1O6WA

Solution structure of the prp40 ww domain pair of the yeast splicing factor prp40
Total Genus 9
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
9
sequence length
75
structure length
75
Chain Sequence
MSIWKEAKDASGRIYYYNTLTKKSTWEKPKELISQEELLLRENGWKAAKTADGKVYYYNPTTRETSWTIPAFEKK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Nuclear protein
molecule keywords PRE-MRNA PROCESSING PROTEIN PRP40
publication title Solution Structure and Ligand Recognition of the Ww Domain Pair of the Yeast Splicing Factor Prp40
pubmed doi rcsb
source organism Saccharomyces cerevisiae
total genus 9
structure length 75
sequence length 75
ec nomenclature
pdb deposition date 2002-10-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00397 WW WW domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.20.70.10 Mainly Beta Single Sheet Ubiquitin Ligase Nedd4; Chain: W; Ubiquitin Ligase Nedd4; Chain: W; 1o6wA02
2.20.70.10 Mainly Beta Single Sheet Ubiquitin Ligase Nedd4; Chain: W; Ubiquitin Ligase Nedd4; Chain: W; 1o6wA01
1EG3A 1TK7A 1I5HW 2MDIA 3KAGA 2YSIA 3CNGA 3KAIA 2XP9A 3KADA 3TC5A 1YW5A 4QIBA 4U86A 2M8JA 2RE3A 3WH0A 1PINA 2DJYA 1WMVA 2JV4A 2M3OW 3L4HA 4E5RA 3M7NA 2KXQA 2DWVA 1EG4A 2JX8A 3LE4A 3KAHA 4REXA 2EZ5W 2DK7A 2JMFA 2DMVA 2F21A 2M8IA 2XP8A 2ZAJA 3KAFA 2BA1A 4U85A 2Q5AA 1ZCNA 5AHTA 2LAJA 2XP3A 2JXWA 2ZR6A 3NTPA 2YSGA 5CQ2A 3TCZA 1WR7A 3M85A 1F8AB 2L4JA 3TDBA 2E45A 2ZQUA 2XPAA 2YSBA 2ZR5A 2XP5A 2ZR4A 2DK1A 3ODKA 1O6WA 4U84A 2XP7A 2XPBA 1K9QA 1JMQA 2XP4A 3KABA 2ITKA 2YSFA 2ZQSA 2ZQTA 2XP6A 3OOBA 2YSHA 1NMVA 2ZQVA 3KCEA 1K9RA
chains in the Genus database with same CATH superfamily
1EG3A 1TK7A 3LKXB 1I5HW 2MDIA 3KAGA 2YSIA 3CNGA 3KAIA 2XP9A 3KADA 5E5WA 3TC5A 1YW5A 2WAEA 4QIBA 3MQGA 4U86A 2M8JA 2RE3A 3WH0A 1PINA 2DJYA 5U47A 1WMVA 2JV4A 2YAJB 2M3OW 3L4HA 4E5RA 1FLCA 3M7NA 2KXQA 5E64A 3LKXA 1RP5A 2DWVA 3FSCA 1EG4A 2JX8A 3LE4A 3KAHA 4REXA 2EZ5W 3PQHA 4GLXA 2QRVA 2DK7A 1TR8A 2JMFA 2DMVA 3MCBB 2F21A 2M8IA 5E65A 4A0UA 2XP8A 2ZAJA 3KAFA 2BA1A 4U85A 2Q5AA 4A0TA 1ZCNA 5AHTA 2LAJA 2XP3A 2JXWA 2ZR6A 3FSBA 3NTPA 3FS8A 2YSGA 2WADA 3MQHA 5CQ2A 3TCZA 1WR7A 3M85A 1F8AB 2L4JA 3TDBA 2E45A 2ZQUA 2XPAA 5E62A 2YSBA 2ZR5A 2OWOA 2XP5A 2ZR4A 2DK1A 3ODKA 1O6WA 4U84A 2XP7A 2XPBA 1K9QA 2Y8NB 3MCBA 1JMQA 2XP4A 3KABA 2ITKA 5E66A 2YSFA 2ZQSA 2ZQTA 2XP6A 3OOBA 2YSHA 1NMVA 2ZQVA 3KCEA 1K9RA
chains in the Genus database with same CATH topology
1EG3A 1TK7A 3LKXB 1I5HW 2MDIA 3KAGA 2YSIA 3CNGA 3KAIA 2XP9A 3KADA 5E5WA 3TC5A 1YW5A 2WAEA 4QIBA 3MQGA 4U86A 2M8JA 2RE3A 3WH0A 1PINA 2DJYA 5U47A 1WMVA 2JV4A 2YAJB 2M3OW 3L4HA 4E5RA 1FLCA 3M7NA 2KXQA 5E64A 3LKXA 1RP5A 2DWVA 3FSCA 1EG4A 2JX8A 3LE4A 3KAHA 4REXA 2EZ5W 3PQHA 4GLXA 2QRVA 2DK7A 1TR8A 2JMFA 2DMVA 3MCBB 2F21A 2M8IA 5E65A 4A0UA 2XP8A 2ZAJA 3KAFA 2BA1A 4U85A 2Q5AA 4A0TA 1ZCNA 5AHTA 2LAJA 2XP3A 2JXWA 2ZR6A 3FSBA 3NTPA 3FS8A 2YSGA 2WADA 3MQHA 5CQ2A 3TCZA 1WR7A 3M85A 1F8AB 2L4JA 3TDBA 2E45A 2ZQUA 2XPAA 5E62A 2YSBA 2ZR5A 2OWOA 2XP5A 2ZR4A 2DK1A 3ODKA 1O6WA 4U84A 2XP7A 2XPBA 1K9QA 2Y8NB 3MCBA 1JMQA 2XP4A 3KABA 2ITKA 5E66A 2YSFA 2ZQSA 2ZQTA 2XP6A 3OOBA 2YSHA 1NMVA 2ZQVA 3KCEA 1K9RA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1EG3 A;  1TK7 A;  1I5H W;  2MDI A;  3KAG A;  2YSI A;  3CNG A;  3KAI A;  2XP9 A;  3KAD A;  3TC5 A;  1YW5 A;  4QIB A;  4U86 A;  2M8J A;  2RE3 A;  3WH0 A;  1PIN A;  2DJY A;  1WMV A;  2JV4 A;  2M3O W;  3L4H A;  4E5R A;  3M7N A;  2KXQ A;  2DWV A;  1EG4 A;  2JX8 A;  3LE4 A;  3KAH A;  4REX A;  2EZ5 W;  2DK7 A;  2JMF A;  2DMV A;  2F21 A;  2M8I A;  2XP8 A;  2ZAJ A;  3KAF A;  2BA1 A;  4U85 A;  2Q5A A;  1ZCN A;  5AHT A;  2LAJ A;  2XP3 A;  2JXW A;  2ZR6 A;  3NTP A;  2YSG A;  5CQ2 A;  3TCZ A;  1WR7 A;  3M85 A;  1F8A B;  2L4J A;  3TDB A;  2E45 A;  2ZQU A;  2XPA A;  2YSB A;  2ZR5 A;  2XP5 A;  2ZR4 A;  2DK1 A;  3ODK A;  1O6W A;  4U84 A;  2XP7 A;  2XPB A;  1K9Q A;  1JMQ A;  2XP4 A;  3KAB A;  2ITK A;  2YSF A;  2ZQS A;  2ZQT A;  2XP6 A;  3OOB A;  2YSH A;  1NMV A;  2ZQV A;  3KCE A;  1K9R A; 
#chains in the Genus database with same CATH topology
 1EG3 A;  1TK7 A;  3LKX B;  1I5H W;  2MDI A;  3KAG A;  2YSI A;  3CNG A;  3KAI A;  2XP9 A;  3KAD A;  5E5W A;  3TC5 A;  1YW5 A;  2WAE A;  4QIB A;  3MQG A;  4U86 A;  2M8J A;  2RE3 A;  3WH0 A;  1PIN A;  2DJY A;  5U47 A;  1WMV A;  2JV4 A;  2YAJ B;  2M3O W;  3L4H A;  4E5R A;  1FLC A;  3M7N A;  2KXQ A;  5E64 A;  3LKX A;  1RP5 A;  2DWV A;  3FSC A;  1EG4 A;  2JX8 A;  3LE4 A;  3KAH A;  4REX A;  2EZ5 W;  3PQH A;  4GLX A;  2QRV A;  2DK7 A;  1TR8 A;  2JMF A;  2DMV A;  3MCB B;  2F21 A;  2M8I A;  5E65 A;  4A0U A;  2XP8 A;  2ZAJ A;  3KAF A;  2BA1 A;  4U85 A;  2Q5A A;  4A0T A;  1ZCN A;  5AHT A;  2LAJ A;  2XP3 A;  2JXW A;  2ZR6 A;  3FSB A;  3NTP A;  3FS8 A;  2YSG A;  2WAD A;  3MQH A;  5CQ2 A;  3TCZ A;  1WR7 A;  3M85 A;  1F8A B;  2L4J A;  3TDB A;  2E45 A;  2ZQU A;  2XPA A;  5E62 A;  2YSB A;  2ZR5 A;  2OWO A;  2XP5 A;  2ZR4 A;  2DK1 A;  3ODK A;  1O6W A;  4U84 A;  2XP7 A;  2XPB A;  1K9Q A;  2Y8N B;  3MCB A;  1JMQ A;  2XP4 A;  3KAB A;  2ITK A;  5E66 A;  2YSF A;  2ZQS A;  2ZQT A;  2XP6 A;  3OOB A;  2YSH A;  1NMV A;  2ZQV A;  3KCE A;  1K9R A; 
#chains in the Genus database with same CATH homology
 1EG3 A;  1TK7 A;  3LKX B;  1I5H W;  2MDI A;  3KAG A;  2YSI A;  3CNG A;  3KAI A;  2XP9 A;  3KAD A;  5E5W A;  3TC5 A;  1YW5 A;  2WAE A;  4QIB A;  3MQG A;  4U86 A;  2M8J A;  2RE3 A;  3WH0 A;  1PIN A;  2DJY A;  5U47 A;  1WMV A;  2JV4 A;  2YAJ B;  2M3O W;  3L4H A;  4E5R A;  1FLC A;  3M7N A;  2KXQ A;  5E64 A;  3LKX A;  1RP5 A;  2DWV A;  3FSC A;  1EG4 A;  2JX8 A;  3LE4 A;  3KAH A;  4REX A;  2EZ5 W;  3PQH A;  4GLX A;  2QRV A;  2DK7 A;  1TR8 A;  2JMF A;  2DMV A;  3MCB B;  2F21 A;  2M8I A;  5E65 A;  4A0U A;  2XP8 A;  2ZAJ A;  3KAF A;  2BA1 A;  4U85 A;  2Q5A A;  4A0T A;  1ZCN A;  5AHT A;  2LAJ A;  2XP3 A;  2JXW A;  2ZR6 A;  3FSB A;  3NTP A;  3FS8 A;  2YSG A;  2WAD A;  3MQH A;  5CQ2 A;  3TCZ A;  1WR7 A;  3M85 A;  1F8A B;  2L4J A;  3TDB A;  2E45 A;  2ZQU A;  2XPA A;  5E62 A;  2YSB A;  2ZR5 A;  2OWO A;  2XP5 A;  2ZR4 A;  2DK1 A;  3ODK A;  1O6W A;  4U84 A;  2XP7 A;  2XPB A;  1K9Q A;  2Y8N B;  3MCB A;  1JMQ A;  2XP4 A;  3KAB A;  2ITK A;  5E66 A;  2YSF A;  2ZQS A;  2ZQT A;  2XP6 A;  3OOB A;  2YSH A;  1NMV A;  2ZQV A;  3KCE A;  1K9R A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...