK1A 1I5HW 3ODKA 1KT0A 2FAPA 2UZ5A 2VN1A 3I6CA 1FKFA 4ODPA 3KAFA 1Q6UA 4IPXA 1FAPA 3O5DA 3KABA 4DRQA 3O5FA 2DWVA 1J6YA 2ZQUA 1FKBA 4GIVA 1D7IA 3O5EA 4ODRA 1WR7A 3IK8A 3KACA 5GPGA 2PBCA 1ROTA 4TYOA 1JNTA 2RSEA 4J4NA 2KE0A 2F4EA 2XP3A 4DRMA 1F8AB 4W9OA 3KZ7A 4QT3A 2KFWA 2MDIA 2DG9A 3O5LA 1BKFA 1JVWA 1FKDA 2KR7A 3UQAA 4LAVA 3CGMA 3UI6A 2Y78A 1O6WA 5I98A 3TDBA 3B7XA 2XP9A 3JYMA 3MDYB 2PV3A 1TCOC 2FKEA 4G2PA 4JFIA 2XP4A 1Q6IA 1YATA 2D9FA 2LAJA 2PPPA 4FN2A 4DRPA 4DIPA 4U84A 3KADA 2ZR4A 1EG3A 3WH0A 2M3OW 1ZCNA 4DRHA 1F40A 2YSFA 4BF8A 3O5JA 2MLXA 5DITA 2RUQA 3UF8A 3JXVA 3PRBA 3O5OA 2PV1A 3IKGA 1EG4A 1NSGA 3LUOA 3RGCA 3KAHA 1P5QA 3OOBA 4DRKA 5HWCA 2ZQVA 2Q5AA 2LJ4A 2RQSA 3O5PA 1D6OA 3PA7A 1D7JA 2ITKA 2XPAA 4ODOA
chains in the Genus database with same CATH superfamily
3EY6A 3H9RB 3CGNA 3ARSA 4ITZA 4JFLA 4DROA 2BA1A 3G6LA 2DJYA 2A3EA 5BXJA 2YSHA 3ARUA 3WD0A 5E64A 2QF8A 1E9LA 2M2AA 1K9RA 4TX0A 4QIBA 1WMVA 1N1AA 1OGBA 1IX5A 2YSGA 2KGJA 1UR8A 3WD3A 4TNSA 3AQUA 3IKDA 3B8SA 2E45A 5HUAA 5JH8A 2DT0A 2DMVA 2MLZA 3L4HA 4FAPA 3M7NA 2OLHA 4DRIA 1FKIA 2XP8A 2ZQTA 3RFWA 2IUZA 5HW6A 5CQ2A 3LE4A 4GLXA 3TCZA 3B9AA 3MCBB 1HKMA 1FKRA 2KO7A 5HKGA 2JX8A 4Z2JA 3KAIA 4XAKA 4Z2HA 1O6IA 5HT1A 5HBFA 2F23A 4J4OA 1HKJA 1GUVA 5E65A 2DT2A 1TFVA 1E6NA 2A3AA 4DWSA 3B9DA 3TC5A 4JFMA 1FKSA 3FAPA 1FFRA 2RE3A 2WLZA 1HKKA 4N19A 4PTMA 4Q7NA 1ZU8A 2ZAJA 4WKHA 2M8IA 3ARZA 3O5KA 3CH9A 1ITXA 1BL4A 2XP6A 2DSUA 1JCHB 2JZVA 4WJXA 1ROUA 1Y0OA 5GPRA 5B8IC 4WKFA 2ZR6A 3PR9A 3AS2A 4LGXA 2O9OA 1FKTA 1HKIA 3MQHA 1ZB5A 3ALFA 1FD9A 1EDQA 2B5UB 5HW7A 4LAXA 4C02B 1Q1CA 1LQ0A 1H0IA 2N87A 2LPVA 4JFJA 2ETNA 5HWBA 3WIJA 3NRKA 1LL4A 2DG3A 2WK2A 2P4VA 1K9TA 2WAEA 2O92A 3EIPA 2OFNA 1SYTA 4G50A 5J6EA 1PINA 4NNRA 5DO2A 2L2SA 4WIWA 2VCDA 2M8JA 1T11A 2MF9A 2PPNA 2KXQA 5D75A 1J4IA 4DWSB 1RD6A 2AOSA 1KT1A 1HJWA 1E44A 1WB0A 4QT2A 2PV2A 4MNKA 4W9QA 4Z2LA 1GPFA 1JMQA 2WM0A 1W1PA 2JMFA 3IHZA 1J4HA 2YSIA 2YBUA 1JNSA 1B6CA 3WD2A 1Q6HA 3CNGA 1EIBA 4URIA 5HW8A 4DRNA 2FDMA 1PBKA 3PRDA 4IQ2A 2AWGA 4JYSA 1R9HA 4L3NA 4Q22A 2MNTA 4W5UA 2IF4A 4LAWA 4DZ3A 1TR8A 2ESCA 1WNOA 2EZ5W 2RUCA 1K9QA 4ODQA 4ODMA 1FKKA 4MNJA 5DEZA 2M1IA 3O5MA 1LL6A 3CZ8A 3O5IA 2RUDA 4IT6A 2XP5A 1TK7A 5E62A 1YW5A 4P8UA 4KQZA 1D7HA 1OGGA 3KAGA 4IQCA 2F21A 1C9HA 3BMBA 4REXA 3CHCA 4ODKA 4W9PA 2DSVA 1EYMA 4DRJA 3O5GA 3UI4A 1FKHA 1NMWA 2K8IA 4DZ2A 3AS0A 1J4RA 2JXWA 3M85A 1L1PA 3GPKA 3CHEA 1A7XA 1ZBVA 2L4JA 1HJXA 4A0TA 3MQGA 2YAJB 4DT4A 3NTPA 3UI5A 1GRJA 1KFWA 2MLYA 5DIVA 4TW7A 3AS1A 1FFQA 2YSBA 1W1YA 2A3BA 3BXWA 3B9EA 3WD4A 4ODLA 1ZBWA 2ZR5A 1NWUA 2LKNA 2WADA 5AHTA 4TW8A 3UQBA 2ZQSA 1FKLA 5E66A 3CHFA 3UQIA 1GOIA 3VAWA 1HXVA 1QPLA 1RP5A 2F2DA 4U86A 2KI3A 4Z2IA 2G41A 2PN0A 2JV4A 4E5RA 4U85A 1U79A 1W1VA 4QZVB 1NMVA 2PPOA 1EQ3A 3ARYA 2PI6A 2XP7A 3FSBA 4ODNA 4MSPA 1FKJA 1M5YA 4GGQA 5HTGA 4S3KA 1LG1A 3KCEA 1E6RA 3NI6A 3O5QA 2DK7A 4LAYA 3O5RA 3FXYA 1JNDA 4R0XA 2XPBA 3QOKA 5DIUA 2M08A 1FJDA 5E5WA 2DG4A 2B31A 3ARTA 4L72B 2MPHA 3JYJA 2DT1A 4KR0B 4O2TA 3LKXA 1W26A 3ALGA 4DH0A 1W9UA 1FKGA 2RURA 1ZK6A 4TW6A 1QPFA 4MGVA 1QZ2A 3FS8A 4ML4A 4JFKA 4UDMA 2LGOA 2DK1A 3RM8A 1I5HW 3ODKA 1E6PA 1KT0A 2FAPA 2UZ5A 2VN1A 3G6MA 4ZS6A 3I6CA 1FKFA 4ODPA 3KAFA 1LJYA 1Q6UA 4IPXA 3GTYX 1VF8A 1FAPA 1NH6A 3O5DA 3KABA 4DRQA 3O5FA 1CTNA 2DWVA 4MNMA 1J6YA 1ZBCA 2ZQUA 4HBOA 1FKBA 3WD1A 1HJVA 4GIVA 2DSWA 4MAVA 1JNEA 1D7IA 4P8WA 3O5EA 4ODRA 1WR7A 1H0GA 3IK8A 2QRVA 1W9PA 4NZCA 3KACA 3WKZA 5GPGA 2PBCA 3WQVA 2DPEA 3PRAA 1ROTA 4NSBA 4TYOA 1JNTA 2RSEA 3ARXA 1X6LA 4J4NA 4P8XA 2KE0A 3LKXB 4P8VA 4AY1A 2F4EA 3PQHA 2XP3A 4DRMA 3ARQA 1NWTA 3OA5A 1F8AB 4W9OA 4WKAA 3KZ7A 3ARPA 4HBEA 4QT3A 3WL1A 4R5EA 2KFWA 2MDIA 2DG9A 3AS3A 3O5LA 2Y8NB 4DWSD 4MPKA 1BKFA 1JVWA 3W4RA 1WAWA 5DF0A 1FKDA 1X6NA 2KR7A 3UQAA 4LAVA 3CGMA 3UI6A 1NWRA 2Y78A 3WL0A 1O6WA 5I98A 3TDBA 3B7XA 2XP9A 3JYMA 4IT4A 3MDYB 1EHNA 2PV3A 4MTVA 3ARRA 1TCOC 2FKEA 1SR0A 3FY1A 4G2PA 4ZPVR 4JFIA 2XP4A 1E15A 1Q6IA 1YATA 5U47A 2G8ZA 2D9FA 1ZL1A 2DSZA 2LAJA 2PPPA 4FN2A 1NWSA 2YBTA 4DRPA 4DIPA 3AROA 4U84A 3RMEA 1OWQA 4WK9A 3KADA 2ZR4A 1LL7A 1W9VA 1EG3A 5GQBA 3WH0A 2DT3A 2M3OW 1ZCNA 4DRHA 1F40A 2YSFA 3ARVA 1E6ZA 4HARA 4DWSC 4BF8A 3O5JA 2MLXA 1D2KA 1UR9A 5DITA 1FLCA 1W1TA 2RUQA 2A3CA 3UF8A 3JXVA 3ARWA 3PRBA 3O5OA 2PV1A 3IKGA 1EG4A 1NSGA 4Z2KA 3RM9A 3LUOA 3RM4A 2EULA 1XHGA 3RGCA 4ZPTR 4A0UA 3FSCA 2OWOA 3WQWA 3KAHA 3MCBA 1P5QA 3OOBA 4DRKA 1ZBKA 4S3JA 1XRVA 5HWCA 2ZQVA 2Q5AA 2LJ4A 2RQSA 3GU0A 3O5PA 1D6OA 3PA7A 1D7JA 1LG2A 3CHDA 2ITKA 4MNLA 2XPAA 2WLYA 4Z2GA 4ZPWR 4ODOA
chains in the Genus database with same CATH topology
3EY6A 3H9RB 3CGNA 3ARSA 4ITZA 4JFLA 4DROA 2BA1A 3G6LA 2DJYA 2A3EA 5BXJA 2YSHA 3ARUA 3WD0A 5E64A 2QF8A 1E9LA 2M2AA 1K9RA 4TX0A 4QIBA 1WMVA 1N1AA 1OGBA 1IX5A 2YSGA 2KGJA 1UR8A 3WD3A 4TNSA 3AQUA 3IKDA 3B8SA 2E45A 5HUAA 5JH8A 2DT0A 2DMVA 2MLZA 3L4HA 4FAPA 3M7NA 2OLHA 4DRIA 1FKIA 2XP8A 2ZQTA 3RFWA 2IUZA 5HW6A 5CQ2A 3LE4A 4GLXA 3TCZA 3B9AA 3MCBB 1HKMA 1FKRA 2KO7A 5HKGA 2JX8A 4Z2JA 3KAIA 4XAKA 4Z2HA 1O6IA 5HT1A 5HBFA 4J4OA 1HKJA 1GUVA 5E65A 2DT2A 1TFVA 1E6NA 2A3AA 4DWSA 3B9DA 3TC5A 4JFMA 1FKSA 3FAPA 1FFRA 2RE3A 2WLZA 1HKKA 4N19A 4PTMA 4Q7NA 1ZU8A 2ZAJA 4WKHA 2M8IA 3ARZA 3O5KA 3CH9A 1ITXA 1BL4A 2XP6A 2DSUA 2JZVA 4WJXA 1ROUA 1Y0OA 5GPRA 5B8IC 4WKFA 2ZR6A 3PR9A 3AS2A 4LGXA 2O9OA 1FKTA 1HKIA 3MQHA 1ZB5A 3ALFA 1FD9A 1EDQA 5HW7A 4LAXA 4C02B 1Q1CA 1LQ0A 1H0IA 2N87A 2LPVA 4JFJA 5HWBA 3WIJA 3NRKA 1LL4A 2DG3A 2WK2A 1K9TA 2WAEA 2O92A 2OFNA 1SYTA 4G50A 5J6EA 1PINA 4NNRA 5DO2A 2L2SA 4WIWA 2VCDA 2M8JA 1T11A 2MF9A 2PPNA 2KXQA 5D75A 1J4IA 4DWSB 1RD6A 2AOSA 1KT1A 1HJWA 1WB0A 4QT2A 2PV2A 4MNKA 4W9QA 4Z2LA 1GPFA 1JMQA 2WM0A 1W1PA 2JMFA 3IHZA 1J4HA 2YSIA 2YBUA 1JNSA 1B6CA 3WD2A 1Q6HA 3CNGA 1EIBA 4URIA 5HW8A 4DRNA 2FDMA 1PBKA 3PRDA 4IQ2A 2AWGA 4JYSA 1R9HA 4L3NA 4Q22A 2MNTA 4W5UA 2IF4A 4LAWA 4DZ3A 1TR8A 2ESCA 1WNOA 2EZ5W 2RUCA 1K9QA 4ODQA 4ODMA 1FKKA 4MNJA 5DEZA 2M1IA 3O5MA 1LL6A 3CZ8A 3O5IA 2RUDA 4IT6A 2XP5A 1TK7A 5E62A 1YW5A 4P8UA 4KQZA 1D7HA 1OGGA 3KAGA 4IQCA 2F21A 1C9HA 4REXA 3CHCA 4ODKA 4W9PA 2DSVA 1EYMA 4DRJA 3O5GA 3UI4A 1FKHA 1NMWA 2K8IA 4DZ2A 3AS0A 1J4RA 2JXWA 3M85A 1L1PA 3GPKA 3CHEA 1A7XA 1HJXA 2L4JA 1ZBVA 4A0TA 3MQGA 2YAJB 4DT4A 3NTPA 3UI5A 1KFWA 2MLYA 5DIVA 4TW7A 3AS1A 1FFQA 2YSBA 1W1YA 2A3BA 3BXWA 3B9EA 3WD4A 4ODLA 1ZBWA 2ZR5A 1NWUA 2LKNA 2WADA 5AHTA 4TW8A 3UQBA 2ZQSA 1FKLA 5E66A 3CHFA 3UQIA 1GOIA 3VAWA 1HXVA 1QPLA 1RP5A 2F2DA 4U86A 2KI3A 4Z2IA 2G41A 2JV4A 4E5RA 4U85A 1U79A 1W1VA 4QZVB 1NMVA 2PPOA 1EQ3A 3ARYA 2PI6A 2XP7A 3FSBA 4ODNA 4MSPA 1FKJA 1M5YA 4GGQA 5HTGA 4S3KA 1LG1A 3KCEA 1E6RA 3NI6A 3O5QA 2DK7A 4LAYA 3O5RA 3FXYA 1JNDA 4R0XA 2XPBA 3QOKA 5DIUA 2M08A 1FJDA 5E5WA 2DG4A 2B31A 3ARTA 4L72B 2MPHA 3JYJA 2DT1A 4KR0B 4O2TA 3LKXA 1W26A 3ALGA 4DH0A 1W9UA 1FKGA 2RURA 1ZK6A 4TW6A 1QPFA 4MGVA 1QZ2A 3FS8A 4ML4A 4JFKA 2LGOA 2DK1A 3RM8A 1I5HW 3ODKA 1E6PA 1KT0A 2FAPA 2UZ5A 2VN1A 3G6MA 4ZS6A 3I6CA 1FKFA 4ODPA 3KAFA 1LJYA 1Q6UA 4IPXA 1VF8A 1FAPA 1NH6A 3O5DA 3KABA 4DRQA 3O5FA 1CTNA 2DWVA 4MNMA 1J6YA 1ZBCA 2ZQUA 4HBOA 1FKBA 3WD1A 1HJVA 4GIVA 2DSWA 4MAVA 1JNEA 1D7IA 4P8WA 3O5EA 4ODRA 1WR7A 1H0GA 3IK8A 2QRVA 1W9PA 4NZCA 3KACA 3WKZA 5GPGA 2PBCA 3WQVA 2DPEA 3PRAA 1ROTA 4NSBA 4TYOA 1JNTA 2RSEA 3ARXA 1X6LA 4J4NA 4P8XA 2KE0A 3LKXB 4P8VA 4AY1A 2F4EA 3PQHA 2XP3A 4DRMA 3ARQA 1NWTA 3OA5A 1F8AB 4W9OA 4WKAA 3KZ7A 3ARPA 4HBEA 4QT3A 3WL1A 4R5EA 2KFWA 2MDIA 2DG9A 3AS3A 3O5LA 2Y8NB 4DWSD 4MPKA 1BKFA 1JVWA 3W4RA 1WAWA 5DF0A 1FKDA 1X6NA 2KR7A 3UQAA 4LAVA 3CGMA 3UI6A 1NWRA 2Y78A 3WL0A 1O6WA 5I98A 3TDBA 3B7XA 2XP9A 3JYMA 4IT4A 3MDYB 1EHNA 2PV3A 4MTVA 3ARRA 1TCOC 2FKEA 1SR0A 3FY1A 4G2PA 4ZPVR 4JFIA 2XP4A 1E15A 1Q6IA 1YATA 5U47A 2G8ZA 2D9FA 1ZL1A 2DSZA 2LAJA 2PPPA 4FN2A 1NWSA 2YBTA 4DRPA 4DIPA 3AROA 4U84A 3RMEA 1OWQA 4WK9A 3KADA 2ZR4A 1LL7A 1W9VA 1EG3A 5GQBA 3WH0A 2DT3A 2M3OW 1ZCNA 4DRHA 1F40A 2YSFA 3ARVA 1E6ZA 4HARA 4DWSC 4BF8A 3O5JA 2MLXA 1D2KA 1UR9A 5DITA 1FLCA 1W1TA 2RUQA 2A3CA 3UF8A 3JXVA 3ARWA 3PRBA 3O5OA 2PV1A 3IKGA 1EG4A 1NSGA 4Z2KA 3RM9A 3LUOA 3RM4A 1XHGA 3RGCA 4ZPTR 4A0UA 3FSCA 2OWOA 3WQWA 3KAHA 3MCBA 1P5QA 3OOBA 4DRKA 1ZBKA 4S3JA 1XRVA 5HWCA 2ZQVA 2Q5AA 2LJ4A 2RQSA 3O5PA 1D6OA 3PA7A 1D7JA 1LG2A 3CHDA 2ITKA 4MNLA 2XPAA 2WLYA 4Z2GA 4ZPWR 4ODOA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3EY6 A;  3H9R B;  3CGN A;  4ITZ A;  4JFL A;  4DRO A;  2BA1 A;  2DJY A;  5BXJ A;  2YSH A;  2M2A A;  1K9R A;  4TX0 A;  4QIB A;  1WMV A;  1N1A A;  2YSG A;  2KGJ A;  4TNS A;  3IKD A;  2E45 A;  5HUA A;  4FAP A;  2DMV A;  2MLZ A;  3L4H A;  3M7N A;  4DRI A;  1FKI A;  2XP8 A;  2ZQT A;  3RFW A;  5HW6 A;  5CQ2 A;  3LE4 A;  3TCZ A;  1FKR A;  2KO7 A;  5HKG A;  2JX8 A;  3KAI A;  5HT1 A;  4J4O A;  3TC5 A;  4JFM A;  1FKS A;  3FAP A;  4N19 A;  2RE3 A;  2ZAJ A;  2M8I A;  3O5K A;  1BL4 A;  2XP6 A;  2JZV A;  1ROU A;  1Y0O A;  5B8I C;  2ZR6 A;  1FKT A;  1FD9 A;  5HW7 A;  4LAX A;  4C02 B;  1Q1C A;  2N87 A;  2LPV A;  4JFJ A;  5HWB A;  3NRK A;  2DG3 A;  2OFN A;  5J6E A;  4G50 A;  1PIN A;  4NNR A;  2L2S A;  2VCD A;  2M8J A;  1T11 A;  2MF9 A;  2PPN A;  2KXQ A;  5D75 A;  1J4I A;  1KT1 A;  4QT2 A;  2PV2 A;  4W9Q A;  1JMQ A;  3IHZ A;  2JMF A;  1J4H A;  2YSI A;  1JNS A;  1B6C A;  1Q6H A;  3CNG A;  5HW8 A;  4DRN A;  1PBK A;  3PRD A;  4IQ2 A;  2AWG A;  4JYS A;  1R9H A;  2MNT A;  2IF4 A;  4LAW A;  4DZ3 A;  2EZ5 W;  2RUC A;  1K9Q A;  4ODQ A;  4ODM A;  1FKK A;  2M1I A;  3O5M A;  3O5I A;  2RUD A;  2XP5 A;  1TK7 A;  1YW5 A;  1D7H A;  3KAG A;  4IQC A;  2F21 A;  1C9H A;  4REX A;  4ODK A;  4W9P A;  1EYM A;  4DRJ A;  3O5G A;  3UI4 A;  1FKH A;  1NMW A;  2K8I A;  4DZ2 A;  1J4R A;  2JXW A;  3M85 A;  1L1P A;  3GPK A;  1A7X A;  2L4J A;  4DT4 A;  3NTP A;  3UI5 A;  2MLY A;  5DIV A;  4TW7 A;  2YSB A;  4ODL A;  2ZR5 A;  2LKN A;  5AHT A;  4TW8 A;  3UQB A;  2ZQS A;  1FKL A;  3UQI A;  1HXV A;  3VAW A;  1QPL A;  2F2D A;  4U86 A;  2KI3 A;  2JV4 A;  4E5R A;  4U85 A;  1U79 A;  1NMV A;  2PPO A;  1EQ3 A;  2XP7 A;  4ODN A;  4MSP A;  1FKJ A;  1M5Y A;  4GGQ A;  5HTG A;  3KCE A;  3NI6 A;  3O5Q A;  2DK7 A;  4LAY A;  3O5R A;  4R0X A;  2XPB A;  5DIU A;  2M08 A;  1FJD A;  2DG4 A;  2MPH A;  3JYJ A;  4O2T A;  1W26 A;  4DH0 A;  1FKG A;  2RUR A;  1ZK6 A;  4TW6 A;  1QPF A;  4MGV A;  1QZ2 A;  4JFK A;  2LGO A;  2DK1 A;  1I5H W;  3ODK A;  1KT0 A;  2FAP A;  2UZ5 A;  2VN1 A;  3I6C A;  1FKF A;  4ODP A;  3KAF A;  1Q6U A;  4IPX A;  1FAP A;  3O5D A;  3KAB A;  4DRQ A;  3O5F A;  2DWV A;  1J6Y A;  2ZQU A;  1FKB A;  4GIV A;  1D7I A;  3O5E A;  4ODR A;  1WR7 A;  3IK8 A;  3KAC A;  5GPG A;  2PBC A;  1ROT A;  4TYO A;  1JNT A;  2RSE A;  4J4N A;  2KE0 A;  2F4E A;  2XP3 A;  4DRM A;  1F8A B;  4W9O A;  3KZ7 A;  4QT3 A;  2KFW A;  2MDI A;  2DG9 A;  3O5L A;  1BKF A;  1JVW A;  1FKD A;  2KR7 A;  3UQA A;  4LAV A;  3CGM A;  3UI6 A;  2Y78 A;  1O6W A;  5I98 A;  3TDB A;  3B7X A;  2XP9 A;  3JYM A;  3MDY B;  2PV3 A;  1TCO C;  2FKE A;  4G2P A;  4JFI A;  2XP4 A;  1Q6I A;  1YAT A;  2D9F A;  2LAJ A;  2PPP A;  4FN2 A;  4DRP A;  4DIP A;  4U84 A;  3KAD A;  2ZR4 A;  1EG3 A;  3WH0 A;  2M3O W;  1ZCN A;  4DRH A;  1F40 A;  2YSF A;  4BF8 A;  3O5J A;  2MLX A;  5DIT A;  2RUQ A;  3UF8 A;  3JXV A;  3PRB A;  3O5O A;  2PV1 A;  3IKG A;  1EG4 A;  1NSG A;  3LUO A;  3RGC A;  3KAH A;  1P5Q A;  3OOB A;  4DRK A;  5HWC A;  2ZQV A;  2Q5A A;  2LJ4 A;  2RQS A;  3O5P A;  1D6O A;  3PA7 A;  1D7J A;  2ITK A;  2XPA A;  4ODO A; 
#chains in the Genus database with same CATH topology
 3EY6 A;  3H9R B;  3CGN A;  3ARS A;  4ITZ A;  4JFL A;  4DRO A;  2BA1 A;  3G6L A;  2DJY A;  2A3E A;  5BXJ A;  2YSH A;  3ARU A;  3WD0 A;  5E64 A;  2QF8 A;  1E9L A;  2M2A A;  1K9R A;  4TX0 A;  4QIB A;  1WMV A;  1N1A A;  1OGB A;  1IX5 A;  2YSG A;  2KGJ A;  1UR8 A;  3WD3 A;  4TNS A;  3AQU A;  3IKD A;  3B8S A;  2E45 A;  5HUA A;  5JH8 A;  2DT0 A;  2DMV A;  2MLZ A;  3L4H A;  4FAP A;  3M7N A;  2OLH A;  4DRI A;  1FKI A;  2XP8 A;  2ZQT A;  3RFW A;  2IUZ A;  5HW6 A;  5CQ2 A;  3LE4 A;  4GLX A;  3TCZ A;  3B9A A;  3MCB B;  1HKM A;  1FKR A;  2KO7 A;  5HKG A;  2JX8 A;  4Z2J A;  3KAI A;  4XAK A;  4Z2H A;  1O6I A;  5HT1 A;  5HBF A;  2F23 A;  4J4O A;  1HKJ A;  1GUV A;  5E65 A;  2DT2 A;  1TFV A;  1E6N A;  2A3A A;  4DWS A;  3B9D A;  3TC5 A;  4JFM A;  1FKS A;  3FAP A;  1FFR A;  2RE3 A;  2WLZ A;  1HKK A;  4N19 A;  4PTM A;  4Q7N A;  1ZU8 A;  2ZAJ A;  4WKH A;  2M8I A;  3ARZ A;  3O5K A;  3CH9 A;  1ITX A;  1BL4 A;  2XP6 A;  2DSU A;  1JCH B;  2JZV A;  4WJX A;  1ROU A;  1Y0O A;  5GPR A;  5B8I C;  4WKF A;  2ZR6 A;  3PR9 A;  3AS2 A;  4LGX A;  2O9O A;  1FKT A;  1HKI A;  3MQH A;  1ZB5 A;  3ALF A;  1FD9 A;  1EDQ A;  2B5U B;  5HW7 A;  4LAX A;  4C02 B;  1Q1C A;  1LQ0 A;  1H0I A;  2N87 A;  2LPV A;  4JFJ A;  2ETN A;  5HWB A;  3WIJ A;  3NRK A;  1LL4 A;  2DG3 A;  2WK2 A;  2P4V A;  1K9T A;  2WAE A;  2O92 A;  3EIP A;  2OFN A;  1SYT A;  4G50 A;  5J6E A;  1PIN A;  4NNR A;  5DO2 A;  2L2S A;  4WIW A;  2VCD A;  2M8J A;  1T11 A;  2MF9 A;  2PPN A;  2KXQ A;  5D75 A;  1J4I A;  4DWS B;  1RD6 A;  2AOS A;  1KT1 A;  1HJW A;  1E44 A;  1WB0 A;  4QT2 A;  2PV2 A;  4MNK A;  4W9Q A;  4Z2L A;  1GPF A;  1JMQ A;  2WM0 A;  1W1P A;  2JMF A;  3IHZ A;  1J4H A;  2YSI A;  2YBU A;  1JNS A;  1B6C A;  3WD2 A;  1Q6H A;  3CNG A;  1EIB A;  4URI A;  5HW8 A;  4DRN A;  2FDM A;  1PBK A;  3PRD A;  4IQ2 A;  2AWG A;  4JYS A;  1R9H A;  4L3N A;  4Q22 A;  2MNT A;  4W5U A;  2IF4 A;  4LAW A;  4DZ3 A;  1TR8 A;  2ESC A;  1WNO A;  2EZ5 W;  2RUC A;  1K9Q A;  4ODQ A;  4ODM A;  1FKK A;  4MNJ A;  5DEZ A;  2M1I A;  3O5M A;  1LL6 A;  3CZ8 A;  3O5I A;  2RUD A;  4IT6 A;  2XP5 A;  1TK7 A;  5E62 A;  1YW5 A;  4P8U A;  4KQZ A;  1D7H A;  1OGG A;  3KAG A;  4IQC A;  2F21 A;  1C9H A;  3BMB A;  4REX A;  3CHC A;  4ODK A;  4W9P A;  2DSV A;  1EYM A;  4DRJ A;  3O5G A;  3UI4 A;  1FKH A;  1NMW A;  2K8I A;  4DZ2 A;  3AS0 A;  1J4R A;  2JXW A;  3M85 A;  1L1P A;  3GPK A;  3CHE A;  1A7X A;  1ZBV A;  2L4J A;  1HJX A;  4A0T A;  3MQG A;  2YAJ B;  4DT4 A;  3NTP A;  3UI5 A;  1GRJ A;  1KFW A;  2MLY A;  5DIV A;  4TW7 A;  3AS1 A;  1FFQ A;  2YSB A;  1W1Y A;  2A3B A;  3BXW A;  3B9E A;  3WD4 A;  4ODL A;  1ZBW A;  2ZR5 A;  1NWU A;  2LKN A;  2WAD A;  5AHT A;  4TW8 A;  3UQB A;  2ZQS A;  1FKL A;  5E66 A;  3CHF A;  3UQI A;  1GOI A;  3VAW A;  1HXV A;  1QPL A;  1RP5 A;  2F2D A;  4U86 A;  2KI3 A;  4Z2I A;  2G41 A;  2PN0 A;  2JV4 A;  4E5R A;  4U85 A;  1U79 A;  1W1V A;  4QZV B;  1NMV A;  2PPO A;  1EQ3 A;  3ARY A;  2PI6 A;  2XP7 A;  3FSB A;  4ODN A;  4MSP A;  1FKJ A;  1M5Y A;  4GGQ A;  5HTG A;  4S3K A;  1LG1 A;  3KCE A;  1E6R A;  3NI6 A;  3O5Q A;  2DK7 A;  4LAY A;  3O5R A;  3FXY A;  1JND A;  4R0X A;  2XPB A;  3QOK A;  5DIU A;  2M08 A;  1FJD A;  5E5W A;  2DG4 A;  2B31 A;  3ART A;  4L72 B;  2MPH A;  3JYJ A;  2DT1 A;  4KR0 B;  4O2T A;  3LKX A;  1W26 A;  3ALG A;  4DH0 A;  1W9U A;  1FKG A;  2RUR A;  1ZK6 A;  4TW6 A;  1QPF A;  4MGV A;  1QZ2 A;  3FS8 A;  4ML4 A;  4JFK A;  4UDM A;  2LGO A;  2DK1 A;  3RM8 A;  1I5H W;  3ODK A;  1E6P A;  1KT0 A;  2FAP A;  2UZ5 A;  2VN1 A;  3G6M A;  4ZS6 A;  3I6C A;  1FKF A;  4ODP A;  3KAF A;  1LJY A;  1Q6U A;  4IPX A;  3GTY X;  1VF8 A;  1FAP A;  1NH6 A;  3O5D A;  3KAB A;  4DRQ A;  3O5F A;  1CTN A;  2DWV A;  4MNM A;  1J6Y A;  1ZBC A;  2ZQU A;  4HBO A;  1FKB A;  3WD1 A;  1HJV A;  4GIV A;  2DSW A;  4MAV A;  1JNE A;  1D7I A;  4P8W A;  3O5E A;  4ODR A;  1WR7 A;  1H0G A;  3IK8 A;  2QRV A;  1W9P A;  4NZC A;  3KAC A;  3WKZ A;  5GPG A;  2PBC A;  3WQV A;  2DPE A;  3PRA A;  1ROT A;  4NSB A;  4TYO A;  1JNT A;  2RSE A;  3ARX A;  1X6L A;  4J4N A;  4P8X A;  2KE0 A;  3LKX B;  4P8V A;  4AY1 A;  2F4E A;  3PQH A;  2XP3 A;  4DRM A;  3ARQ A;  1NWT A;  3OA5 A;  1F8A B;  4W9O A;  4WKA A;  3KZ7 A;  3ARP A;  4HBE A;  4QT3 A;  3WL1 A;  4R5E A;  2KFW A;  2MDI A;  2DG9 A;  3AS3 A;  3O5L A;  2Y8N B;  4DWS D;  4MPK A;  1BKF A;  1JVW A;  3W4R A;  1WAW A;  5DF0 A;  1FKD A;  1X6N A;  2KR7 A;  3UQA A;  4LAV A;  3CGM A;  3UI6 A;  1NWR A;  2Y78 A;  3WL0 A;  1O6W A;  5I98 A;  3TDB A;  3B7X A;  2XP9 A;  3JYM A;  4IT4 A;  3MDY B;  1EHN A;  2PV3 A;  4MTV A;  3ARR A;  1TCO C;  2FKE A;  1SR0 A;  3FY1 A;  4G2P A;  4ZPV R;  4JFI A;  2XP4 A;  1E15 A;  1Q6I A;  1YAT A;  5U47 A;  2G8Z A;  2D9F A;  1ZL1 A;  2DSZ A;  2LAJ A;  2PPP A;  4FN2 A;  1NWS A;  2YBT A;  4DRP A;  4DIP A;  3ARO A;  4U84 A;  3RME A;  1OWQ A;  4WK9 A;  3KAD A;  2ZR4 A;  1LL7 A;  1W9V A;  1EG3 A;  5GQB A;  3WH0 A;  2DT3 A;  2M3O W;  1ZCN A;  4DRH A;  1F40 A;  2YSF A;  3ARV A;  1E6Z A;  4HAR A;  4DWS C;  4BF8 A;  3O5J A;  2MLX A;  1D2K A;  1UR9 A;  5DIT A;  1FLC A;  1W1T A;  2RUQ A;  2A3C A;  3UF8 A;  3JXV A;  3ARW A;  3PRB A;  3O5O A;  2PV1 A;  3IKG A;  1EG4 A;  1NSG A;  4Z2K A;  3RM9 A;  3LUO A;  3RM4 A;  2EUL A;  1XHG A;  3RGC A;  4ZPT R;  4A0U A;  3FSC A;  2OWO A;  3WQW A;  3KAH A;  3MCB A;  1P5Q A;  3OOB A;  4DRK A;  1ZBK A;  4S3J A;  1XRV A;  5HWC A;  2ZQV A;  2Q5A A;  2LJ4 A;  2RQS A;  3GU0 A;  3O5P A;  1D6O A;  3PA7 A;  1D7J A;  1LG2 A;  3CHD A;  2ITK A;  4MNL A;  2XPA A;  2WLY A;  4Z2G A;  4ZPW R;  4ODO A; 
#chains in the Genus database with same CATH homology
 3EY6 A;  3H9R B;  3CGN A;  3ARS A;  4ITZ A;  4JFL A;  4DRO A;  2BA1 A;  3G6L A;  2DJY A;  2A3E A;  5BXJ A;  2YSH A;  3ARU A;  3WD0 A;  5E64 A;  2QF8 A;  1E9L A;  2M2A A;  1K9R A;  4TX0 A;  4QIB A;  1WMV A;  1N1A A;  1OGB A;  1IX5 A;  2YSG A;  2KGJ A;  1UR8 A;  3WD3 A;  4TNS A;  3AQU A;  3IKD A;  3B8S A;  2E45 A;  5HUA A;  5JH8 A;  2DT0 A;  2DMV A;  2MLZ A;  3L4H A;  4FAP A;  3M7N A;  2OLH A;  4DRI A;  1FKI A;  2XP8 A;  2ZQT A;  3RFW A;  2IUZ A;  5HW6 A;  5CQ2 A;  3LE4 A;  4GLX A;  3TCZ A;  3B9A A;  3MCB B;  1HKM A;  1FKR A;  2KO7 A;  5HKG A;  2JX8 A;  4Z2J A;  3KAI A;  4XAK A;  4Z2H A;  1O6I A;  5HT1 A;  5HBF A;  4J4O A;  1HKJ A;  1GUV A;  5E65 A;  2DT2 A;  1TFV A;  1E6N A;  2A3A A;  4DWS A;  3B9D A;  3TC5 A;  4JFM A;  1FKS A;  3FAP A;  1FFR A;  2RE3 A;  2WLZ A;  1HKK A;  4N19 A;  4PTM A;  4Q7N A;  1ZU8 A;  2ZAJ A;  4WKH A;  2M8I A;  3ARZ A;  3O5K A;  3CH9 A;  1ITX A;  1BL4 A;  2XP6 A;  2DSU A;  2JZV A;  4WJX A;  1ROU A;  1Y0O A;  5GPR A;  5B8I C;  4WKF A;  2ZR6 A;  3PR9 A;  3AS2 A;  4LGX A;  2O9O A;  1FKT A;  1HKI A;  3MQH A;  1ZB5 A;  3ALF A;  1FD9 A;  1EDQ A;  5HW7 A;  4LAX A;  4C02 B;  1Q1C A;  1LQ0 A;  1H0I A;  2N87 A;  2LPV A;  4JFJ A;  5HWB A;  3WIJ A;  3NRK A;  1LL4 A;  2DG3 A;  2WK2 A;  1K9T A;  2WAE A;  2O92 A;  2OFN A;  1SYT A;  4G50 A;  5J6E A;  1PIN A;  4NNR A;  5DO2 A;  2L2S A;  4WIW A;  2VCD A;  2M8J A;  1T11 A;  2MF9 A;  2PPN A;  2KXQ A;  5D75 A;  1J4I A;  4DWS B;  1RD6 A;  2AOS A;  1KT1 A;  1HJW A;  1WB0 A;  4QT2 A;  2PV2 A;  4MNK A;  4W9Q A;  4Z2L A;  1GPF A;  1JMQ A;  2WM0 A;  1W1P A;  2JMF A;  3IHZ A;  1J4H A;  2YSI A;  2YBU A;  1JNS A;  1B6C A;  3WD2 A;  1Q6H A;  3CNG A;  1EIB A;  4URI A;  5HW8 A;  4DRN A;  2FDM A;  1PBK A;  3PRD A;  4IQ2 A;  2AWG A;  4JYS A;  1R9H A;  4L3N A;  4Q22 A;  2MNT A;  4W5U A;  2IF4 A;  4LAW A;  4DZ3 A;  1TR8 A;  2ESC A;  1WNO A;  2EZ5 W;  2RUC A;  1K9Q A;  4ODQ A;  4ODM A;  1FKK A;  4MNJ A;  5DEZ A;  2M1I A;  3O5M A;  1LL6 A;  3CZ8 A;  3O5I A;  2RUD A;  4IT6 A;  2XP5 A;  1TK7 A;  5E62 A;  1YW5 A;  4P8U A;  4KQZ A;  1D7H A;  1OGG A;  3KAG A;  4IQC A;  2F21 A;  1C9H A;  4REX A;  3CHC A;  4ODK A;  4W9P A;  2DSV A;  1EYM A;  4DRJ A;  3O5G A;  3UI4 A;  1FKH A;  1NMW A;  2K8I A;  4DZ2 A;  3AS0 A;  1J4R A;  2JXW A;  3M85 A;  1L1P A;  3GPK A;  3CHE A;  1A7X A;  1HJX A;  2L4J A;  1ZBV A;  4A0T A;  3MQG A;  2YAJ B;  4DT4 A;  3NTP A;  3UI5 A;  1KFW A;  2MLY A;  5DIV A;  4TW7 A;  3AS1 A;  1FFQ A;  2YSB A;  1W1Y A;  2A3B A;  3BXW A;  3B9E A;  3WD4 A;  4ODL A;  1ZBW A;  2ZR5 A;  1NWU A;  2LKN A;  2WAD A;  5AHT A;  4TW8 A;  3UQB A;  2ZQS A;  1FKL A;  5E66 A;  3CHF A;  3UQI A;  1GOI A;  3VAW A;  1HXV A;  1QPL A;  1RP5 A;  2F2D A;  4U86 A;  2KI3 A;  4Z2I A;  2G41 A;  2JV4 A;  4E5R A;  4U85 A;  1U79 A;  1W1V A;  4QZV B;  1NMV A;  2PPO A;  1EQ3 A;  3ARY A;  2PI6 A;  2XP7 A;  3FSB A;  4ODN A;  4MSP A;  1FKJ A;  1M5Y A;  4GGQ A;  5HTG A;  4S3K A;  1LG1 A;  3KCE A;  1E6R A;  3NI6 A;  3O5Q A;  2DK7 A;  4LAY A;  3O5R A;  3FXY A;  1JND A;  4R0X A;  2XPB A;  3QOK A;  5DIU A;  2M08 A;  1FJD A;  5E5W A;  2DG4 A;  2B31 A;  3ART A;  4L72 B;  2MPH A;  3JYJ A;  2DT1 A;  4KR0 B;  4O2T A;  3LKX A;  1W26 A;  3ALG A;  4DH0 A;  1W9U A;  1FKG A;  2RUR A;  1ZK6 A;  4TW6 A;  1QPF A;  4MGV A;  1QZ2 A;  3FS8 A;  4ML4 A;  4JFK A;  2LGO A;  2DK1 A;  3RM8 A;  1I5H W;  3ODK A;  1E6P A;  1KT0 A;  2FAP A;  2UZ5 A;  2VN1 A;  3G6M A;  4ZS6 A;  3I6C A;  1FKF A;  4ODP A;  3KAF A;  1LJY A;  1Q6U A;  4IPX A;  1VF8 A;  1FAP A;  1NH6 A;  3O5D A;  3KAB A;  4DRQ A;  3O5F A;  1CTN A;  2DWV A;  4MNM A;  1J6Y A;  1ZBC A;  2ZQU A;  4HBO A;  1FKB A;  3WD1 A;  1HJV A;  4GIV A;  2DSW A;  4MAV A;  1JNE A;  1D7I A;  4P8W A;  3O5E A;  4ODR A;  1WR7 A;  1H0G A;  3IK8 A;  2QRV A;  1W9P A;  4NZC A;  3KAC A;  3WKZ A;  5GPG A;  2PBC A;  3WQV A;  2DPE A;  3PRA A;  1ROT A;  4NSB A;  4TYO A;  1JNT A;  2RSE A;  3ARX A;  1X6L A;  4J4N A;  4P8X A;  2KE0 A;  3LKX B;  4P8V A;  4AY1 A;  2F4E A;  3PQH A;  2XP3 A;  4DRM A;  3ARQ A;  1NWT A;  3OA5 A;  1F8A B;  4W9O A;  4WKA A;  3KZ7 A;  3ARP A;  4HBE A;  4QT3 A;  3WL1 A;  4R5E A;  2KFW A;  2MDI A;  2DG9 A;  3AS3 A;  3O5L A;  2Y8N B;  4DWS D;  4MPK A;  1BKF A;  1JVW A;  3W4R A;  1WAW A;  5DF0 A;  1FKD A;  1X6N A;  2KR7 A;  3UQA A;  4LAV A;  3CGM A;  3UI6 A;  1NWR A;  2Y78 A;  3WL0 A;  1O6W A;  5I98 A;  3TDB A;  3B7X A;  2XP9 A;  3JYM A;  4IT4 A;  3MDY B;  1EHN A;  2PV3 A;  4MTV A;  3ARR A;  1TCO C;  2FKE A;  1SR0 A;  3FY1 A;  4G2P A;  4ZPV R;  4JFI A;  2XP4 A;  1E15 A;  1Q6I A;  1YAT A;  5U47 A;  2G8Z A;  2D9F A;  1ZL1 A;  2DSZ A;  2LAJ A;  2PPP A;  4FN2 A;  1NWS A;  2YBT A;  4DRP A;  4DIP A;  3ARO A;  4U84 A;  3RME A;  1OWQ A;  4WK9 A;  3KAD A;  2ZR4 A;  1LL7 A;  1W9V A;  1EG3 A;  5GQB A;  3WH0 A;  2DT3 A;  2M3O W;  1ZCN A;  4DRH A;  1F40 A;  2YSF A;  3ARV A;  1E6Z A;  4HAR A;  4DWS C;  4BF8 A;  3O5J A;  2MLX A;  1D2K A;  1UR9 A;  5DIT A;  1FLC A;  1W1T A;  2RUQ A;  2A3C A;  3UF8 A;  3JXV A;  3ARW A;  3PRB A;  3O5O A;  2PV1 A;  3IKG A;  1EG4 A;  1NSG A;  4Z2K A;  3RM9 A;  3LUO A;  3RM4 A;  1XHG A;  3RGC A;  4ZPT R;  4A0U A;  3FSC A;  2OWO A;  3WQW A;  3KAH A;  3MCB A;  1P5Q A;  3OOB A;  4DRK A;  1ZBK A;  4S3J A;  1XRV A;  5HWC A;  2ZQV A;  2Q5A A;  2LJ4 A;  2RQS A;  3O5P A;  1D6O A;  3PA7 A;  1D7J A;  1LG2 A;  3CHD A;  2ITK A;  4MNL A;  2XPA A;  2WLY A;  4Z2G A;  4ZPW R;  4ODO A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...