2ZAJA

Solution structure of the short-isoform of the second ww domain from the human membrane-associated guanylate kinase, ww and pdz domain-containing protein 1 (magi-1)
Total Genus 4
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
4
sequence length
49
structure length
49
Chain Sequence
GSSGSSGLDSELELPAGWEKIEDPVYGIYYVDHINRKTQYENPSGPSSG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Protein binding
molecule keywords Membrane-associated guanylate kinase, WW and PDZ domain-cont
publication title Solution structure of the short-isoform of the second WW domain from the human membrane-associated guanylate kinase, WW and PDZ domain-containing protein 1 (MAGI-1)
rcsb
source organism Homo sapiens
total genus 4
structure length 49
sequence length 49
ec nomenclature
pdb deposition date 2007-10-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00397 WW WW domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.20.70.10 Mainly Beta Single Sheet Ubiquitin Ligase Nedd4; Chain: W; Ubiquitin Ligase Nedd4; Chain: W; 2zajA01
3CNGA 2XPAA 2XPBA 2XP9A 3KAGA 3M7NA 2M8JA 3KAHA 2RE3A 4U84A 1TK7A 4E5RA 2YSGA 2EZ5W 3KAFA 1JMQA 2ZQUA 3TC5A 1PINA 2XP5A 1O6WA 3WH0A 3KADA 2ZAJA 2M3OW 3KAIA 1K9QA 2Q5AA 2JV4A 2DMVA 2F21A 2ITKA 4QIBA 2XP6A 3TCZA 2M8IA 3L4HA 1ZCNA 2XP7A 3KCEA 2DK7A 3NTPA 2DJYA 1NMVA 2E45A 2ZR5A 2YSHA 2ZQVA 2L4JA 3TDBA 3KABA 3M85A 2JMFA 1I5HW 2XP8A 2ZQSA 2DK1A 2ZQTA 2JXWA 2ZR4A 1YW5A 4U86A 5CQ2A 2YSFA 2YSIA 2JX8A 5AHTA 2LAJA 1K9RA 4U85A 2ZR6A 1EG4A 2KXQA 2MDIA 1WR7A 2BA1A 1F8AB 2XP4A 1WMVA 2DWVA 1EG3A 3LE4A 2YSBA 3OOBA 3ODKA 4REXA 2XP3A
chains in the Genus database with same CATH superfamily
2YAJB 3CNGA 2XPAA 2XPBA 2XP9A 5U47A 3KAGA 3M7NA 2M8JA 3KAHA 2RE3A 4U84A 1TK7A 4E5RA 2YSGA 2EZ5W 3KAFA 1JMQA 2ZQUA 3TC5A 1PINA 2XP5A 1O6WA 3WH0A 2QRVA 3KADA 2ZAJA 5E66A 2M3OW 3KAIA 1K9QA 2Q5AA 2JV4A 2DMVA 2F21A 2ITKA 4QIBA 2XP6A 3MQHA 3TCZA 2M8IA 5E64A 3L4HA 1ZCNA 5E62A 1FLCA 2XP7A 2WADA 3PQHA 3KCEA 2DK7A 3NTPA 2DJYA 1NMVA 2E45A 2ZR5A 2YSHA 3LKXA 1TR8A 4A0UA 2ZQVA 2L4JA 3TDBA 3LKXB 3KABA 3M85A 2JMFA 1I5HW 2XP8A 2ZQSA 2DK1A 2ZQTA 2JXWA 2ZR4A 3FSCA 1YW5A 4U86A 5CQ2A 4GLXA 2YSFA 2YSIA 2JX8A 5E65A 2OWOA 5AHTA 2LAJA 3FSBA 1K9RA 4U85A 2ZR6A 1EG4A 3MCBA 2KXQA 2MDIA 3MQGA 1WR7A 3MCBB 2BA1A 1F8AB 2XP4A 1WMVA 2Y8NB 2DWVA 1EG3A 5E5WA 3LE4A 2YSBA 3OOBA 2WAEA 3ODKA 1RP5A 4REXA 3FS8A 2XP3A 4A0TA
chains in the Genus database with same CATH topology
2YAJB 3CNGA 2XPAA 2XPBA 2XP9A 5U47A 3KAGA 3M7NA 2M8JA 3KAHA 2RE3A 4U84A 1TK7A 4E5RA 2YSGA 2EZ5W 3KAFA 1JMQA 2ZQUA 3TC5A 1PINA 2XP5A 1O6WA 3WH0A 2QRVA 3KADA 2ZAJA 5E66A 2M3OW 3KAIA 1K9QA 2Q5AA 2JV4A 2DMVA 2F21A 2ITKA 4QIBA 2XP6A 3MQHA 3TCZA 2M8IA 5E64A 3L4HA 1ZCNA 5E62A 1FLCA 2XP7A 2WADA 3PQHA 3KCEA 2DK7A 3NTPA 2DJYA 1NMVA 2E45A 2ZR5A 2YSHA 3LKXA 1TR8A 4A0UA 2ZQVA 2L4JA 3TDBA 3LKXB 3KABA 3M85A 2JMFA 1I5HW 2XP8A 2ZQSA 2DK1A 2ZQTA 2JXWA 2ZR4A 3FSCA 1YW5A 4U86A 5CQ2A 4GLXA 2YSFA 2YSIA 2JX8A 5E65A 2OWOA 5AHTA 2LAJA 3FSBA 1K9RA 4U85A 2ZR6A 1EG4A 3MCBA 2KXQA 2MDIA 3MQGA 1WR7A 3MCBB 2BA1A 1F8AB 2XP4A 1WMVA 2Y8NB 2DWVA 1EG3A 5E5WA 3LE4A 2YSBA 3OOBA 2WAEA 3ODKA 1RP5A 4REXA 3FS8A 2XP3A 4A0TA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3CNG A;  2XPA A;  2XPB A;  2XP9 A;  3KAG A;  3M7N A;  2M8J A;  3KAH A;  2RE3 A;  4U84 A;  1TK7 A;  4E5R A;  2YSG A;  2EZ5 W;  3KAF A;  1JMQ A;  2ZQU A;  3TC5 A;  1PIN A;  2XP5 A;  1O6W A;  3WH0 A;  3KAD A;  2ZAJ A;  2M3O W;  3KAI A;  1K9Q A;  2Q5A A;  2JV4 A;  2DMV A;  2F21 A;  2ITK A;  4QIB A;  2XP6 A;  3TCZ A;  2M8I A;  3L4H A;  1ZCN A;  2XP7 A;  3KCE A;  2DK7 A;  3NTP A;  2DJY A;  1NMV A;  2E45 A;  2ZR5 A;  2YSH A;  2ZQV A;  2L4J A;  3TDB A;  3KAB A;  3M85 A;  2JMF A;  1I5H W;  2XP8 A;  2ZQS A;  2DK1 A;  2ZQT A;  2JXW A;  2ZR4 A;  1YW5 A;  4U86 A;  5CQ2 A;  2YSF A;  2YSI A;  2JX8 A;  5AHT A;  2LAJ A;  1K9R A;  4U85 A;  2ZR6 A;  1EG4 A;  2KXQ A;  2MDI A;  1WR7 A;  2BA1 A;  1F8A B;  2XP4 A;  1WMV A;  2DWV A;  1EG3 A;  3LE4 A;  2YSB A;  3OOB A;  3ODK A;  4REX A;  2XP3 A; 
#chains in the Genus database with same CATH topology
 2YAJ B;  3CNG A;  2XPA A;  2XPB A;  2XP9 A;  5U47 A;  3KAG A;  3M7N A;  2M8J A;  3KAH A;  2RE3 A;  4U84 A;  1TK7 A;  4E5R A;  2YSG A;  2EZ5 W;  3KAF A;  1JMQ A;  2ZQU A;  3TC5 A;  1PIN A;  2XP5 A;  1O6W A;  3WH0 A;  2QRV A;  3KAD A;  2ZAJ A;  5E66 A;  2M3O W;  3KAI A;  1K9Q A;  2Q5A A;  2JV4 A;  2DMV A;  2F21 A;  2ITK A;  4QIB A;  2XP6 A;  3MQH A;  3TCZ A;  2M8I A;  5E64 A;  3L4H A;  1ZCN A;  5E62 A;  1FLC A;  2XP7 A;  2WAD A;  3PQH A;  3KCE A;  2DK7 A;  3NTP A;  2DJY A;  1NMV A;  2E45 A;  2ZR5 A;  2YSH A;  3LKX A;  1TR8 A;  4A0U A;  2ZQV A;  2L4J A;  3TDB A;  3LKX B;  3KAB A;  3M85 A;  2JMF A;  1I5H W;  2XP8 A;  2ZQS A;  2DK1 A;  2ZQT A;  2JXW A;  2ZR4 A;  3FSC A;  1YW5 A;  4U86 A;  5CQ2 A;  4GLX A;  2YSF A;  2YSI A;  2JX8 A;  5E65 A;  2OWO A;  5AHT A;  2LAJ A;  3FSB A;  1K9R A;  4U85 A;  2ZR6 A;  1EG4 A;  3MCB A;  2KXQ A;  2MDI A;  3MQG A;  1WR7 A;  3MCB B;  2BA1 A;  1F8A B;  2XP4 A;  1WMV A;  2Y8N B;  2DWV A;  1EG3 A;  5E5W A;  3LE4 A;  2YSB A;  3OOB A;  2WAE A;  3ODK A;  1RP5 A;  4REX A;  3FS8 A;  2XP3 A;  4A0T A; 
#chains in the Genus database with same CATH homology
 2YAJ B;  3CNG A;  2XPA A;  2XPB A;  2XP9 A;  5U47 A;  3KAG A;  3M7N A;  2M8J A;  3KAH A;  2RE3 A;  4U84 A;  1TK7 A;  4E5R A;  2YSG A;  2EZ5 W;  3KAF A;  1JMQ A;  2ZQU A;  3TC5 A;  1PIN A;  2XP5 A;  1O6W A;  3WH0 A;  2QRV A;  3KAD A;  2ZAJ A;  5E66 A;  2M3O W;  3KAI A;  1K9Q A;  2Q5A A;  2JV4 A;  2DMV A;  2F21 A;  2ITK A;  4QIB A;  2XP6 A;  3MQH A;  3TCZ A;  2M8I A;  5E64 A;  3L4H A;  1ZCN A;  5E62 A;  1FLC A;  2XP7 A;  2WAD A;  3PQH A;  3KCE A;  2DK7 A;  3NTP A;  2DJY A;  1NMV A;  2E45 A;  2ZR5 A;  2YSH A;  3LKX A;  1TR8 A;  4A0U A;  2ZQV A;  2L4J A;  3TDB A;  3LKX B;  3KAB A;  3M85 A;  2JMF A;  1I5H W;  2XP8 A;  2ZQS A;  2DK1 A;  2ZQT A;  2JXW A;  2ZR4 A;  3FSC A;  1YW5 A;  4U86 A;  5CQ2 A;  4GLX A;  2YSF A;  2YSI A;  2JX8 A;  5E65 A;  2OWO A;  5AHT A;  2LAJ A;  3FSB A;  1K9R A;  4U85 A;  2ZR6 A;  1EG4 A;  3MCB A;  2KXQ A;  2MDI A;  3MQG A;  1WR7 A;  3MCB B;  2BA1 A;  1F8A B;  2XP4 A;  1WMV A;  2Y8N B;  2DWV A;  1EG3 A;  5E5W A;  3LE4 A;  2YSB A;  3OOB A;  2WAE A;  3ODK A;  1RP5 A;  4REX A;  3FS8 A;  2XP3 A;  4A0T A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...