2ZAJA

Solution structure of the short-isoform of the second ww domain from the human membrane-associated guanylate kinase, ww and pdz domain-containing protein 1 (magi-1)
Total Genus 4
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
4
sequence length
49
structure length
49
Chain Sequence
GSSGSSGLDSELELPAGWEKIEDPVYGIYYVDHINRKTQYENPSGPSSG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Membrane-associated guanylate kinase, WW and PDZ domain-cont
publication title Solution structure of the short-isoform of the second WW domain from the human membrane-associated guanylate kinase, WW and PDZ domain-containing protein 1 (MAGI-1)
rcsb
source organism Homo sapiens
molecule tags Protein binding
total genus 4
structure length 49
sequence length 49
ec nomenclature
pdb deposition date 2007-10-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00397 WW WW domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.20.70.10 Mainly Beta Single Sheet Ubiquitin Ligase Nedd4; Chain: W; Ubiquitin Ligase Nedd4; Chain: W; 2zajA01
1WMVA 2EZ5W 2JXWA 1F8AB 2YSHA 2ITKA 2M8JA 3KAFA 3LE4A 2E45A 2ZQUA 2YSIA 3TCZA 1YW5A 2XP8A 2KXQA 1EG4A 2ZR4A 2JX8A 2ZQSA 2JMFA 2F21A 2YSBA 2M3OW 2DK7A 1JMQA 2DMVA 2M8IA 1K9QA 3L4HA 1ZCNA 4QIBA 2ZAJA 2JV4A 4U86A 3KABA 3OOBA 2L4JA 2DJYA 3TDBA 1EG3A 3CNGA 1K9RA 3KADA 2DK1A 3KAIA 2RE3A 1PINA 4E5RA 2BA1A 3WH0A 3ODKA 2XPBA 2YSFA 2XPAA 1TK7A 2XP9A 2Q5AA 3KAHA 2XP5A 2LAJA 3NTPA 2XP6A 3M7NA 2ZR6A 2XP3A 4U85A 2YSGA 2DWVA 1WR7A 4REXA 1I5HW 3TC5A 2MDIA 3KCEA 3M85A 5CQ2A 2XP4A 1NMVA 2ZR5A 4U84A 1O6WA 5AHTA 3KAGA 2XP7A 2ZQVA 2ZQTA
chains in the Genus database with same CATH superfamily
1WMVA 2EZ5W 2JXWA 1F8AB 2YSHA 2ITKA 1RP5A 2M8JA 3KAFA 3LE4A 2E45A 3MQHA 2ZQUA 2YSIA 5E65A 3TCZA 1YW5A 2XP8A 2KXQA 2WADA 1EG4A 2ZR4A 2JX8A 2ZQSA 2Y8NB 2JMFA 2OWOA 2F21A 2YSBA 2M3OW 5U47A 2DK7A 1JMQA 2DMVA 2M8IA 1K9QA 4A0TA 3L4HA 1ZCNA 4QIBA 3MQGA 2ZAJA 2JV4A 1TR8A 4U86A 3KABA 3OOBA 2L4JA 2DJYA 3TDBA 1EG3A 3CNGA 1K9RA 3LKXB 5E5WA 3KADA 2DK1A 3KAIA 3FS8A 2RE3A 1PINA 4E5RA 2BA1A 3WH0A 3ODKA 2XPBA 2YSFA 2XPAA 1TK7A 5E66A 2XP9A 2Q5AA 3KAHA 4GLXA 2XP5A 2LAJA 3NTPA 2XP6A 3M7NA 2ZR6A 5E62A 3MCBA 3FSCA 2XP3A 4A0UA 4U85A 2YSGA 2DWVA 1FLCA 1WR7A 4REXA 1I5HW 3TC5A 2MDIA 3KCEA 3M85A 5CQ2A 2XP4A 1NMVA 2ZR5A 2QRVA 3MCBB 4U84A 5E64A 2YAJB 1O6WA 3FSBA 5AHTA 3LKXA 3PQHA 3KAGA 2XP7A 2ZQVA 2WAEA 2ZQTA
chains in the Genus database with same CATH topology
1WMVA 2EZ5W 2JXWA 1F8AB 2YSHA 2ITKA 1RP5A 2M8JA 3KAFA 3LE4A 2E45A 3MQHA 2ZQUA 2YSIA 5E65A 3TCZA 1YW5A 2XP8A 2KXQA 2WADA 1EG4A 2ZR4A 2JX8A 2ZQSA 2Y8NB 2JMFA 2OWOA 2F21A 2YSBA 2M3OW 5U47A 2DK7A 1JMQA 2DMVA 2M8IA 1K9QA 4A0TA 3L4HA 1ZCNA 4QIBA 3MQGA 2ZAJA 2JV4A 1TR8A 4U86A 3KABA 3OOBA 2L4JA 2DJYA 3TDBA 1EG3A 3CNGA 1K9RA 3LKXB 5E5WA 3KADA 2DK1A 3KAIA 3FS8A 2RE3A 1PINA 4E5RA 2BA1A 3WH0A 3ODKA 2XPBA 2YSFA 2XPAA 1TK7A 5E66A 2XP9A 2Q5AA 3KAHA 4GLXA 2XP5A 2LAJA 3NTPA 2XP6A 3M7NA 2ZR6A 5E62A 3MCBA 3FSCA 2XP3A 4A0UA 4U85A 2YSGA 2DWVA 1FLCA 1WR7A 4REXA 1I5HW 3TC5A 2MDIA 3KCEA 3M85A 5CQ2A 2XP4A 1NMVA 2ZR5A 2QRVA 3MCBB 4U84A 5E64A 2YAJB 1O6WA 3FSBA 5AHTA 3LKXA 3PQHA 3KAGA 2XP7A 2ZQVA 2WAEA 2ZQTA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1WMV A;  2EZ5 W;  2JXW A;  1F8A B;  2YSH A;  2ITK A;  2M8J A;  3KAF A;  3LE4 A;  2E45 A;  2ZQU A;  2YSI A;  3TCZ A;  1YW5 A;  2XP8 A;  2KXQ A;  1EG4 A;  2ZR4 A;  2JX8 A;  2ZQS A;  2JMF A;  2F21 A;  2YSB A;  2M3O W;  2DK7 A;  1JMQ A;  2DMV A;  2M8I A;  1K9Q A;  3L4H A;  1ZCN A;  4QIB A;  2ZAJ A;  2JV4 A;  4U86 A;  3KAB A;  3OOB A;  2L4J A;  2DJY A;  3TDB A;  1EG3 A;  3CNG A;  1K9R A;  3KAD A;  2DK1 A;  3KAI A;  2RE3 A;  1PIN A;  4E5R A;  2BA1 A;  3WH0 A;  3ODK A;  2XPB A;  2YSF A;  2XPA A;  1TK7 A;  2XP9 A;  2Q5A A;  3KAH A;  2XP5 A;  2LAJ A;  3NTP A;  2XP6 A;  3M7N A;  2ZR6 A;  2XP3 A;  4U85 A;  2YSG A;  2DWV A;  1WR7 A;  4REX A;  1I5H W;  3TC5 A;  2MDI A;  3KCE A;  3M85 A;  5CQ2 A;  2XP4 A;  1NMV A;  2ZR5 A;  4U84 A;  1O6W A;  5AHT A;  3KAG A;  2XP7 A;  2ZQV A;  2ZQT A; 
#chains in the Genus database with same CATH topology
 1WMV A;  2EZ5 W;  2JXW A;  1F8A B;  2YSH A;  2ITK A;  1RP5 A;  2M8J A;  3KAF A;  3LE4 A;  2E45 A;  3MQH A;  2ZQU A;  2YSI A;  5E65 A;  3TCZ A;  1YW5 A;  2XP8 A;  2KXQ A;  2WAD A;  1EG4 A;  2ZR4 A;  2JX8 A;  2ZQS A;  2Y8N B;  2JMF A;  2OWO A;  2F21 A;  2YSB A;  2M3O W;  5U47 A;  2DK7 A;  1JMQ A;  2DMV A;  2M8I A;  1K9Q A;  4A0T A;  3L4H A;  1ZCN A;  4QIB A;  3MQG A;  2ZAJ A;  2JV4 A;  1TR8 A;  4U86 A;  3KAB A;  3OOB A;  2L4J A;  2DJY A;  3TDB A;  1EG3 A;  3CNG A;  1K9R A;  3LKX B;  5E5W A;  3KAD A;  2DK1 A;  3KAI A;  3FS8 A;  2RE3 A;  1PIN A;  4E5R A;  2BA1 A;  3WH0 A;  3ODK A;  2XPB A;  2YSF A;  2XPA A;  1TK7 A;  5E66 A;  2XP9 A;  2Q5A A;  3KAH A;  4GLX A;  2XP5 A;  2LAJ A;  3NTP A;  2XP6 A;  3M7N A;  2ZR6 A;  5E62 A;  3MCB A;  3FSC A;  2XP3 A;  4A0U A;  4U85 A;  2YSG A;  2DWV A;  1FLC A;  1WR7 A;  4REX A;  1I5H W;  3TC5 A;  2MDI A;  3KCE A;  3M85 A;  5CQ2 A;  2XP4 A;  1NMV A;  2ZR5 A;  2QRV A;  3MCB B;  4U84 A;  5E64 A;  2YAJ B;  1O6W A;  3FSB A;  5AHT A;  3LKX A;  3PQH A;  3KAG A;  2XP7 A;  2ZQV A;  2WAE A;  2ZQT A; 
#chains in the Genus database with same CATH homology
 1WMV A;  2EZ5 W;  2JXW A;  1F8A B;  2YSH A;  2ITK A;  1RP5 A;  2M8J A;  3KAF A;  3LE4 A;  2E45 A;  3MQH A;  2ZQU A;  2YSI A;  5E65 A;  3TCZ A;  1YW5 A;  2XP8 A;  2KXQ A;  2WAD A;  1EG4 A;  2ZR4 A;  2JX8 A;  2ZQS A;  2Y8N B;  2JMF A;  2OWO A;  2F21 A;  2YSB A;  2M3O W;  5U47 A;  2DK7 A;  1JMQ A;  2DMV A;  2M8I A;  1K9Q A;  4A0T A;  3L4H A;  1ZCN A;  4QIB A;  3MQG A;  2ZAJ A;  2JV4 A;  1TR8 A;  4U86 A;  3KAB A;  3OOB A;  2L4J A;  2DJY A;  3TDB A;  1EG3 A;  3CNG A;  1K9R A;  3LKX B;  5E5W A;  3KAD A;  2DK1 A;  3KAI A;  3FS8 A;  2RE3 A;  1PIN A;  4E5R A;  2BA1 A;  3WH0 A;  3ODK A;  2XPB A;  2YSF A;  2XPA A;  1TK7 A;  5E66 A;  2XP9 A;  2Q5A A;  3KAH A;  4GLX A;  2XP5 A;  2LAJ A;  3NTP A;  2XP6 A;  3M7N A;  2ZR6 A;  5E62 A;  3MCB A;  3FSC A;  2XP3 A;  4A0U A;  4U85 A;  2YSG A;  2DWV A;  1FLC A;  1WR7 A;  4REX A;  1I5H W;  3TC5 A;  2MDI A;  3KCE A;  3M85 A;  5CQ2 A;  2XP4 A;  1NMV A;  2ZR5 A;  2QRV A;  3MCB B;  4U84 A;  5E64 A;  2YAJ B;  1O6W A;  3FSB A;  5AHT A;  3LKX A;  3PQH A;  3KAG A;  2XP7 A;  2ZQV A;  2WAE A;  2ZQT A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...