2ZR6A

Crystal structure of a mutant pin1 peptidyl-prolyl cis-trans isomerase
Total Genus 39
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
39
sequence length
158
structure length
153
Chain Sequence
b'KLPPGWEKAMSRSSGRVYYFNHITNASQWERPSGGKNGQGEPARVRCSHLLVKHSQSRRPSSWRQEKITRTKEEALELINGYIQKIKSGEEDFESLASQFSDCSSAKARGDLGAFSRGQMQKPFEDASFALRTGEMSGPVFTDSGIHIILRTE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Peptidyl-prolyl cis-trans isomerase NIMA-interacting 1
publication title Structural studies on PIN1 mutants
rcsb
source organism Homo sapiens
molecule tags Isomerase
total genus 39
structure length 153
sequence length 158
ec nomenclature ec 5.2.1.8: Peptidylprolyl isomerase.
pdb deposition date 2008-08-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00397 WW WW domain
A PF00639 Rotamase PPIC-type PPIASE domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.20.70.10 Mainly Beta Single Sheet Ubiquitin Ligase Nedd4; Chain: W; Ubiquitin Ligase Nedd4; Chain: W; 2zr6A01
3.10.50.40 Alpha Beta Roll Chitinase A; domain 3 Chitinase A; domain 3 2zr6A02
1ROUA 2KR7A 2ZQVA 3RGCA 5GPGA 1ZK6A 2RURA 4DROA 2ZQSA 1JNTA 4G2PA 1KT1A 4LAYA 1EYMA 1NMWA 1EQ3A 3KZ7A 4JFMA 3KAGA 1Q6IA 5HTGA 2YSHA 1YW5A 1PINA 3NI6A 5J6EA 2XP7A 4W9QA 2F4EA 4ITZA 1J6YA 3LUOA 1FD9A 2KI3A 1EG3A 2PV3A 4ODMA 4DRKA 2M08A 3LE4A 4DRQA 3KABA 1EG4A 2OFNA 2E45A 5BXJA 3NRKA 3O5RA 2MLYA 2PPOA 2RUDA 2XPBA 3O5IA 2M8IA 1FKTA 4G50A 2LPVA 1WMVA 4J4OA 3UQAA 1NMVA 4ODOA 4GGQA 4IPXA 3O5LA 3MDYB 3UI6A 1F8AB 1B6CA 5DIUA 2PV1A 3O5JA 3ODKA 4ODLA 5HW6A 3IHZA 1Q1CA 1I5HW 1QPLA 5AHTA 3O5DA 1D6OA 2DJYA 1L1PA 1HXVA 4DRPA 4DRJA 1Q6UA 2DG4A 4ODNA 5DIVA 3UI5A 3TDBA 1ROTA 2BA1A 3PRBA 3OOBA 3PA7A 2MLXA 2ZR4A 4JFLA 1QZ2A 2D9FA 3UF8A 2MDIA 3IKGA 5I98A 2XP8A 4GIVA 4REXA 1D7HA 4ODPA 1FKSA 3KCEA 4TW6A 4JFKA 1QPFA 2KGJA 2RSEA 4O2TA 5HWBA 1FKIA 1M5YA 3KAHA 1WR7A 2DK1A 1FKKA 4U86A 5DITA 1T11A 1KT0A 1J4IA 2MNTA 2DK7A 2JX8A 3O5PA 1FKJA 1W26A 2EZ5W 2LGOA 4NNRA 2JV4A 3IK8A 1FKDA 4DT4A 4TX0A 1FKLA 5HUAA 2ZQUA 1F40A 4MSPA 3M85A 3CGNA 2VCDA 1P5QA 2DG3A 4JFIA 2DMVA 4J4NA 4JFJA 4E5RA 1FKBA 3O5OA 4N19A 3L4HA 1K9RA 4W9OA 1O6WA 3I6CA 3JYMA 3O5GA 3PRDA 4U84A 2KXQA 4FN2A 2LKNA 1J4RA 1FJDA 1JMQA 3TCZA 2F2DA 4QIBA 5HT1A 4ODKA 2AWGA 2L4JA 3KACA 4DH0A 4LAWA 3O5KA 2K8IA 1N1AA 1FAPA 2XP3A 5HW7A 3JYJA 5HKGA 1BL4A 2VN1A 2JMFA 4QT3A 3JXVA 1JVWA 4QT2A 3IKDA 4ODQA 3UQBA 4DZ3A 3VAWA 1JNSA 3UI4A 1FKHA 4LAXA 2M8JA 3H9RB 4U85A 2JXWA 1NSGA 2ZR5A 2RE3A 2XP6A 1J4HA 3CNGA 2N87A 5B8IC 1YATA 2PPPA 1Y0OA 4MGVA 4BF8A 3O5FA 4DRMA 4DRNA 2ZQTA 1BKFA 2RUCA 2PBCA 4DRIA 2M2AA 4IQ2A 4TW7A 2RQSA 4FAPA 5CQ2A 2YSGA 3CGMA 2FAPA 1TCOC 3EY6A 4ODRA 1FKRA 4LAVA 3TC5A 3KAIA 5HW8A 4DRHA 2XP9A 4W9PA 3NTPA 2XP5A 2YSBA 4DZ2A 2Q5AA 2LAJA 2YSIA 3FAPA 2ZAJA 4TNSA 1ZCNA 4JYSA 2YSFA 5HWCA 2ZR6A 2FKEA 1C9HA 1TK7A 2RUQA 2IF4A 1U79A 4DIPA 2MLZA 3RFWA 1Q6HA 3O5MA 2DWVA 3M7NA 1A7XA 3UQIA 4C02B 2UZ5A 2DG9A 4TW8A 1FKFA 4TYOA 2KFWA 2M1IA 2PPNA 3O5QA 4IQCA 1PBKA 2XPAA 3O5EA 2MF9A 3KAFA 3KADA 2Y78A 2KO7A 1R9HA 2ITKA 3B7XA 2M3OW 5D75A 2LJ4A 3WH0A 3GPKA 2XP4A 1D7JA 4R0XA 2MPHA 1FKGA 2JZVA 1D7IA 2KE0A 2L2SA 2PV2A 1K9QA 2F21A
chains in the Genus database with same CATH superfamily
1HJWA 2ESCA 1ROUA 1W1YA 1ZL1A 2KR7A 2DT1A 4DWSC 2ZQVA 3RGCA 1JCHB 5GPGA 1ZK6A 2RURA 4DROA 2ZQSA 1JNTA 1JNEA 4G2PA 1KT1A 4LAYA 1LG2A 1LL6A 1EYMA 1NMWA 1EQ3A 4GLXA 1ZBWA 4WJXA 1O6IA 3KZ7A 4HBEA 4JFMA 3KAGA 1Q6IA 5HTGA 2YSHA 1YW5A 1PINA 3NI6A 5J6EA 1OGBA 2XP7A 4W9QA 1NH6A 2F4EA 3AS0A 4ITZA 4S3KA 4LGXA 1J6YA 4MNLA 4P8WA 3LUOA 4Z2LA 3RM4A 3AS1A 4S3JA 1ZBKA 1FD9A 2B31A 2KI3A 1EG3A 3AQUA 2PV3A 3BXWA 2G41A 4ODMA 4DRKA 4XAKA 5U47A 2WADA 2M08A 3LE4A 1XHGA 4DRQA 3KABA 1EG4A 3WL1A 2B5UB 1E6PA 2OFNA 2E45A 2DT0A 5BXJA 3NRKA 3O5RA 1H0IA 3G6LA 2MLYA 3LKXA 5E66A 2PPOA 2RUDA 4Q7NA 2XPBA 3O5IA 2M8IA 1FKTA 4G50A 2LPVA 1OGGA 1WMVA 4J4OA 2DSVA 3UQAA 1NMVA 4ODOA 4GGQA 2DPEA 4WIWA 4IPXA 3O5LA 3WD1A 3MDYB 3UI6A 5GQBA 4R5EA 3CHCA 4Z2HA 2FDMA 1F8AB 2PN0A 1B6CA 3MCBB 2G8ZA 5DIUA 2PV1A 3O5JA 3ODKA 1GOIA 4ODLA 4UDMA 5HW6A 3IHZA 1Q1CA 1I5HW 1QPLA 5AHTA 3O5DA 4MNJA 3B9DA 1D6OA 3RMEA 1FLCA 4ZPWR 2DJYA 1L1PA 4AY1A 3WQVA 1W1PA 4ZPVR 1E6NA 3AROA 1HXVA 4DRPA 4W5UA 4DRJA 1Q6UA 2DG4A 4ODNA 5DIVA 3UI5A 3TDBA 1ROTA 2BA1A 3PRBA 1EHNA 1KFWA 3OOBA 3PA7A 5JH8A 2MLXA 2PI6A 2ZR4A 4JFLA 1QZ2A 2D9FA 3UF8A 4HARA 2WK2A 2MDIA 2A3AA 3IKGA 1LG1A 5I98A 2XP8A 3ARXA 4GIVA 4REXA 1D7HA 1E15A 1FFQA 2O92A 4ODPA 4ZPTR 1FKSA 4WKHA 4L3NA 5GPRA 3KCEA 4TW6A 4JFKA 3WD4A 2WM0A 1QPFA 1H0GA 2DSZA 2KGJA 3FSCA 4P8VA 2RSEA 1D2KA 1LJYA 4O2TA 3RM9A 2Y8NB 5HWBA 1FKIA 1ZU8A 1NWUA 4WKAA 1M5YA 3KAHA 4URIA 1E6ZA 4P8XA 1WR7A 1RP5A 2DK1A 1FKKA 4ML4A 4U86A 5DITA 1T11A 3AS2A 1KT0A 3LKXB 3WD0A 1X6NA 1J4IA 3WIJA 1IX5A 2MNTA 2DK7A 2JX8A 3O5PA 3CHEA 1FKJA 1W26A 2EZ5W 2EULA 1NWTA 2WAEA 2LGOA 4NNRA 2JV4A 3FXYA 3IK8A 1FKDA 4DT4A 4DWSB 4TX0A 4QZVB 1FKLA 5HUAA 1W9UA 1WB0A 2ZQUA 3WD2A 4WK9A 1F40A 3PQHA 3PRAA 4MSPA 3M85A 3CGNA 2VCDA 1P5QA 2DG3A 4JFIA 5E62A 1JNDA 2DMVA 2QRVA 4J4NA 4JFJA 4E5RA 1FKBA 1X6LA 3O5OA 3ALGA 3OA5A 1XRVA 4N19A 3CHDA 1E6RA 3L4HA 3CHFA 3PR9A 1K9RA 4W9OA 1O6WA 3I6CA 3G6MA 3JYMA 3O5GA 3PRDA 3CZ8A 1W9PA 1GPFA 4U84A 1UR9A 5DEZA 2KXQA 4FN2A 2LKNA 1J4RA 1FJDA 3AS3A 1JMQA 3TCZA 2F2DA 3FSBA 4QIBA 4WKFA 5HT1A 4ODKA 3BMBA 3ARVA 5DF0A 2AWGA 2L4JA 3FS8A 1EDQA 3KACA 4MNMA 4DH0A 4LAWA 3O5KA 2K8IA 1N1AA 1FAPA 4Z2KA 2YAJB 4Q22A 2XP3A 3GTYX 5HW7A 3JYJA 2DT2A 1ZBCA 5HKGA 1BL4A 1CTNA 1ZBVA 3ARRA 2VN1A 2JMFA 4QT3A 2OLHA 3JXVA 1JVWA 2A3CA 3IKDA 4ODQA 1K9TA 4QT2A 4Z2IA 4DZ3A 3UQBA 4P8UA 1NWSA 2A3BA 3VAWA 1TFVA 1JNSA 3UI4A 1FKHA 4LAXA 2M8JA 3H9RB 4MTVA 4U85A 4KQZA 1GUVA 2JXWA 2DSUA 1NSGA 2ZR5A 2RE3A 1NWRA 1SR0A 1W1VA 2XP6A 1J4HA 4NZCA 3CNGA 2N87A 4ZS6A 1HKMA 1W9VA 3ARYA 2WLZA 2F23A 5B8IC 1WNOA 1YATA 3GU0A 1HKKA 2PPPA 1Y0OA 4MGVA 1HKJA 2O9OA 4BF8A 3O5FA 1EIBA 4DRMA 4A0UA 1OWQA 2ZQTA 4DRNA 1HKIA 1BKFA 3ARTA 3WD3A 4KR0B 2RUCA 3B9AA 2PBCA 3FY1A 4DRIA 2M2AA 5HBFA 4IQ2A 2AOSA 4TW7A 2YBUA 2RQSA 4FAPA 5CQ2A 2YSGA 3CGMA 3W4RA 1HJVA 2FAPA 1ITXA 1E44A 1TCOC 3EY6A 4ODRA 1FKRA 2ETNA 4LAVA 3WQWA 4NSBA 3TC5A 1RD6A 3KAIA 2WLYA 3ARSA 5HW8A 4DRHA 2XP9A 2DT3A 4W9PA 3NTPA 3ARQA 2XP5A 3MQHA 2YSBA 3QOKA 4DZ2A 2YBTA 2Q5AA 1SYTA 2LAJA 4PTMA 2YSIA 3FAPA 5E5WA 2ZAJA 4TNSA 1ZCNA 3WKZA 4JYSA 1TR8A 2YSFA 5HWCA 2ZR6A 1E9LA 1C9HA 1GRJA 2FKEA 1TK7A 2RUQA 2IF4A 4MAVA 1U79A 1LQ0A 1ZB5A 4DIPA 2MLZA 3RFWA 3ARPA 2DSWA 1Q6HA 4DWSD 3O5MA 2DWVA 3M7NA 4MPKA 4DWSA 1HJXA 3ARZA 3ARWA 4IT4A 1A7XA 1FFRA 2OWOA 3UQIA 4C02B 4IT6A 5E65A 2QF8A 3CH9A 1LL4A 3ARUA 2UZ5A 2DG9A 4TW8A 1FKFA 4TYOA 2KFWA 2M1IA 2PPNA 3O5QA 4IQCA 1PBKA 2XPAA 3ALFA 3O5EA 2MF9A 3KAFA 4Z2GA 3KADA 2Y78A 4MNKA 2KO7A 4A0TA 2P4VA 3MCBA 1R9HA 2ITKA 3MQGA 3B7XA 2M3OW 5D75A 3WL0A 2IUZA 5DO2A 2LJ4A 3WH0A 3GPKA 2A3EA 2XP4A 1VF8A 3EIPA 1D7JA 4L72B 4R0XA 3RM8A 2MPHA 1FKGA 2JZVA 1WAWA 4HBOA 1LL7A 3B8SA 1D7IA 2KE0A 2L2SA 2PV2A 3B9EA 1K9QA 4Z2JA 2F21A 5E64A 1W1TA 1UR8A
chains in the Genus database with same CATH topology
1HJWA 2ESCA 1ROUA 1W1YA 1ZL1A 2KR7A 2DT1A 4DWSC 2ZQVA 3RGCA 5GPGA 1ZK6A 2RURA 4DROA 2ZQSA 1JNTA 1JNEA 4G2PA 1KT1A 4LAYA 1LG2A 1LL6A 1EYMA 1NMWA 1EQ3A 4GLXA 1ZBWA 4WJXA 1O6IA 3KZ7A 4HBEA 4JFMA 3KAGA 1Q6IA 5HTGA 2YSHA 1YW5A 1PINA 3NI6A 5J6EA 1OGBA 2XP7A 4W9QA 1NH6A 2F4EA 3AS0A 4ITZA 4S3KA 4LGXA 1J6YA 4MNLA 4P8WA 3LUOA 4Z2LA 3RM4A 3AS1A 4S3JA 1ZBKA 1FD9A 2B31A 2KI3A 1EG3A 3AQUA 2PV3A 3BXWA 2G41A 4ODMA 4DRKA 4XAKA 5U47A 2WADA 2M08A 3LE4A 1XHGA 4DRQA 3KABA 1EG4A 3WL1A 1E6PA 2OFNA 2E45A 2DT0A 5BXJA 3NRKA 3O5RA 1H0IA 3G6LA 2MLYA 3LKXA 5E66A 2PPOA 2RUDA 4Q7NA 2XPBA 3O5IA 2M8IA 1FKTA 4G50A 2LPVA 1OGGA 1WMVA 4J4OA 2DSVA 3UQAA 1NMVA 4ODOA 4GGQA 2DPEA 4WIWA 4IPXA 3O5LA 3WD1A 3MDYB 3UI6A 5GQBA 4R5EA 3CHCA 4Z2HA 2FDMA 1F8AB 1B6CA 3MCBB 2G8ZA 5DIUA 2PV1A 3O5JA 3ODKA 1GOIA 4ODLA 5HW6A 3IHZA 1Q1CA 1I5HW 1QPLA 5AHTA 3O5DA 4MNJA 3B9DA 1D6OA 3RMEA 1FLCA 4ZPWR 2DJYA 1L1PA 4AY1A 3WQVA 1W1PA 4ZPVR 1E6NA 3AROA 1HXVA 4DRPA 4W5UA 4DRJA 1Q6UA 2DG4A 4ODNA 5DIVA 3UI5A 3TDBA 1ROTA 2BA1A 3PRBA 1EHNA 1KFWA 3OOBA 3PA7A 5JH8A 2MLXA 2PI6A 2ZR4A 4JFLA 1QZ2A 2D9FA 3UF8A 4HARA 2WK2A 2MDIA 2A3AA 3IKGA 1LG1A 5I98A 2XP8A 3ARXA 4GIVA 4REXA 1D7HA 1E15A 1FFQA 2O92A 4ODPA 4ZPTR 1FKSA 4WKHA 4L3NA 5GPRA 3KCEA 4TW6A 4JFKA 3WD4A 2WM0A 1QPFA 1H0GA 2DSZA 2KGJA 3FSCA 4P8VA 2RSEA 1D2KA 1LJYA 4O2TA 3RM9A 2Y8NB 5HWBA 1FKIA 1ZU8A 1NWUA 4WKAA 1M5YA 3KAHA 4URIA 1E6ZA 4P8XA 1WR7A 1RP5A 2DK1A 1FKKA 4ML4A 4U86A 5DITA 1T11A 3AS2A 1KT0A 3LKXB 3WD0A 1X6NA 1J4IA 3WIJA 1IX5A 2MNTA 2DK7A 2JX8A 3O5PA 3CHEA 1FKJA 1W26A 2EZ5W 1NWTA 2WAEA 2LGOA 4NNRA 2JV4A 3FXYA 3IK8A 1FKDA 4DT4A 4DWSB 4TX0A 4QZVB 1FKLA 5HUAA 1W9UA 1WB0A 2ZQUA 3WD2A 4WK9A 1F40A 3PQHA 3PRAA 4MSPA 3M85A 3CGNA 2VCDA 1P5QA 2DG3A 4JFIA 5E62A 1JNDA 2DMVA 2QRVA 4J4NA 4JFJA 4E5RA 1FKBA 1X6LA 3O5OA 3ALGA 3OA5A 1XRVA 4N19A 3CHDA 1E6RA 3L4HA 3CHFA 3PR9A 1K9RA 4W9OA 1O6WA 3I6CA 3G6MA 3JYMA 3O5GA 3PRDA 3CZ8A 1W9PA 1GPFA 4U84A 1UR9A 5DEZA 2KXQA 4FN2A 2LKNA 1J4RA 1FJDA 3AS3A 1JMQA 3TCZA 2F2DA 3FSBA 4QIBA 4WKFA 5HT1A 4ODKA 3ARVA 5DF0A 2AWGA 2L4JA 3FS8A 1EDQA 3KACA 4MNMA 4DH0A 4LAWA 3O5KA 2K8IA 1N1AA 1FAPA 4Z2KA 2YAJB 4Q22A 2XP3A 5HW7A 3JYJA 2DT2A 1ZBCA 5HKGA 1BL4A 1CTNA 1ZBVA 3ARRA 2VN1A 2JMFA 4QT3A 2OLHA 3JXVA 1JVWA 2A3CA 3IKDA 4ODQA 1K9TA 4QT2A 4Z2IA 4DZ3A 3UQBA 4P8UA 1NWSA 2A3BA 3VAWA 1TFVA 1JNSA 3UI4A 1FKHA 4LAXA 2M8JA 3H9RB 4MTVA 4U85A 4KQZA 1GUVA 2JXWA 2DSUA 1NSGA 2ZR5A 2RE3A 1NWRA 1SR0A 1W1VA 2XP6A 1J4HA 4NZCA 3CNGA 2N87A 4ZS6A 1HKMA 1W9VA 3ARYA 2WLZA 5B8IC 1WNOA 1YATA 1HKKA 2PPPA 1Y0OA 4MGVA 1HKJA 2O9OA 4BF8A 3O5FA 1EIBA 4DRMA 4A0UA 1OWQA 2ZQTA 4DRNA 1HKIA 1BKFA 3ARTA 3WD3A 4KR0B 2RUCA 3B9AA 2PBCA 3FY1A 4DRIA 2M2AA 5HBFA 4IQ2A 2AOSA 4TW7A 2YBUA 2RQSA 4FAPA 5CQ2A 2YSGA 3CGMA 3W4RA 1HJVA 2FAPA 1ITXA 1TCOC 3EY6A 4ODRA 1FKRA 4LAVA 3WQWA 4NSBA 3TC5A 1RD6A 3KAIA 2WLYA 3ARSA 5HW8A 4DRHA 2XP9A 2DT3A 4W9PA 3NTPA 3ARQA 2XP5A 3MQHA 2YSBA 3QOKA 4DZ2A 2YBTA 2Q5AA 1SYTA 2LAJA 4PTMA 2YSIA 3FAPA 5E5WA 2ZAJA 4TNSA 1ZCNA 3WKZA 4JYSA 1TR8A 2YSFA 5HWCA 2ZR6A 1E9LA 1C9HA 2FKEA 1TK7A 2RUQA 2IF4A 4MAVA 1U79A 1LQ0A 1ZB5A 4DIPA 2MLZA 3RFWA 3ARPA 2DSWA 1Q6HA 4DWSD 3O5MA 2DWVA 3M7NA 4MPKA 4DWSA 1HJXA 3ARZA 3ARWA 4IT4A 1A7XA 1FFRA 2OWOA 3UQIA 4C02B 4IT6A 5E65A 2QF8A 3CH9A 1LL4A 3ARUA 2UZ5A 2DG9A 4TW8A 1FKFA 4TYOA 2KFWA 2M1IA 2PPNA 3O5QA 4IQCA 1PBKA 2XPAA 3ALFA 3O5EA 2MF9A 3KAFA 4Z2GA 3KADA 2Y78A 4MNKA 2KO7A 4A0TA 3MCBA 1R9HA 2ITKA 3MQGA 3B7XA 2M3OW 5D75A 3WL0A 2IUZA 5DO2A 2LJ4A 3WH0A 3GPKA 2A3EA 2XP4A 1VF8A 4L72B 1D7JA 4R0XA 3RM8A 2MPHA 1FKGA 2JZVA 1WAWA 4HBOA 1LL7A 3B8SA 1D7IA 2KE0A 2L2SA 2PV2A 3B9EA 1K9QA 4Z2JA 2F21A 5E64A 1W1TA 1UR8A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1ROU A;  2KR7 A;  2ZQV A;  3RGC A;  5GPG A;  1ZK6 A;  2RUR A;  4DRO A;  2ZQS A;  1JNT A;  4G2P A;  1KT1 A;  4LAY A;  1EYM A;  1NMW A;  1EQ3 A;  3KZ7 A;  4JFM A;  3KAG A;  1Q6I A;  5HTG A;  2YSH A;  1YW5 A;  1PIN A;  3NI6 A;  5J6E A;  2XP7 A;  4W9Q A;  2F4E A;  4ITZ A;  1J6Y A;  3LUO A;  1FD9 A;  2KI3 A;  1EG3 A;  2PV3 A;  4ODM A;  4DRK A;  2M08 A;  3LE4 A;  4DRQ A;  3KAB A;  1EG4 A;  2OFN A;  2E45 A;  5BXJ A;  3NRK A;  3O5R A;  2MLY A;  2PPO A;  2RUD A;  2XPB A;  3O5I A;  2M8I A;  1FKT A;  4G50 A;  2LPV A;  1WMV A;  4J4O A;  3UQA A;  1NMV A;  4ODO A;  4GGQ A;  4IPX A;  3O5L A;  3MDY B;  3UI6 A;  1F8A B;  1B6C A;  5DIU A;  2PV1 A;  3O5J A;  3ODK A;  4ODL A;  5HW6 A;  3IHZ A;  1Q1C A;  1I5H W;  1QPL A;  5AHT A;  3O5D A;  1D6O A;  2DJY A;  1L1P A;  1HXV A;  4DRP A;  4DRJ A;  1Q6U A;  2DG4 A;  4ODN A;  5DIV A;  3UI5 A;  3TDB A;  1ROT A;  2BA1 A;  3PRB A;  3OOB A;  3PA7 A;  2MLX A;  2ZR4 A;  4JFL A;  1QZ2 A;  2D9F A;  3UF8 A;  2MDI A;  3IKG A;  5I98 A;  2XP8 A;  4GIV A;  4REX A;  1D7H A;  4ODP A;  1FKS A;  3KCE A;  4TW6 A;  4JFK A;  1QPF A;  2KGJ A;  2RSE A;  4O2T A;  5HWB A;  1FKI A;  1M5Y A;  3KAH A;  1WR7 A;  2DK1 A;  1FKK A;  4U86 A;  5DIT A;  1T11 A;  1KT0 A;  1J4I A;  2MNT A;  2DK7 A;  2JX8 A;  3O5P A;  1FKJ A;  1W26 A;  2EZ5 W;  2LGO A;  4NNR A;  2JV4 A;  3IK8 A;  1FKD A;  4DT4 A;  4TX0 A;  1FKL A;  5HUA A;  2ZQU A;  1F40 A;  4MSP A;  3M85 A;  3CGN A;  2VCD A;  1P5Q A;  2DG3 A;  4JFI A;  2DMV A;  4J4N A;  4JFJ A;  4E5R A;  1FKB A;  3O5O A;  4N19 A;  3L4H A;  1K9R A;  4W9O A;  1O6W A;  3I6C A;  3JYM A;  3O5G A;  3PRD A;  4U84 A;  2KXQ A;  4FN2 A;  2LKN A;  1J4R A;  1FJD A;  1JMQ A;  3TCZ A;  2F2D A;  4QIB A;  5HT1 A;  4ODK A;  2AWG A;  2L4J A;  3KAC A;  4DH0 A;  4LAW A;  3O5K A;  2K8I A;  1N1A A;  1FAP A;  2XP3 A;  5HW7 A;  3JYJ A;  5HKG A;  1BL4 A;  2VN1 A;  2JMF A;  4QT3 A;  3JXV A;  1JVW A;  4QT2 A;  3IKD A;  4ODQ A;  3UQB A;  4DZ3 A;  3VAW A;  1JNS A;  3UI4 A;  1FKH A;  4LAX A;  2M8J A;  3H9R B;  4U85 A;  2JXW A;  1NSG A;  2ZR5 A;  2RE3 A;  2XP6 A;  1J4H A;  3CNG A;  2N87 A;  5B8I C;  1YAT A;  2PPP A;  1Y0O A;  4MGV A;  4BF8 A;  3O5F A;  4DRM A;  4DRN A;  2ZQT A;  1BKF A;  2RUC A;  2PBC A;  4DRI A;  2M2A A;  4IQ2 A;  4TW7 A;  2RQS A;  4FAP A;  5CQ2 A;  2YSG A;  3CGM A;  2FAP A;  1TCO C;  3EY6 A;  4ODR A;  1FKR A;  4LAV A;  3TC5 A;  3KAI A;  5HW8 A;  4DRH A;  2XP9 A;  4W9P A;  3NTP A;  2XP5 A;  2YSB A;  4DZ2 A;  2Q5A A;  2LAJ A;  2YSI A;  3FAP A;  2ZAJ A;  4TNS A;  1ZCN A;  4JYS A;  2YSF A;  5HWC A;  2ZR6 A;  2FKE A;  1C9H A;  1TK7 A;  2RUQ A;  2IF4 A;  1U79 A;  4DIP A;  2MLZ A;  3RFW A;  1Q6H A;  3O5M A;  2DWV A;  3M7N A;  1A7X A;  3UQI A;  4C02 B;  2UZ5 A;  2DG9 A;  4TW8 A;  1FKF A;  4TYO A;  2KFW A;  2M1I A;  2PPN A;  3O5Q A;  4IQC A;  1PBK A;  2XPA A;  3O5E A;  2MF9 A;  3KAF A;  3KAD A;  2Y78 A;  2KO7 A;  1R9H A;  2ITK A;  3B7X A;  2M3O W;  5D75 A;  2LJ4 A;  3WH0 A;  3GPK A;  2XP4 A;  1D7J A;  4R0X A;  2MPH A;  1FKG A;  2JZV A;  1D7I A;  2KE0 A;  2L2S A;  2PV2 A;  1K9Q A;  2F21 A; 
#chains in the Genus database with same CATH topology
 1HJW A;  2ESC A;  1ROU A;  1W1Y A;  1ZL1 A;  2KR7 A;  2DT1 A;  4DWS C;  2ZQV A;  3RGC A;  1JCH B;  5GPG A;  1ZK6 A;  2RUR A;  4DRO A;  2ZQS A;  1JNT A;  1JNE A;  4G2P A;  1KT1 A;  4LAY A;  1LG2 A;  1LL6 A;  1EYM A;  1NMW A;  1EQ3 A;  4GLX A;  1ZBW A;  4WJX A;  1O6I A;  3KZ7 A;  4HBE A;  4JFM A;  3KAG A;  1Q6I A;  5HTG A;  2YSH A;  1YW5 A;  1PIN A;  3NI6 A;  5J6E A;  1OGB A;  2XP7 A;  4W9Q A;  1NH6 A;  2F4E A;  3AS0 A;  4ITZ A;  4S3K A;  4LGX A;  1J6Y A;  4MNL A;  4P8W A;  3LUO A;  4Z2L A;  3RM4 A;  3AS1 A;  4S3J A;  1ZBK A;  1FD9 A;  2B31 A;  2KI3 A;  1EG3 A;  3AQU A;  2PV3 A;  3BXW A;  2G41 A;  4ODM A;  4DRK A;  4XAK A;  5U47 A;  2WAD A;  2M08 A;  3LE4 A;  1XHG A;  4DRQ A;  3KAB A;  1EG4 A;  3WL1 A;  2B5U B;  1E6P A;  2OFN A;  2E45 A;  2DT0 A;  5BXJ A;  3NRK A;  3O5R A;  1H0I A;  3G6L A;  2MLY A;  3LKX A;  5E66 A;  2PPO A;  2RUD A;  4Q7N A;  2XPB A;  3O5I A;  2M8I A;  1FKT A;  4G50 A;  2LPV A;  1OGG A;  1WMV A;  4J4O A;  2DSV A;  3UQA A;  1NMV A;  4ODO A;  4GGQ A;  2DPE A;  4WIW A;  4IPX A;  3O5L A;  3WD1 A;  3MDY B;  3UI6 A;  5GQB A;  4R5E A;  3CHC A;  4Z2H A;  2FDM A;  1F8A B;  2PN0 A;  1B6C A;  3MCB B;  2G8Z A;  5DIU A;  2PV1 A;  3O5J A;  3ODK A;  1GOI A;  4ODL A;  4UDM A;  5HW6 A;  3IHZ A;  1Q1C A;  1I5H W;  1QPL A;  5AHT A;  3O5D A;  4MNJ A;  3B9D A;  1D6O A;  3RME A;  1FLC A;  4ZPW R;  2DJY A;  1L1P A;  4AY1 A;  3WQV A;  1W1P A;  4ZPV R;  1E6N A;  3ARO A;  1HXV A;  4DRP A;  4W5U A;  4DRJ A;  1Q6U A;  2DG4 A;  4ODN A;  5DIV A;  3UI5 A;  3TDB A;  1ROT A;  2BA1 A;  3PRB A;  1EHN A;  1KFW A;  3OOB A;  3PA7 A;  5JH8 A;  2MLX A;  2PI6 A;  2ZR4 A;  4JFL A;  1QZ2 A;  2D9F A;  3UF8 A;  4HAR A;  2WK2 A;  2MDI A;  2A3A A;  3IKG A;  1LG1 A;  5I98 A;  2XP8 A;  3ARX A;  4GIV A;  4REX A;  1D7H A;  1E15 A;  1FFQ A;  2O92 A;  4ODP A;  4ZPT R;  1FKS A;  4WKH A;  4L3N A;  5GPR A;  3KCE A;  4TW6 A;  4JFK A;  3WD4 A;  2WM0 A;  1QPF A;  1H0G A;  2DSZ A;  2KGJ A;  3FSC A;  4P8V A;  2RSE A;  1D2K A;  1LJY A;  4O2T A;  3RM9 A;  2Y8N B;  5HWB A;  1FKI A;  1ZU8 A;  1NWU A;  4WKA A;  1M5Y A;  3KAH A;  4URI A;  1E6Z A;  4P8X A;  1WR7 A;  1RP5 A;  2DK1 A;  1FKK A;  4ML4 A;  4U86 A;  5DIT A;  1T11 A;  3AS2 A;  1KT0 A;  3LKX B;  3WD0 A;  1X6N A;  1J4I A;  3WIJ A;  1IX5 A;  2MNT A;  2DK7 A;  2JX8 A;  3O5P A;  3CHE A;  1FKJ A;  1W26 A;  2EZ5 W;  2EUL A;  1NWT A;  2WAE A;  2LGO A;  4NNR A;  2JV4 A;  3FXY A;  3IK8 A;  1FKD A;  4DT4 A;  4DWS B;  4TX0 A;  4QZV B;  1FKL A;  5HUA A;  1W9U A;  1WB0 A;  2ZQU A;  3WD2 A;  4WK9 A;  1F40 A;  3PQH A;  3PRA A;  4MSP A;  3M85 A;  3CGN A;  2VCD A;  1P5Q A;  2DG3 A;  4JFI A;  5E62 A;  1JND A;  2DMV A;  2QRV A;  4J4N A;  4JFJ A;  4E5R A;  1FKB A;  1X6L A;  3O5O A;  3ALG A;  3OA5 A;  1XRV A;  4N19 A;  3CHD A;  1E6R A;  3L4H A;  3CHF A;  3PR9 A;  1K9R A;  4W9O A;  1O6W A;  3I6C A;  3G6M A;  3JYM A;  3O5G A;  3PRD A;  3CZ8 A;  1W9P A;  1GPF A;  4U84 A;  1UR9 A;  5DEZ A;  2KXQ A;  4FN2 A;  2LKN A;  1J4R A;  1FJD A;  3AS3 A;  1JMQ A;  3TCZ A;  2F2D A;  3FSB A;  4QIB A;  4WKF A;  5HT1 A;  4ODK A;  3BMB A;  3ARV A;  5DF0 A;  2AWG A;  2L4J A;  3FS8 A;  1EDQ A;  3KAC A;  4MNM A;  4DH0 A;  4LAW A;  3O5K A;  2K8I A;  1N1A A;  1FAP A;  4Z2K A;  2YAJ B;  4Q22 A;  2XP3 A;  3GTY X;  5HW7 A;  3JYJ A;  2DT2 A;  1ZBC A;  5HKG A;  1BL4 A;  1CTN A;  1ZBV A;  3ARR A;  2VN1 A;  2JMF A;  4QT3 A;  2OLH A;  3JXV A;  1JVW A;  2A3C A;  3IKD A;  4ODQ A;  1K9T A;  4QT2 A;  4Z2I A;  4DZ3 A;  3UQB A;  4P8U A;  1NWS A;  2A3B A;  3VAW A;  1TFV A;  1JNS A;  3UI4 A;  1FKH A;  4LAX A;  2M8J A;  3H9R B;  4MTV A;  4U85 A;  4KQZ A;  1GUV A;  2JXW A;  2DSU A;  1NSG A;  2ZR5 A;  2RE3 A;  1NWR A;  1SR0 A;  1W1V A;  2XP6 A;  1J4H A;  4NZC A;  3CNG A;  2N87 A;  4ZS6 A;  1HKM A;  1W9V A;  3ARY A;  2WLZ A;  2F23 A;  5B8I C;  1WNO A;  1YAT A;  3GU0 A;  1HKK A;  2PPP A;  1Y0O A;  4MGV A;  1HKJ A;  2O9O A;  4BF8 A;  3O5F A;  1EIB A;  4DRM A;  4A0U A;  1OWQ A;  2ZQT A;  4DRN A;  1HKI A;  1BKF A;  3ART A;  3WD3 A;  4KR0 B;  2RUC A;  3B9A A;  2PBC A;  3FY1 A;  4DRI A;  2M2A A;  5HBF A;  4IQ2 A;  2AOS A;  4TW7 A;  2YBU A;  2RQS A;  4FAP A;  5CQ2 A;  2YSG A;  3CGM A;  3W4R A;  1HJV A;  2FAP A;  1ITX A;  1E44 A;  1TCO C;  3EY6 A;  4ODR A;  1FKR A;  2ETN A;  4LAV A;  3WQW A;  4NSB A;  3TC5 A;  1RD6 A;  3KAI A;  2WLY A;  3ARS A;  5HW8 A;  4DRH A;  2XP9 A;  2DT3 A;  4W9P A;  3NTP A;  3ARQ A;  2XP5 A;  3MQH A;  2YSB A;  3QOK A;  4DZ2 A;  2YBT A;  2Q5A A;  1SYT A;  2LAJ A;  4PTM A;  2YSI A;  3FAP A;  5E5W A;  2ZAJ A;  4TNS A;  1ZCN A;  3WKZ A;  4JYS A;  1TR8 A;  2YSF A;  5HWC A;  2ZR6 A;  1E9L A;  1C9H A;  1GRJ A;  2FKE A;  1TK7 A;  2RUQ A;  2IF4 A;  4MAV A;  1U79 A;  1LQ0 A;  1ZB5 A;  4DIP A;  2MLZ A;  3RFW A;  3ARP A;  2DSW A;  1Q6H A;  4DWS D;  3O5M A;  2DWV A;  3M7N A;  4MPK A;  4DWS A;  1HJX A;  3ARZ A;  3ARW A;  4IT4 A;  1A7X A;  1FFR A;  2OWO A;  3UQI A;  4C02 B;  4IT6 A;  5E65 A;  2QF8 A;  3CH9 A;  1LL4 A;  3ARU A;  2UZ5 A;  2DG9 A;  4TW8 A;  1FKF A;  4TYO A;  2KFW A;  2M1I A;  2PPN A;  3O5Q A;  4IQC A;  1PBK A;  2XPA A;  3ALF A;  3O5E A;  2MF9 A;  3KAF A;  4Z2G A;  3KAD A;  2Y78 A;  4MNK A;  2KO7 A;  4A0T A;  2P4V A;  3MCB A;  1R9H A;  2ITK A;  3MQG A;  3B7X A;  2M3O W;  5D75 A;  3WL0 A;  2IUZ A;  5DO2 A;  2LJ4 A;  3WH0 A;  3GPK A;  2A3E A;  2XP4 A;  1VF8 A;  3EIP A;  1D7J A;  4L72 B;  4R0X A;  3RM8 A;  2MPH A;  1FKG A;  2JZV A;  1WAW A;  4HBO A;  1LL7 A;  3B8S A;  1D7I A;  2KE0 A;  2L2S A;  2PV2 A;  3B9E A;  1K9Q A;  4Z2J A;  2F21 A;  5E64 A;  1W1T A;  1UR8 A; 
#chains in the Genus database with same CATH homology
 1HJW A;  2ESC A;  1ROU A;  1W1Y A;  1ZL1 A;  2KR7 A;  2DT1 A;  4DWS C;  2ZQV A;  3RGC A;  5GPG A;  1ZK6 A;  2RUR A;  4DRO A;  2ZQS A;  1JNT A;  1JNE A;  4G2P A;  1KT1 A;  4LAY A;  1LG2 A;  1LL6 A;  1EYM A;  1NMW A;  1EQ3 A;  4GLX A;  1ZBW A;  4WJX A;  1O6I A;  3KZ7 A;  4HBE A;  4JFM A;  3KAG A;  1Q6I A;  5HTG A;  2YSH A;  1YW5 A;  1PIN A;  3NI6 A;  5J6E A;  1OGB A;  2XP7 A;  4W9Q A;  1NH6 A;  2F4E A;  3AS0 A;  4ITZ A;  4S3K A;  4LGX A;  1J6Y A;  4MNL A;  4P8W A;  3LUO A;  4Z2L A;  3RM4 A;  3AS1 A;  4S3J A;  1ZBK A;  1FD9 A;  2B31 A;  2KI3 A;  1EG3 A;  3AQU A;  2PV3 A;  3BXW A;  2G41 A;  4ODM A;  4DRK A;  4XAK A;  5U47 A;  2WAD A;  2M08 A;  3LE4 A;  1XHG A;  4DRQ A;  3KAB A;  1EG4 A;  3WL1 A;  1E6P A;  2OFN A;  2E45 A;  2DT0 A;  5BXJ A;  3NRK A;  3O5R A;  1H0I A;  3G6L A;  2MLY A;  3LKX A;  5E66 A;  2PPO A;  2RUD A;  4Q7N A;  2XPB A;  3O5I A;  2M8I A;  1FKT A;  4G50 A;  2LPV A;  1OGG A;  1WMV A;  4J4O A;  2DSV A;  3UQA A;  1NMV A;  4ODO A;  4GGQ A;  2DPE A;  4WIW A;  4IPX A;  3O5L A;  3WD1 A;  3MDY B;  3UI6 A;  5GQB A;  4R5E A;  3CHC A;  4Z2H A;  2FDM A;  1F8A B;  1B6C A;  3MCB B;  2G8Z A;  5DIU A;  2PV1 A;  3O5J A;  3ODK A;  1GOI A;  4ODL A;  5HW6 A;  3IHZ A;  1Q1C A;  1I5H W;  1QPL A;  5AHT A;  3O5D A;  4MNJ A;  3B9D A;  1D6O A;  3RME A;  1FLC A;  4ZPW R;  2DJY A;  1L1P A;  4AY1 A;  3WQV A;  1W1P A;  4ZPV R;  1E6N A;  3ARO A;  1HXV A;  4DRP A;  4W5U A;  4DRJ A;  1Q6U A;  2DG4 A;  4ODN A;  5DIV A;  3UI5 A;  3TDB A;  1ROT A;  2BA1 A;  3PRB A;  1EHN A;  1KFW A;  3OOB A;  3PA7 A;  5JH8 A;  2MLX A;  2PI6 A;  2ZR4 A;  4JFL A;  1QZ2 A;  2D9F A;  3UF8 A;  4HAR A;  2WK2 A;  2MDI A;  2A3A A;  3IKG A;  1LG1 A;  5I98 A;  2XP8 A;  3ARX A;  4GIV A;  4REX A;  1D7H A;  1E15 A;  1FFQ A;  2O92 A;  4ODP A;  4ZPT R;  1FKS A;  4WKH A;  4L3N A;  5GPR A;  3KCE A;  4TW6 A;  4JFK A;  3WD4 A;  2WM0 A;  1QPF A;  1H0G A;  2DSZ A;  2KGJ A;  3FSC A;  4P8V A;  2RSE A;  1D2K A;  1LJY A;  4O2T A;  3RM9 A;  2Y8N B;  5HWB A;  1FKI A;  1ZU8 A;  1NWU A;  4WKA A;  1M5Y A;  3KAH A;  4URI A;  1E6Z A;  4P8X A;  1WR7 A;  1RP5 A;  2DK1 A;  1FKK A;  4ML4 A;  4U86 A;  5DIT A;  1T11 A;  3AS2 A;  1KT0 A;  3LKX B;  3WD0 A;  1X6N A;  1J4I A;  3WIJ A;  1IX5 A;  2MNT A;  2DK7 A;  2JX8 A;  3O5P A;  3CHE A;  1FKJ A;  1W26 A;  2EZ5 W;  1NWT A;  2WAE A;  2LGO A;  4NNR A;  2JV4 A;  3FXY A;  3IK8 A;  1FKD A;  4DT4 A;  4DWS B;  4TX0 A;  4QZV B;  1FKL A;  5HUA A;  1W9U A;  1WB0 A;  2ZQU A;  3WD2 A;  4WK9 A;  1F40 A;  3PQH A;  3PRA A;  4MSP A;  3M85 A;  3CGN A;  2VCD A;  1P5Q A;  2DG3 A;  4JFI A;  5E62 A;  1JND A;  2DMV A;  2QRV A;  4J4N A;  4JFJ A;  4E5R A;  1FKB A;  1X6L A;  3O5O A;  3ALG A;  3OA5 A;  1XRV A;  4N19 A;  3CHD A;  1E6R A;  3L4H A;  3CHF A;  3PR9 A;  1K9R A;  4W9O A;  1O6W A;  3I6C A;  3G6M A;  3JYM A;  3O5G A;  3PRD A;  3CZ8 A;  1W9P A;  1GPF A;  4U84 A;  1UR9 A;  5DEZ A;  2KXQ A;  4FN2 A;  2LKN A;  1J4R A;  1FJD A;  3AS3 A;  1JMQ A;  3TCZ A;  2F2D A;  3FSB A;  4QIB A;  4WKF A;  5HT1 A;  4ODK A;  3ARV A;  5DF0 A;  2AWG A;  2L4J A;  3FS8 A;  1EDQ A;  3KAC A;  4MNM A;  4DH0 A;  4LAW A;  3O5K A;  2K8I A;  1N1A A;  1FAP A;  4Z2K A;  2YAJ B;  4Q22 A;  2XP3 A;  5HW7 A;  3JYJ A;  2DT2 A;  1ZBC A;  5HKG A;  1BL4 A;  1CTN A;  1ZBV A;  3ARR A;  2VN1 A;  2JMF A;  4QT3 A;  2OLH A;  3JXV A;  1JVW A;  2A3C A;  3IKD A;  4ODQ A;  1K9T A;  4QT2 A;  4Z2I A;  4DZ3 A;  3UQB A;  4P8U A;  1NWS A;  2A3B A;  3VAW A;  1TFV A;  1JNS A;  3UI4 A;  1FKH A;  4LAX A;  2M8J A;  3H9R B;  4MTV A;  4U85 A;  4KQZ A;  1GUV A;  2JXW A;  2DSU A;  1NSG A;  2ZR5 A;  2RE3 A;  1NWR A;  1SR0 A;  1W1V A;  2XP6 A;  1J4H A;  4NZC A;  3CNG A;  2N87 A;  4ZS6 A;  1HKM A;  1W9V A;  3ARY A;  2WLZ A;  5B8I C;  1WNO A;  1YAT A;  1HKK A;  2PPP A;  1Y0O A;  4MGV A;  1HKJ A;  2O9O A;  4BF8 A;  3O5F A;  1EIB A;  4DRM A;  4A0U A;  1OWQ A;  2ZQT A;  4DRN A;  1HKI A;  1BKF A;  3ART A;  3WD3 A;  4KR0 B;  2RUC A;  3B9A A;  2PBC A;  3FY1 A;  4DRI A;  2M2A A;  5HBF A;  4IQ2 A;  2AOS A;  4TW7 A;  2YBU A;  2RQS A;  4FAP A;  5CQ2 A;  2YSG A;  3CGM A;  3W4R A;  1HJV A;  2FAP A;  1ITX A;  1TCO C;  3EY6 A;  4ODR A;  1FKR A;  4LAV A;  3WQW A;  4NSB A;  3TC5 A;  1RD6 A;  3KAI A;  2WLY A;  3ARS A;  5HW8 A;  4DRH A;  2XP9 A;  2DT3 A;  4W9P A;  3NTP A;  3ARQ A;  2XP5 A;  3MQH A;  2YSB A;  3QOK A;  4DZ2 A;  2YBT A;  2Q5A A;  1SYT A;  2LAJ A;  4PTM A;  2YSI A;  3FAP A;  5E5W A;  2ZAJ A;  4TNS A;  1ZCN A;  3WKZ A;  4JYS A;  1TR8 A;  2YSF A;  5HWC A;  2ZR6 A;  1E9L A;  1C9H A;  2FKE A;  1TK7 A;  2RUQ A;  2IF4 A;  4MAV A;  1U79 A;  1LQ0 A;  1ZB5 A;  4DIP A;  2MLZ A;  3RFW A;  3ARP A;  2DSW A;  1Q6H A;  4DWS D;  3O5M A;  2DWV A;  3M7N A;  4MPK A;  4DWS A;  1HJX A;  3ARZ A;  3ARW A;  4IT4 A;  1A7X A;  1FFR A;  2OWO A;  3UQI A;  4C02 B;  4IT6 A;  5E65 A;  2QF8 A;  3CH9 A;  1LL4 A;  3ARU A;  2UZ5 A;  2DG9 A;  4TW8 A;  1FKF A;  4TYO A;  2KFW A;  2M1I A;  2PPN A;  3O5Q A;  4IQC A;  1PBK A;  2XPA A;  3ALF A;  3O5E A;  2MF9 A;  3KAF A;  4Z2G A;  3KAD A;  2Y78 A;  4MNK A;  2KO7 A;  4A0T A;  3MCB A;  1R9H A;  2ITK A;  3MQG A;  3B7X A;  2M3O W;  5D75 A;  3WL0 A;  2IUZ A;  5DO2 A;  2LJ4 A;  3WH0 A;  3GPK A;  2A3E A;  2XP4 A;  1VF8 A;  4L72 B;  1D7J A;  4R0X A;  3RM8 A;  2MPH A;  1FKG A;  2JZV A;  1WAW A;  4HBO A;  1LL7 A;  3B8S A;  1D7I A;  2KE0 A;  2L2S A;  2PV2 A;  3B9E A;  1K9Q A;  4Z2J A;  2F21 A;  5E64 A;  1W1T A;  1UR8 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...