1O6WA

Solution structure of the prp40 ww domain pair of the yeast splicing factor prp40
Total Genus 9
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
9
sequence length
75
structure length
75
Chain Sequence
MSIWKEAKDASGRIYYYNTLTKKSTWEKPKELISQEELLLRENGWKAAKTADGKVYYYNPTTRETSWTIPAFEKK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PRE-MRNA PROCESSING PROTEIN PRP40
publication title Solution Structure and Ligand Recognition of the Ww Domain Pair of the Yeast Splicing Factor Prp40
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Nuclear protein
total genus 9
structure length 75
sequence length 75
ec nomenclature
pdb deposition date 2002-10-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00397 WW WW domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.20.70.10 Mainly Beta Single Sheet Ubiquitin Ligase Nedd4; Chain: W; Ubiquitin Ligase Nedd4; Chain: W; 1o6wA02
2.20.70.10 Mainly Beta Single Sheet Ubiquitin Ligase Nedd4; Chain: W; Ubiquitin Ligase Nedd4; Chain: W; 1o6wA01
2XP9A 2DMVA 3M7NA 2XP4A 2XP5A 2XP6A 1K9RA 3KABA 3KAFA 2ZQSA 2JX8A 3WH0A 2DWVA 1EG3A 2ZQTA 2DJYA 3KAIA 5AHTA 2E45A 2ZR6A 2ITKA 4U84A 2ZR5A 2ZR4A 2L4JA 1PINA 2ZQUA 3KAGA 3KCEA 3ODKA 4REXA 2ZQVA 3CNGA 1EG4A 2XP7A 3KADA 3TC5A 2JMFA 4U85A 3TDBA 2MDIA 3KAHA 1YW5A 2DK7A 3NTPA 2YSBA 2XPAA 2RE3A 1TK7A 2M8JA 2LAJA 3OOBA 1JMQA 1O6WA 2BA1A 2EZ5W 1NMVA 2JXWA 2F21A 2YSHA 2XP8A 4U86A 3L4HA 2KXQA 2YSGA 2XPBA 1ZCNA 2JV4A 2M3OW 2DK1A 2Q5AA 4QIBA 2YSIA 2XP3A 2ZAJA 4E5RA 3M85A 3TCZA 3LE4A 1WR7A 1WMVA 2YSFA 5CQ2A 1K9QA 2M8IA 1F8AB 1I5HW
chains in the Genus database with same CATH superfamily
5U47A 2XP9A 2DMVA 1FLCA 3M7NA 2XP4A 2XP5A 2XP6A 1K9RA 3KABA 3KAFA 2ZQSA 2JX8A 3WH0A 2DWVA 1EG3A 2ZQTA 2DJYA 3KAIA 5AHTA 5E62A 3MCBA 2E45A 2ZR6A 2YAJB 2ITKA 4U84A 2ZR5A 1TR8A 2ZR4A 2L4JA 1PINA 2ZQUA 3LKXB 3KAGA 3KCEA 3ODKA 4REXA 2ZQVA 3CNGA 1RP5A 1EG4A 2XP7A 3KADA 3TC5A 2Y8NB 5E66A 2JMFA 4U85A 3TDBA 3FS8A 3FSBA 5E64A 3LKXA 3PQHA 2MDIA 3KAHA 2QRVA 1YW5A 2DK7A 3NTPA 2YSBA 2WAEA 2XPAA 2RE3A 1TK7A 2OWOA 2M8JA 2LAJA 3OOBA 1JMQA 5E65A 1O6WA 2BA1A 2EZ5W 1NMVA 3MQHA 2JXWA 2F21A 2YSHA 2XP8A 4U86A 4A0TA 4GLXA 3L4HA 2KXQA 2YSGA 2XPBA 1ZCNA 2JV4A 2M3OW 2DK1A 2WADA 2Q5AA 4QIBA 2YSIA 2XP3A 2ZAJA 3MQGA 4E5RA 3M85A 3TCZA 3LE4A 1WR7A 1WMVA 2YSFA 5CQ2A 1K9QA 3FSCA 5E5WA 4A0UA 2M8IA 1F8AB 1I5HW 3MCBB
chains in the Genus database with same CATH topology
5U47A 2XP9A 2DMVA 1FLCA 3M7NA 2XP4A 2XP5A 2XP6A 1K9RA 3KABA 3KAFA 2ZQSA 2JX8A 3WH0A 2DWVA 1EG3A 2ZQTA 2DJYA 3KAIA 5AHTA 5E62A 3MCBA 2E45A 2ZR6A 2YAJB 2ITKA 4U84A 2ZR5A 1TR8A 2ZR4A 2L4JA 1PINA 2ZQUA 3LKXB 3KAGA 3KCEA 3ODKA 4REXA 2ZQVA 3CNGA 1RP5A 1EG4A 2XP7A 3KADA 3TC5A 2Y8NB 5E66A 2JMFA 4U85A 3TDBA 3FS8A 3FSBA 5E64A 3LKXA 3PQHA 2MDIA 3KAHA 2QRVA 1YW5A 2DK7A 3NTPA 2YSBA 2WAEA 2XPAA 2RE3A 1TK7A 2OWOA 2M8JA 2LAJA 3OOBA 1JMQA 5E65A 1O6WA 2BA1A 2EZ5W 1NMVA 3MQHA 2JXWA 2F21A 2YSHA 2XP8A 4U86A 4A0TA 4GLXA 3L4HA 2KXQA 2YSGA 2XPBA 1ZCNA 2JV4A 2M3OW 2DK1A 2WADA 2Q5AA 4QIBA 2YSIA 2XP3A 2ZAJA 3MQGA 4E5RA 3M85A 3TCZA 3LE4A 1WR7A 1WMVA 2YSFA 5CQ2A 1K9QA 3FSCA 5E5WA 4A0UA 2M8IA 1F8AB 1I5HW 3MCBB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2XP9 A;  2DMV A;  3M7N A;  2XP4 A;  2XP5 A;  2XP6 A;  1K9R A;  3KAB A;  3KAF A;  2ZQS A;  2JX8 A;  3WH0 A;  2DWV A;  1EG3 A;  2ZQT A;  2DJY A;  3KAI A;  5AHT A;  2E45 A;  2ZR6 A;  2ITK A;  4U84 A;  2ZR5 A;  2ZR4 A;  2L4J A;  1PIN A;  2ZQU A;  3KAG A;  3KCE A;  3ODK A;  4REX A;  2ZQV A;  3CNG A;  1EG4 A;  2XP7 A;  3KAD A;  3TC5 A;  2JMF A;  4U85 A;  3TDB A;  2MDI A;  3KAH A;  1YW5 A;  2DK7 A;  3NTP A;  2YSB A;  2XPA A;  2RE3 A;  1TK7 A;  2M8J A;  2LAJ A;  3OOB A;  1JMQ A;  1O6W A;  2BA1 A;  2EZ5 W;  1NMV A;  2JXW A;  2F21 A;  2YSH A;  2XP8 A;  4U86 A;  3L4H A;  2KXQ A;  2YSG A;  2XPB A;  1ZCN A;  2JV4 A;  2M3O W;  2DK1 A;  2Q5A A;  4QIB A;  2YSI A;  2XP3 A;  2ZAJ A;  4E5R A;  3M85 A;  3TCZ A;  3LE4 A;  1WR7 A;  1WMV A;  2YSF A;  5CQ2 A;  1K9Q A;  2M8I A;  1F8A B;  1I5H W; 
#chains in the Genus database with same CATH topology
 5U47 A;  2XP9 A;  2DMV A;  1FLC A;  3M7N A;  2XP4 A;  2XP5 A;  2XP6 A;  1K9R A;  3KAB A;  3KAF A;  2ZQS A;  2JX8 A;  3WH0 A;  2DWV A;  1EG3 A;  2ZQT A;  2DJY A;  3KAI A;  5AHT A;  5E62 A;  3MCB A;  2E45 A;  2ZR6 A;  2YAJ B;  2ITK A;  4U84 A;  2ZR5 A;  1TR8 A;  2ZR4 A;  2L4J A;  1PIN A;  2ZQU A;  3LKX B;  3KAG A;  3KCE A;  3ODK A;  4REX A;  2ZQV A;  3CNG A;  1RP5 A;  1EG4 A;  2XP7 A;  3KAD A;  3TC5 A;  2Y8N B;  5E66 A;  2JMF A;  4U85 A;  3TDB A;  3FS8 A;  3FSB A;  5E64 A;  3LKX A;  3PQH A;  2MDI A;  3KAH A;  2QRV A;  1YW5 A;  2DK7 A;  3NTP A;  2YSB A;  2WAE A;  2XPA A;  2RE3 A;  1TK7 A;  2OWO A;  2M8J A;  2LAJ A;  3OOB A;  1JMQ A;  5E65 A;  1O6W A;  2BA1 A;  2EZ5 W;  1NMV A;  3MQH A;  2JXW A;  2F21 A;  2YSH A;  2XP8 A;  4U86 A;  4A0T A;  4GLX A;  3L4H A;  2KXQ A;  2YSG A;  2XPB A;  1ZCN A;  2JV4 A;  2M3O W;  2DK1 A;  2WAD A;  2Q5A A;  4QIB A;  2YSI A;  2XP3 A;  2ZAJ A;  3MQG A;  4E5R A;  3M85 A;  3TCZ A;  3LE4 A;  1WR7 A;  1WMV A;  2YSF A;  5CQ2 A;  1K9Q A;  3FSC A;  5E5W A;  4A0U A;  2M8I A;  1F8A B;  1I5H W;  3MCB B; 
#chains in the Genus database with same CATH homology
 5U47 A;  2XP9 A;  2DMV A;  1FLC A;  3M7N A;  2XP4 A;  2XP5 A;  2XP6 A;  1K9R A;  3KAB A;  3KAF A;  2ZQS A;  2JX8 A;  3WH0 A;  2DWV A;  1EG3 A;  2ZQT A;  2DJY A;  3KAI A;  5AHT A;  5E62 A;  3MCB A;  2E45 A;  2ZR6 A;  2YAJ B;  2ITK A;  4U84 A;  2ZR5 A;  1TR8 A;  2ZR4 A;  2L4J A;  1PIN A;  2ZQU A;  3LKX B;  3KAG A;  3KCE A;  3ODK A;  4REX A;  2ZQV A;  3CNG A;  1RP5 A;  1EG4 A;  2XP7 A;  3KAD A;  3TC5 A;  2Y8N B;  5E66 A;  2JMF A;  4U85 A;  3TDB A;  3FS8 A;  3FSB A;  5E64 A;  3LKX A;  3PQH A;  2MDI A;  3KAH A;  2QRV A;  1YW5 A;  2DK7 A;  3NTP A;  2YSB A;  2WAE A;  2XPA A;  2RE3 A;  1TK7 A;  2OWO A;  2M8J A;  2LAJ A;  3OOB A;  1JMQ A;  5E65 A;  1O6W A;  2BA1 A;  2EZ5 W;  1NMV A;  3MQH A;  2JXW A;  2F21 A;  2YSH A;  2XP8 A;  4U86 A;  4A0T A;  4GLX A;  3L4H A;  2KXQ A;  2YSG A;  2XPB A;  1ZCN A;  2JV4 A;  2M3O W;  2DK1 A;  2WAD A;  2Q5A A;  4QIB A;  2YSI A;  2XP3 A;  2ZAJ A;  3MQG A;  4E5R A;  3M85 A;  3TCZ A;  3LE4 A;  1WR7 A;  1WMV A;  2YSF A;  5CQ2 A;  1K9Q A;  3FSC A;  5E5W A;  4A0U A;  2M8I A;  1F8A B;  1I5H W;  3MCB B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...