1O6WA

Solution structure of the prp40 ww domain pair of the yeast splicing factor prp40
Total Genus 9
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
9
sequence length
75
structure length
75
Chain Sequence
MSIWKEAKDASGRIYYYNTLTKKSTWEKPKELISQEELLLRENGWKAAKTADGKVYYYNPTTRETSWTIPAFEKK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PRE-MRNA PROCESSING PROTEIN PRP40
publication title Solution Structure and Ligand Recognition of the Ww Domain Pair of the Yeast Splicing Factor Prp40
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Nuclear protein
total genus 9
structure length 75
sequence length 75
ec nomenclature
pdb deposition date 2002-10-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00397 WW WW domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.20.70.10 Mainly Beta Single Sheet Ubiquitin Ligase Nedd4; Chain: W; Ubiquitin Ligase Nedd4; Chain: W; 1o6wA02
2.20.70.10 Mainly Beta Single Sheet Ubiquitin Ligase Nedd4; Chain: W; Ubiquitin Ligase Nedd4; Chain: W; 1o6wA01
2ZQUA 1F8AB 2ZAJA 3TCZA 2L4JA 4U85A 4U86A 4REXA 1ZCNA 4E5RA 1WR7A 4U84A 3TC5A 3M85A 3NTPA 3M7NA 2XP8A 1I5HW 2YSIA 2KXQA 2ZR5A 2Q5AA 1TK7A 2XPAA 2ZQVA 2XP4A 1EG3A 2E45A 1JMQA 3LE4A 3ODKA 1K9QA 3WH0A 2ZR6A 2YSBA 2RE3A 2XPBA 3KABA 3OOBA 2F21A 3CNGA 3L4HA 2JMFA 2M8JA 3KAFA 2EZ5W 2ZR4A 5AHTA 2DK1A 2DMVA 3KCEA 1O6WA 2M3OW 2JV4A 2YSGA 2YSHA 2JX8A 2DWVA 2LAJA 2XP7A 2XP9A 2ITKA 3KAGA 3KAHA 3TDBA 2ZQSA 3KADA 2DJYA 4QIBA 1EG4A 2BA1A 2M8IA 2DK7A 3KAIA 1YW5A 2XP6A 2JXWA 2XP5A 2ZQTA 2XP3A 5CQ2A 1WMVA 1NMVA 1PINA 2MDIA 2YSFA 1K9RA
chains in the Genus database with same CATH superfamily
1TR8A 2ZQUA 1F8AB 2ZAJA 3TCZA 2L4JA 4U85A 4U86A 4REXA 3FS8A 3MCBA 1ZCNA 4E5RA 1WR7A 4U84A 3TC5A 3M85A 3NTPA 3M7NA 2XP8A 3MQGA 1I5HW 4A0TA 2YSIA 2KXQA 2ZR5A 2Q5AA 5E5WA 1TK7A 2XPAA 2ZQVA 2XP4A 1EG3A 2E45A 1JMQA 3LE4A 3ODKA 1K9QA 3WH0A 2ZR6A 4GLXA 2YSBA 2YAJB 2RE3A 2XPBA 3KABA 3OOBA 2F21A 3CNGA 3L4HA 2JMFA 2M8JA 3KAFA 5E66A 2EZ5W 2ZR4A 2WADA 4A0UA 5AHTA 2DK1A 3MQHA 2DMVA 3KCEA 1O6WA 2WAEA 2M3OW 2JV4A 2YSGA 2YSHA 2JX8A 2DWVA 2LAJA 2XP7A 2XP9A 2ITKA 3KAGA 3KAHA 3PQHA 3FSCA 5E64A 3LKXB 1FLCA 3TDBA 2QRVA 2ZQSA 5U47A 3KADA 2DJYA 4QIBA 1EG4A 2BA1A 1RP5A 2M8IA 2OWOA 2DK7A 3KAIA 5E65A 3MCBB 1YW5A 3FSBA 2XP6A 2JXWA 2XP5A 2ZQTA 2XP3A 5CQ2A 1WMVA 1NMVA 1PINA 2MDIA 2YSFA 1K9RA 2Y8NB 3LKXA 5E62A
chains in the Genus database with same CATH topology
1TR8A 2ZQUA 1F8AB 2ZAJA 3TCZA 2L4JA 4U85A 4U86A 4REXA 3FS8A 3MCBA 1ZCNA 4E5RA 1WR7A 4U84A 3TC5A 3M85A 3NTPA 3M7NA 2XP8A 3MQGA 1I5HW 4A0TA 2YSIA 2KXQA 2ZR5A 2Q5AA 5E5WA 1TK7A 2XPAA 2ZQVA 2XP4A 1EG3A 2E45A 1JMQA 3LE4A 3ODKA 1K9QA 3WH0A 2ZR6A 4GLXA 2YSBA 2YAJB 2RE3A 2XPBA 3KABA 3OOBA 2F21A 3CNGA 3L4HA 2JMFA 2M8JA 3KAFA 5E66A 2EZ5W 2ZR4A 2WADA 4A0UA 5AHTA 2DK1A 3MQHA 2DMVA 3KCEA 1O6WA 2WAEA 2M3OW 2JV4A 2YSGA 2YSHA 2JX8A 2DWVA 2LAJA 2XP7A 2XP9A 2ITKA 3KAGA 3KAHA 3PQHA 3FSCA 5E64A 3LKXB 1FLCA 3TDBA 2QRVA 2ZQSA 5U47A 3KADA 2DJYA 4QIBA 1EG4A 2BA1A 1RP5A 2M8IA 2OWOA 2DK7A 3KAIA 5E65A 3MCBB 1YW5A 3FSBA 2XP6A 2JXWA 2XP5A 2ZQTA 2XP3A 5CQ2A 1WMVA 1NMVA 1PINA 2MDIA 2YSFA 1K9RA 2Y8NB 3LKXA 5E62A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2ZQU A;  1F8A B;  2ZAJ A;  3TCZ A;  2L4J A;  4U85 A;  4U86 A;  4REX A;  1ZCN A;  4E5R A;  1WR7 A;  4U84 A;  3TC5 A;  3M85 A;  3NTP A;  3M7N A;  2XP8 A;  1I5H W;  2YSI A;  2KXQ A;  2ZR5 A;  2Q5A A;  1TK7 A;  2XPA A;  2ZQV A;  2XP4 A;  1EG3 A;  2E45 A;  1JMQ A;  3LE4 A;  3ODK A;  1K9Q A;  3WH0 A;  2ZR6 A;  2YSB A;  2RE3 A;  2XPB A;  3KAB A;  3OOB A;  2F21 A;  3CNG A;  3L4H A;  2JMF A;  2M8J A;  3KAF A;  2EZ5 W;  2ZR4 A;  5AHT A;  2DK1 A;  2DMV A;  3KCE A;  1O6W A;  2M3O W;  2JV4 A;  2YSG A;  2YSH A;  2JX8 A;  2DWV A;  2LAJ A;  2XP7 A;  2XP9 A;  2ITK A;  3KAG A;  3KAH A;  3TDB A;  2ZQS A;  3KAD A;  2DJY A;  4QIB A;  1EG4 A;  2BA1 A;  2M8I A;  2DK7 A;  3KAI A;  1YW5 A;  2XP6 A;  2JXW A;  2XP5 A;  2ZQT A;  2XP3 A;  5CQ2 A;  1WMV A;  1NMV A;  1PIN A;  2MDI A;  2YSF A;  1K9R A; 
#chains in the Genus database with same CATH topology
 1TR8 A;  2ZQU A;  1F8A B;  2ZAJ A;  3TCZ A;  2L4J A;  4U85 A;  4U86 A;  4REX A;  3FS8 A;  3MCB A;  1ZCN A;  4E5R A;  1WR7 A;  4U84 A;  3TC5 A;  3M85 A;  3NTP A;  3M7N A;  2XP8 A;  3MQG A;  1I5H W;  4A0T A;  2YSI A;  2KXQ A;  2ZR5 A;  2Q5A A;  5E5W A;  1TK7 A;  2XPA A;  2ZQV A;  2XP4 A;  1EG3 A;  2E45 A;  1JMQ A;  3LE4 A;  3ODK A;  1K9Q A;  3WH0 A;  2ZR6 A;  4GLX A;  2YSB A;  2YAJ B;  2RE3 A;  2XPB A;  3KAB A;  3OOB A;  2F21 A;  3CNG A;  3L4H A;  2JMF A;  2M8J A;  3KAF A;  5E66 A;  2EZ5 W;  2ZR4 A;  2WAD A;  4A0U A;  5AHT A;  2DK1 A;  3MQH A;  2DMV A;  3KCE A;  1O6W A;  2WAE A;  2M3O W;  2JV4 A;  2YSG A;  2YSH A;  2JX8 A;  2DWV A;  2LAJ A;  2XP7 A;  2XP9 A;  2ITK A;  3KAG A;  3KAH A;  3PQH A;  3FSC A;  5E64 A;  3LKX B;  1FLC A;  3TDB A;  2QRV A;  2ZQS A;  5U47 A;  3KAD A;  2DJY A;  4QIB A;  1EG4 A;  2BA1 A;  1RP5 A;  2M8I A;  2OWO A;  2DK7 A;  3KAI A;  5E65 A;  3MCB B;  1YW5 A;  3FSB A;  2XP6 A;  2JXW A;  2XP5 A;  2ZQT A;  2XP3 A;  5CQ2 A;  1WMV A;  1NMV A;  1PIN A;  2MDI A;  2YSF A;  1K9R A;  2Y8N B;  3LKX A;  5E62 A; 
#chains in the Genus database with same CATH homology
 1TR8 A;  2ZQU A;  1F8A B;  2ZAJ A;  3TCZ A;  2L4J A;  4U85 A;  4U86 A;  4REX A;  3FS8 A;  3MCB A;  1ZCN A;  4E5R A;  1WR7 A;  4U84 A;  3TC5 A;  3M85 A;  3NTP A;  3M7N A;  2XP8 A;  3MQG A;  1I5H W;  4A0T A;  2YSI A;  2KXQ A;  2ZR5 A;  2Q5A A;  5E5W A;  1TK7 A;  2XPA A;  2ZQV A;  2XP4 A;  1EG3 A;  2E45 A;  1JMQ A;  3LE4 A;  3ODK A;  1K9Q A;  3WH0 A;  2ZR6 A;  4GLX A;  2YSB A;  2YAJ B;  2RE3 A;  2XPB A;  3KAB A;  3OOB A;  2F21 A;  3CNG A;  3L4H A;  2JMF A;  2M8J A;  3KAF A;  5E66 A;  2EZ5 W;  2ZR4 A;  2WAD A;  4A0U A;  5AHT A;  2DK1 A;  3MQH A;  2DMV A;  3KCE A;  1O6W A;  2WAE A;  2M3O W;  2JV4 A;  2YSG A;  2YSH A;  2JX8 A;  2DWV A;  2LAJ A;  2XP7 A;  2XP9 A;  2ITK A;  3KAG A;  3KAH A;  3PQH A;  3FSC A;  5E64 A;  3LKX B;  1FLC A;  3TDB A;  2QRV A;  2ZQS A;  5U47 A;  3KAD A;  2DJY A;  4QIB A;  1EG4 A;  2BA1 A;  1RP5 A;  2M8I A;  2OWO A;  2DK7 A;  3KAI A;  5E65 A;  3MCB B;  1YW5 A;  3FSB A;  2XP6 A;  2JXW A;  2XP5 A;  2ZQT A;  2XP3 A;  5CQ2 A;  1WMV A;  1NMV A;  1PIN A;  2MDI A;  2YSF A;  1K9R A;  2Y8N B;  3LKX A;  5E62 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...