3KAIA

Structure-guided design of alpha-amino acid-derived pin1 inhibitors
Total Genus 45
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
45
sequence length
157
structure length
145
Chain Sequence
b'LPPGWEKAMSRSSGRVYYFNHITNASQWERPSEPARVRCSHLLVKHSQSRRPSSWRQEKITRTKEEALELINGYIQKIKSGEEDFESLASQFSDCSSAKARGDLGAFSRGQMQKPFEDASFALRTGEMSGPVFTDSGIHIILRTE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Peptidyl-prolyl cis-trans isomerase NIMA-interacting 1
publication title Structure-guided design of alpha-amino acid-derived Pin1 inhibitors
pubmed doi rcsb
source organism Homo sapiens
molecule tags Isomerase
total genus 45
structure length 145
sequence length 157
ec nomenclature ec 5.2.1.8: Peptidylprolyl isomerase.
pdb deposition date 2009-10-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00397 WW WW domain
A PF00639 Rotamase PPIC-type PPIASE domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.20.70.10 Mainly Beta Single Sheet Ubiquitin Ligase Nedd4; Chain: W; Ubiquitin Ligase Nedd4; Chain: W; 3kaiA01
3.10.50.40 Alpha Beta Roll Chitinase A; domain 3 Chitinase A; domain 3 3kaiA02
1F8AB 1F40A 4U85A 3MDYB 5D75A 2MPHA 1PBKA 4R0XA 5HUAA 2PV1A 2DMVA 2EZ5W 4ODKA 3O5LA 2RUDA 2DG3A 1ROUA 3H9RB 4ODRA 4TW7A 4FN2A 3O5QA 1Q6IA 3O5OA 1D7JA 3EY6A 3JXVA 3UI4A 2MLYA 5HW7A 1NMVA 5CQ2A 3KABA 2F4EA 2KGJA 2MLXA 1NMWA 2BA1A 3KAHA 3PRDA 5DITA 3IKDA 2L2SA 2XP8A 4W9OA 2D9FA 4ODLA 1J4RA 3KAGA 2KE0A 1QPFA 2XP3A 2JXWA 1FKRA 2XP6A 2MDIA 2AWGA 1QZ2A 4LAYA 1I5HW 1BL4A 3KAFA 1FKBA 4DRPA 3NTPA 3UQBA 1ROTA 3O5KA 2E45A 1D7HA 4DT4A 1K9RA 2ZR4A 1JNSA 4MGVA 2M8IA 5DIVA 1N1AA 4ODPA 3O5DA 1FKIA 2DK1A 2DG9A 3CNGA 4ODMA 1FKKA 3O5GA 1FKFA 1ZK6A 4BF8A 3UI6A 2LGOA 3O5FA 3KCEA 3KAIA 4NNRA 3KADA 3NI6A 2DJYA 1Q6UA 1PINA 1KT0A 2PPOA 5HWCA 1T11A 3TCZA 5DIUA 3NRKA 4LAXA 1C9HA 4DRNA 3LE4A 2FAPA 4J4OA 4JFIA 2LKNA 3O5PA 2PV2A 2RSEA 1FAPA 4U86A 4DRHA 1BKFA 1Q1CA 4TW6A 4U84A 4JFLA 2ZQUA 2RUCA 2DG4A 3UQAA 2VCDA 2MNTA 2XP7A 4G50A 2L4JA 1FD9A 5AHTA 1Y0OA 4O2TA 5HT1A 4GGQA 1HXVA 4IQ2A 4ODOA 2JMFA 3B7XA 2XPAA 2RUQA 2F21A 4GIVA 4DRKA 1Q6HA 1B6CA 2YSBA 1M5YA 3UI5A 2XPBA 4G2PA 2PPPA 4QT2A 3JYMA 3KZ7A 1TK7A 4QIBA 2PV3A 2M1IA 1YW5A 1J4IA 2ZAJA 4DRIA 5B8IC 3O5IA 2ZQTA 1J6YA 3IK8A 4IPXA 3LUOA 2JV4A 4REXA 4IQCA 5J6EA 1WR7A 4JYSA 2UZ5A 4J4NA 2KFWA 3CGMA 4DZ3A 4JFKA 2YSIA 4E5RA 1EG3A 4W9QA 2KI3A 4MSPA 3L4HA 4DIPA 2ITKA 4DRJA 3O5EA 3OOBA 4DH0A 4DROA 1FKSA 4DZ2A 4DRMA 3O5RA 2PBCA 4FAPA 3GPKA 3UQIA 1O6WA 2M2AA 1FJDA 4DRQA 2MLZA 2JZVA 5HW8A 3O5JA 2VN1A 1QPLA 3WH0A 1FKGA 2DK7A 2ZQSA 1YATA 2ZR6A 1FKHA 3IHZA 4LAVA 4ODQA 2M08A 2Q5AA 5HTGA 4ODNA 3VAWA 1L1PA 2YSGA 1FKDA 2ZQVA 4TX0A 3ODKA 3UF8A 5HW6A 1A7XA 1FKLA 3TDBA 1P5QA 1FKTA 4TNSA 2XP9A 2MF9A 3CGNA 5I98A 1TCOC 2RQSA 3I6CA 3PA7A 3JYJA 2OFNA 2LJ4A 2ZR5A 3RGCA 4N19A 2YSHA 2KO7A 3IKGA 1D6OA 1EG4A 1FKJA 4TW8A 1EYMA 1WMVA 2PPNA 1EQ3A 5HKGA 2KR7A 2XP4A 2DWVA 1W26A 3RFWA 2M8JA 4LAWA 1K9QA 1J4HA 4C02B 2M3OW 3M85A 2JX8A 5BXJA 5HWBA 2YSFA 2F2DA 2Y78A 4JFJA 4QT3A 3TC5A 1D7IA 1JVWA 1NSGA 1ZCNA 3PRBA 3FAPA 3KACA 3O5MA 5GPGA 2LAJA 2KXQA 2XP5A 1R9HA 4JFMA 2N87A 2LPVA 2K8IA 1U79A 1JNTA 4W9PA 2RE3A 4TYOA 2RURA 4ITZA 2FKEA 1JMQA 1KT1A 3M7NA 2IF4A
chains in the Genus database with same CATH superfamily
1F8AB 1F40A 4U85A 3MDYB 5D75A 2MPHA 2F23A 1PBKA 1W1PA 3ARXA 2WAEA 3RM4A 1TFVA 2O92A 1GPFA 5U47A 4R0XA 1HJXA 4NZCA 5HUAA 2PV1A 2DMVA 2EZ5W 4ODKA 5DO2A 3ARTA 2RUDA 3O5LA 2DG3A 4GLXA 1ROUA 1ZU8A 3WKZA 3H9RB 1E6PA 4ODRA 4TW7A 1NWUA 2DT1A 1HKJA 4FN2A 3O5QA 5DF0A 1Q6IA 3O5OA 1D7JA 3EY6A 3JXVA 3UI4A 2MLYA 3RM9A 5HW7A 1NMVA 5CQ2A 3KABA 2DSZA 2F4EA 2KGJA 2MLXA 2EULA 2YBUA 3LKXB 1NMWA 3B9EA 2BA1A 5HBFA 3KAHA 3PRDA 4NSBA 5DITA 2QF8A 3IKDA 4P8XA 1LL7A 4MNKA 2L2SA 3WQVA 2XP8A 4W9OA 2D9FA 4Z2GA 4ODLA 1ZBCA 3RM8A 1J4RA 3KAGA 3B8SA 2KE0A 1QPFA 2XP3A 2WM0A 2DT2A 2JXWA 4PTMA 1FKRA 1E9LA 3ARYA 2XP6A 2MDIA 4DWSD 2AWGA 1QZ2A 3CHCA 1I5HW 4LAYA 1BL4A 1W9VA 3KAFA 1FKBA 4DRPA 3NTPA 3UQBA 1LQ0A 3WL1A 1E6NA 1ROTA 1E6RA 3WD4A 2YAJB 3O5KA 2E45A 1D7HA 3CZ8A 2YBTA 3B9AA 3ARQA 4DT4A 5E62A 1K9RA 2ZR4A 1JNSA 2DT0A 4MGVA 1E44A 2M8IA 1E15A 5DIVA 3ALFA 1RD6A 1N1AA 4ODPA 3O5DA 3MQHA 1FKIA 2DK1A 2DG9A 3CNGA 4ODMA 3WQWA 1FKKA 3O5GA 2PI6A 1FKFA 1ZK6A 4BF8A 4Z2IA 4IT6A 2WK2A 3UI6A 3GU0A 5E5WA 2LGOA 3EIPA 3O5FA 3KCEA 3KAIA 4NNRA 3KADA 4P8VA 1HKIA 3AS3A 3NI6A 2DJYA 1Q6UA 1PINA 3LKXA 1KT0A 3G6MA 2PPOA 3FXYA 5HWCA 1X6LA 2P4VA 3TCZA 1T11A 4A0TA 5DIUA 4Z2JA 1ITXA 1FLCA 3NRKA 1WNOA 4LAXA 1C9HA 3BXWA 4DRNA 2FDMA 3LE4A 4MPKA 2FAPA 4MNLA 4Q22A 4J4OA 3WD0A 4JFIA 4Z2KA 2LKNA 3CHEA 3O5PA 2DSUA 2PV2A 2RSEA 3MCBB 1FAPA 4WKFA 4U86A 1IX5A 1D2KA 1OGGA 3W4RA 1NWTA 2OLHA 2AOSA 4ZS6A 4DRHA 1BKFA 1Q1CA 4TW6A 4U84A 4A0UA 2WLYA 4JFLA 1EDQA 2ZQUA 2RUCA 2DG4A 2A3CA 1UR9A 4P8WA 1ZBKA 4ZPTR 4HBOA 3UQAA 2VCDA 2MNTA 2XP7A 4G50A 2L4JA 1GRJA 1FD9A 5AHTA 3AS2A 1Y0OA 1XRVA 4AY1A 4O2TA 5HT1A 4GGQA 1SYTA 1HXVA 4WKAA 4IQ2A 4ODOA 2JMFA 3B7XA 4DWSA 2XPAA 1ZBWA 3ARUA 2RUQA 5JH8A 1W1YA 2F21A 1Q6HA 1B6CA 4GIVA 4DRKA 2YSBA 1SR0A 1M5YA 2IUZA 4ZPVR 2XPBA 4G2PA 3UI5A 2PPPA 4QT2A 3JYMA 3KZ7A 1TK7A 3ALGA 4QIBA 2PV3A 2M1IA 1YW5A 4R5EA 1J4IA 1EIBA 1XHGA 1RP5A 2ZAJA 4UDMA 4DRIA 5B8IC 3O5IA 2ZQTA 4P8UA 1J6YA 2DSVA 1W1TA 3IK8A 4IPXA 3FY1A 4MNJA 4Q7NA 3LUOA 3OA5A 2JV4A 4REXA 3MQGA 4IQCA 5J6EA 1WR7A 4JYSA 1GUVA 2UZ5A 4J4NA 2KFWA 3WD1A 4KQZA 3CGMA 4DZ3A 4JFKA 2YSIA 1EHNA 4E5RA 1EG3A 4W9QA 2KI3A 3AS0A 4MSPA 1NWSA 3PR9A 1NH6A 3L4HA 4DIPA 2ITKA 2Y8NB 1ZL1A 4DRJA 4MNMA 1HJVA 4WK9A 1WB0A 3O5EA 3OOBA 4DH0A 5E65A 5GQBA 4DROA 1FKSA 4DZ2A 2B5UB 3FSCA 4L3NA 5GPRA 4DRMA 4KR0B 2A3AA 2G8ZA 3O5RA 4DWSC 1LL6A 5DEZA 1HKMA 1ZB5A 2PBCA 4WIWA 4FAPA 3GPKA 3UQIA 1O6WA 3QOKA 1FFRA 2M2AA 3WL0A 1FJDA 4URIA 2ESCA 4DRQA 2MLZA 2JZVA 5HW8A 3O5JA 1HKKA 2VN1A 3GTYX 2B31A 1QPLA 1GOIA 3WH0A 1FKGA 2DK7A 2ZQSA 4HARA 1YATA 2ZR6A 4ML4A 3ARZA 1FKHA 3IHZA 1ZBVA 2O9OA 3ARPA 4LAVA 4ODQA 2M08A 2Q5AA 5HTGA 4ODNA 3VAWA 1L1PA 2YSGA 3RMEA 4QZVB 5E66A 1CTNA 1FKDA 2ZQVA 3ODKA 4TX0A 1W9UA 3UF8A 5HW6A 1A7XA 1FKLA 3TDBA 4IT4A 1P5QA 1FKTA 4TNSA 4L72B 3BMBA 2XP9A 2MF9A 3CGNA 3AROA 4Z2HA 5I98A 3ARWA 2DSWA 3FSBA 3WD2A 1JNDA 1TCOC 2RQSA 4MAVA 4MTVA 3WD3A 3I6CA 2DPEA 3PA7A 4WJXA 3JYJA 2OFNA 2LJ4A 2ZR5A 4ZPWR 3RGCA 4HBEA 2ETNA 4N19A 2YSHA 2KO7A 3CH9A 3IKGA 3AQUA 1D6OA 1X6NA 1EG4A 1FKJA 1LG2A 4TW8A 1EYMA 1VF8A 1NWRA 2PN0A 1JNEA 1WMVA 2PPNA 3PRAA 2A3BA 1EQ3A 5HKGA 2KR7A 3MCBA 2XP4A 3G6LA 1LL4A 2A3EA 1H0IA 2DWVA 1W26A 3RFWA 2DT3A 2M8JA 3CHDA 1H0GA 3WIJA 2WADA 4LAWA 1K9QA 1J4HA 1OWQA 2G41A 1UR8A 3ARSA 4C02B 1O6IA 2M3OW 3M85A 1W1VA 2JX8A 4W5UA 5BXJA 1OGBA 5HWBA 2YSFA 3AS1A 2F2DA 2Y78A 4LGXA 3ARVA 4JFJA 4QT3A 3PQHA 3TC5A 5E64A 1D7IA 1JVWA 1E6ZA 1NSGA 1ZCNA 2WLZA 3PRBA 1K9TA 3FAPA 1LJYA 3B9DA 4WKHA 3KACA 3O5MA 4S3JA 1W9PA 5GPGA 4DWSB 3ARRA 2LAJA 1HJWA 2KXQA 2XP5A 1WAWA 1JCHB 1R9HA 1LG1A 4JFMA 2N87A 2LPVA 2K8IA 3FS8A 1U79A 2OWOA 1FFQA 1TR8A 2QRVA 1JNTA 4W9PA 2RE3A 4TYOA 2RURA 4ITZA 4XAKA 1KFWA 2FKEA 3CHFA 1JMQA 1KT1A 4S3KA 4Z2LA 3M7NA 2IF4A
chains in the Genus database with same CATH topology
1F8AB 1F40A 4U85A 3MDYB 5D75A 2MPHA 1PBKA 1W1PA 3ARXA 2WAEA 3RM4A 1TFVA 2O92A 1GPFA 5U47A 4R0XA 1HJXA 4NZCA 5HUAA 2PV1A 2DMVA 2EZ5W 4ODKA 5DO2A 3ARTA 2RUDA 3O5LA 2DG3A 4GLXA 1ROUA 1ZU8A 3WKZA 3H9RB 1E6PA 4ODRA 4TW7A 1NWUA 2DT1A 1HKJA 4FN2A 3O5QA 5DF0A 1Q6IA 3O5OA 1D7JA 3EY6A 3JXVA 3UI4A 2MLYA 3RM9A 5HW7A 1NMVA 5CQ2A 3KABA 2DSZA 2F4EA 2KGJA 2MLXA 2YBUA 3LKXB 1NMWA 3B9EA 2BA1A 5HBFA 3KAHA 3PRDA 4NSBA 5DITA 2QF8A 3IKDA 4P8XA 1LL7A 4MNKA 2L2SA 3WQVA 2XP8A 4W9OA 2D9FA 4Z2GA 4ODLA 1ZBCA 3RM8A 1J4RA 3KAGA 3B8SA 2KE0A 1QPFA 2XP3A 2WM0A 2DT2A 2JXWA 4PTMA 1FKRA 1E9LA 3ARYA 2XP6A 2MDIA 4DWSD 2AWGA 1QZ2A 3CHCA 1I5HW 4LAYA 1BL4A 1W9VA 3KAFA 1FKBA 4DRPA 3NTPA 3UQBA 1LQ0A 3WL1A 1E6NA 1ROTA 1E6RA 3WD4A 2YAJB 3O5KA 2E45A 1D7HA 3CZ8A 2YBTA 3B9AA 3ARQA 4DT4A 5E62A 1K9RA 2ZR4A 1JNSA 2DT0A 4MGVA 2M8IA 1E15A 5DIVA 3ALFA 1RD6A 1N1AA 4ODPA 3O5DA 3MQHA 1FKIA 2DK1A 2DG9A 3CNGA 4ODMA 3WQWA 1FKKA 3O5GA 2PI6A 1FKFA 1ZK6A 4BF8A 4Z2IA 4IT6A 2WK2A 3UI6A 5E5WA 2LGOA 3O5FA 3KCEA 3KAIA 4NNRA 3KADA 4P8VA 1HKIA 3AS3A 3NI6A 2DJYA 1Q6UA 1PINA 3LKXA 1KT0A 3G6MA 2PPOA 3FXYA 5HWCA 1X6LA 1T11A 3TCZA 5DIUA 4A0TA 4Z2JA 1ITXA 1FLCA 3NRKA 1WNOA 4LAXA 1C9HA 3BXWA 4DRNA 2FDMA 3LE4A 4MPKA 2FAPA 4MNLA 4Q22A 4J4OA 3WD0A 4JFIA 4Z2KA 2LKNA 3CHEA 3O5PA 2DSUA 2PV2A 2RSEA 3MCBB 1FAPA 4WKFA 4U86A 1IX5A 1D2KA 1OGGA 3W4RA 1NWTA 2OLHA 2AOSA 4ZS6A 4DRHA 1BKFA 1Q1CA 4TW6A 4U84A 4A0UA 2WLYA 4JFLA 1EDQA 2ZQUA 2RUCA 2DG4A 2A3CA 1UR9A 4P8WA 1ZBKA 4ZPTR 4HBOA 3UQAA 2VCDA 2MNTA 2XP7A 4G50A 2L4JA 1FD9A 5AHTA 3AS2A 1Y0OA 1XRVA 4AY1A 4O2TA 5HT1A 4GGQA 1SYTA 1HXVA 4WKAA 4IQ2A 4ODOA 2JMFA 3B7XA 4DWSA 2XPAA 1ZBWA 3ARUA 2RUQA 5JH8A 1W1YA 2F21A 1Q6HA 1B6CA 4GIVA 4DRKA 2YSBA 1SR0A 1M5YA 2IUZA 4ZPVR 2XPBA 4G2PA 3UI5A 2PPPA 4QT2A 3JYMA 3KZ7A 1TK7A 3ALGA 4QIBA 2PV3A 2M1IA 1YW5A 4R5EA 1J4IA 1EIBA 1XHGA 1RP5A 2ZAJA 4DRIA 5B8IC 3O5IA 2ZQTA 4P8UA 1J6YA 2DSVA 1W1TA 3IK8A 4IPXA 3FY1A 4MNJA 4Q7NA 3LUOA 3OA5A 2JV4A 4REXA 3MQGA 4IQCA 5J6EA 1WR7A 4JYSA 1GUVA 2UZ5A 4J4NA 2KFWA 3WD1A 4KQZA 3CGMA 4DZ3A 4JFKA 2YSIA 1EHNA 4E5RA 1EG3A 4W9QA 2KI3A 3AS0A 4MSPA 1NWSA 3PR9A 1NH6A 3L4HA 4DIPA 2ITKA 2Y8NB 1ZL1A 4DRJA 4MNMA 1HJVA 4WK9A 1WB0A 3O5EA 3OOBA 4DH0A 5E65A 5GQBA 4DROA 1FKSA 4DZ2A 3FSCA 4L3NA 5GPRA 4DRMA 4KR0B 2A3AA 2G8ZA 3O5RA 4DWSC 1LL6A 5DEZA 1HKMA 1ZB5A 2PBCA 4WIWA 4FAPA 3GPKA 3UQIA 1O6WA 3QOKA 1FFRA 2M2AA 3WL0A 1FJDA 4URIA 2ESCA 4DRQA 2MLZA 2JZVA 5HW8A 3O5JA 1HKKA 2VN1A 2B31A 1QPLA 1GOIA 3WH0A 1FKGA 2DK7A 2ZQSA 4HARA 1YATA 2ZR6A 4ML4A 3ARZA 1FKHA 3IHZA 1ZBVA 2O9OA 3ARPA 4LAVA 4ODQA 2M08A 2Q5AA 5HTGA 4ODNA 3VAWA 1L1PA 2YSGA 3RMEA 4QZVB 5E66A 1CTNA 1FKDA 2ZQVA 3ODKA 4TX0A 1W9UA 3UF8A 5HW6A 1A7XA 1FKLA 3TDBA 4IT4A 1P5QA 1FKTA 4TNSA 4L72B 2XP9A 2MF9A 3CGNA 3AROA 4Z2HA 5I98A 3ARWA 2DSWA 3FSBA 3WD2A 1JNDA 1TCOC 2RQSA 4MAVA 4MTVA 3WD3A 3I6CA 2DPEA 3PA7A 4WJXA 3JYJA 2OFNA 2LJ4A 2ZR5A 4ZPWR 3RGCA 4HBEA 4N19A 2YSHA 2KO7A 3CH9A 3IKGA 3AQUA 1D6OA 1X6NA 1EG4A 1FKJA 1LG2A 4TW8A 1EYMA 1VF8A 1NWRA 1JNEA 1WMVA 2PPNA 3PRAA 2A3BA 1EQ3A 5HKGA 2KR7A 3MCBA 2XP4A 3G6LA 1LL4A 2A3EA 1H0IA 2DWVA 1W26A 3RFWA 2DT3A 2M8JA 3CHDA 1H0GA 3WIJA 2WADA 4LAWA 1K9QA 1J4HA 1OWQA 2G41A 1UR8A 3ARSA 4C02B 1O6IA 2M3OW 3M85A 1W1VA 2JX8A 4W5UA 5BXJA 1OGBA 5HWBA 2YSFA 3AS1A 2F2DA 2Y78A 4LGXA 3ARVA 4JFJA 4QT3A 3PQHA 3TC5A 5E64A 1D7IA 1JVWA 1E6ZA 1NSGA 1ZCNA 2WLZA 3PRBA 1K9TA 3FAPA 1LJYA 3B9DA 4WKHA 3KACA 3O5MA 4S3JA 1W9PA 5GPGA 4DWSB 3ARRA 2LAJA 1HJWA 2KXQA 2XP5A 1WAWA 1R9HA 1LG1A 4JFMA 2N87A 2LPVA 3FS8A 2K8IA 1U79A 2OWOA 1FFQA 1TR8A 2QRVA 1JNTA 4W9PA 2RE3A 4TYOA 2RURA 4ITZA 4XAKA 1KFWA 2FKEA 3CHFA 1JMQA 1KT1A 4S3KA 4Z2LA 3M7NA 2IF4A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1F8A B;  1F40 A;  4U85 A;  3MDY B;  5D75 A;  2MPH A;  1PBK A;  4R0X A;  5HUA A;  2PV1 A;  2DMV A;  2EZ5 W;  4ODK A;  3O5L A;  2RUD A;  2DG3 A;  1ROU A;  3H9R B;  4ODR A;  4TW7 A;  4FN2 A;  3O5Q A;  1Q6I A;  3O5O A;  1D7J A;  3EY6 A;  3JXV A;  3UI4 A;  2MLY A;  5HW7 A;  1NMV A;  5CQ2 A;  3KAB A;  2F4E A;  2KGJ A;  2MLX A;  1NMW A;  2BA1 A;  3KAH A;  3PRD A;  5DIT A;  3IKD A;  2L2S A;  2XP8 A;  4W9O A;  2D9F A;  4ODL A;  1J4R A;  3KAG A;  2KE0 A;  1QPF A;  2XP3 A;  2JXW A;  1FKR A;  2XP6 A;  2MDI A;  2AWG A;  1QZ2 A;  4LAY A;  1I5H W;  1BL4 A;  3KAF A;  1FKB A;  4DRP A;  3NTP A;  3UQB A;  1ROT A;  3O5K A;  2E45 A;  1D7H A;  4DT4 A;  1K9R A;  2ZR4 A;  1JNS A;  4MGV A;  2M8I A;  5DIV A;  1N1A A;  4ODP A;  3O5D A;  1FKI A;  2DK1 A;  2DG9 A;  3CNG A;  4ODM A;  1FKK A;  3O5G A;  1FKF A;  1ZK6 A;  4BF8 A;  3UI6 A;  2LGO A;  3O5F A;  3KCE A;  3KAI A;  4NNR A;  3KAD A;  3NI6 A;  2DJY A;  1Q6U A;  1PIN A;  1KT0 A;  2PPO A;  5HWC A;  1T11 A;  3TCZ A;  5DIU A;  3NRK A;  4LAX A;  1C9H A;  4DRN A;  3LE4 A;  2FAP A;  4J4O A;  4JFI A;  2LKN A;  3O5P A;  2PV2 A;  2RSE A;  1FAP A;  4U86 A;  4DRH A;  1BKF A;  1Q1C A;  4TW6 A;  4U84 A;  4JFL A;  2ZQU A;  2RUC A;  2DG4 A;  3UQA A;  2VCD A;  2MNT A;  2XP7 A;  4G50 A;  2L4J A;  1FD9 A;  5AHT A;  1Y0O A;  4O2T A;  5HT1 A;  4GGQ A;  1HXV A;  4IQ2 A;  4ODO A;  2JMF A;  3B7X A;  2XPA A;  2RUQ A;  2F21 A;  4GIV A;  4DRK A;  1Q6H A;  1B6C A;  2YSB A;  1M5Y A;  3UI5 A;  2XPB A;  4G2P A;  2PPP A;  4QT2 A;  3JYM A;  3KZ7 A;  1TK7 A;  4QIB A;  2PV3 A;  2M1I A;  1YW5 A;  1J4I A;  2ZAJ A;  4DRI A;  5B8I C;  3O5I A;  2ZQT A;  1J6Y A;  3IK8 A;  4IPX A;  3LUO A;  2JV4 A;  4REX A;  4IQC A;  5J6E A;  1WR7 A;  4JYS A;  2UZ5 A;  4J4N A;  2KFW A;  3CGM A;  4DZ3 A;  4JFK A;  2YSI A;  4E5R A;  1EG3 A;  4W9Q A;  2KI3 A;  4MSP A;  3L4H A;  4DIP A;  2ITK A;  4DRJ A;  3O5E A;  3OOB A;  4DH0 A;  4DRO A;  1FKS A;  4DZ2 A;  4DRM A;  3O5R A;  2PBC A;  4FAP A;  3GPK A;  3UQI A;  1O6W A;  2M2A A;  1FJD A;  4DRQ A;  2MLZ A;  2JZV A;  5HW8 A;  3O5J A;  2VN1 A;  1QPL A;  3WH0 A;  1FKG A;  2DK7 A;  2ZQS A;  1YAT A;  2ZR6 A;  1FKH A;  3IHZ A;  4LAV A;  4ODQ A;  2M08 A;  2Q5A A;  5HTG A;  4ODN A;  3VAW A;  1L1P A;  2YSG A;  1FKD A;  2ZQV A;  4TX0 A;  3ODK A;  3UF8 A;  5HW6 A;  1A7X A;  1FKL A;  3TDB A;  1P5Q A;  1FKT A;  4TNS A;  2XP9 A;  2MF9 A;  3CGN A;  5I98 A;  1TCO C;  2RQS A;  3I6C A;  3PA7 A;  3JYJ A;  2OFN A;  2LJ4 A;  2ZR5 A;  3RGC A;  4N19 A;  2YSH A;  2KO7 A;  3IKG A;  1D6O A;  1EG4 A;  1FKJ A;  4TW8 A;  1EYM A;  1WMV A;  2PPN A;  1EQ3 A;  5HKG A;  2KR7 A;  2XP4 A;  2DWV A;  1W26 A;  3RFW A;  2M8J A;  4LAW A;  1K9Q A;  1J4H A;  4C02 B;  2M3O W;  3M85 A;  2JX8 A;  5BXJ A;  5HWB A;  2YSF A;  2F2D A;  2Y78 A;  4JFJ A;  4QT3 A;  3TC5 A;  1D7I A;  1JVW A;  1NSG A;  1ZCN A;  3PRB A;  3FAP A;  3KAC A;  3O5M A;  5GPG A;  2LAJ A;  2KXQ A;  2XP5 A;  1R9H A;  4JFM A;  2N87 A;  2LPV A;  2K8I A;  1U79 A;  1JNT A;  4W9P A;  2RE3 A;  4TYO A;  2RUR A;  4ITZ A;  2FKE A;  1JMQ A;  1KT1 A;  3M7N A;  2IF4 A; 
#chains in the Genus database with same CATH topology
 1F8A B;  1F40 A;  4U85 A;  3MDY B;  5D75 A;  2MPH A;  2F23 A;  1PBK A;  1W1P A;  3ARX A;  2WAE A;  3RM4 A;  1TFV A;  2O92 A;  1GPF A;  5U47 A;  4R0X A;  1HJX A;  4NZC A;  5HUA A;  2PV1 A;  2DMV A;  2EZ5 W;  4ODK A;  5DO2 A;  3ART A;  2RUD A;  3O5L A;  2DG3 A;  4GLX A;  1ROU A;  1ZU8 A;  3WKZ A;  3H9R B;  1E6P A;  4ODR A;  4TW7 A;  1NWU A;  2DT1 A;  1HKJ A;  4FN2 A;  3O5Q A;  5DF0 A;  1Q6I A;  3O5O A;  1D7J A;  3EY6 A;  3JXV A;  3UI4 A;  2MLY A;  3RM9 A;  5HW7 A;  1NMV A;  5CQ2 A;  3KAB A;  2DSZ A;  2F4E A;  2KGJ A;  2MLX A;  2EUL A;  2YBU A;  3LKX B;  1NMW A;  3B9E A;  2BA1 A;  5HBF A;  3KAH A;  3PRD A;  4NSB A;  5DIT A;  2QF8 A;  3IKD A;  4P8X A;  1LL7 A;  4MNK A;  2L2S A;  3WQV A;  2XP8 A;  4W9O A;  2D9F A;  4Z2G A;  4ODL A;  1ZBC A;  3RM8 A;  1J4R A;  3KAG A;  3B8S A;  2KE0 A;  1QPF A;  2XP3 A;  2WM0 A;  2DT2 A;  2JXW A;  4PTM A;  1FKR A;  1E9L A;  3ARY A;  2XP6 A;  2MDI A;  4DWS D;  2AWG A;  1QZ2 A;  3CHC A;  1I5H W;  4LAY A;  1BL4 A;  1W9V A;  3KAF A;  1FKB A;  4DRP A;  3NTP A;  3UQB A;  1LQ0 A;  3WL1 A;  1E6N A;  1ROT A;  1E6R A;  3WD4 A;  2YAJ B;  3O5K A;  2E45 A;  1D7H A;  3CZ8 A;  2YBT A;  3B9A A;  3ARQ A;  4DT4 A;  5E62 A;  1K9R A;  2ZR4 A;  1JNS A;  2DT0 A;  4MGV A;  1E44 A;  2M8I A;  1E15 A;  5DIV A;  3ALF A;  1RD6 A;  1N1A A;  4ODP A;  3O5D A;  3MQH A;  1FKI A;  2DK1 A;  2DG9 A;  3CNG A;  4ODM A;  3WQW A;  1FKK A;  3O5G A;  2PI6 A;  1FKF A;  1ZK6 A;  4BF8 A;  4Z2I A;  4IT6 A;  2WK2 A;  3UI6 A;  3GU0 A;  5E5W A;  2LGO A;  3EIP A;  3O5F A;  3KCE A;  3KAI A;  4NNR A;  3KAD A;  4P8V A;  1HKI A;  3AS3 A;  3NI6 A;  2DJY A;  1Q6U A;  1PIN A;  3LKX A;  1KT0 A;  3G6M A;  2PPO A;  3FXY A;  5HWC A;  1X6L A;  2P4V A;  3TCZ A;  1T11 A;  4A0T A;  5DIU A;  4Z2J A;  1ITX A;  1FLC A;  3NRK A;  1WNO A;  4LAX A;  1C9H A;  3BXW A;  4DRN A;  2FDM A;  3LE4 A;  4MPK A;  2FAP A;  4MNL A;  4Q22 A;  4J4O A;  3WD0 A;  4JFI A;  4Z2K A;  2LKN A;  3CHE A;  3O5P A;  2DSU A;  2PV2 A;  2RSE A;  3MCB B;  1FAP A;  4WKF A;  4U86 A;  1IX5 A;  1D2K A;  1OGG A;  3W4R A;  1NWT A;  2OLH A;  2AOS A;  4ZS6 A;  4DRH A;  1BKF A;  1Q1C A;  4TW6 A;  4U84 A;  4A0U A;  2WLY A;  4JFL A;  1EDQ A;  2ZQU A;  2RUC A;  2DG4 A;  2A3C A;  1UR9 A;  4P8W A;  1ZBK A;  4ZPT R;  4HBO A;  3UQA A;  2VCD A;  2MNT A;  2XP7 A;  4G50 A;  2L4J A;  1GRJ A;  1FD9 A;  5AHT A;  3AS2 A;  1Y0O A;  1XRV A;  4AY1 A;  4O2T A;  5HT1 A;  4GGQ A;  1SYT A;  1HXV A;  4WKA A;  4IQ2 A;  4ODO A;  2JMF A;  3B7X A;  4DWS A;  2XPA A;  1ZBW A;  3ARU A;  2RUQ A;  5JH8 A;  1W1Y A;  2F21 A;  1Q6H A;  1B6C A;  4GIV A;  4DRK A;  2YSB A;  1SR0 A;  1M5Y A;  2IUZ A;  4ZPV R;  2XPB A;  4G2P A;  3UI5 A;  2PPP A;  4QT2 A;  3JYM A;  3KZ7 A;  1TK7 A;  3ALG A;  4QIB A;  2PV3 A;  2M1I A;  1YW5 A;  4R5E A;  1J4I A;  1EIB A;  1XHG A;  1RP5 A;  2ZAJ A;  4UDM A;  4DRI A;  5B8I C;  3O5I A;  2ZQT A;  4P8U A;  1J6Y A;  2DSV A;  1W1T A;  3IK8 A;  4IPX A;  3FY1 A;  4MNJ A;  4Q7N A;  3LUO A;  3OA5 A;  2JV4 A;  4REX A;  3MQG A;  4IQC A;  5J6E A;  1WR7 A;  4JYS A;  1GUV A;  2UZ5 A;  4J4N A;  2KFW A;  3WD1 A;  4KQZ A;  3CGM A;  4DZ3 A;  4JFK A;  2YSI A;  1EHN A;  4E5R A;  1EG3 A;  4W9Q A;  2KI3 A;  3AS0 A;  4MSP A;  1NWS A;  3PR9 A;  1NH6 A;  3L4H A;  4DIP A;  2ITK A;  2Y8N B;  1ZL1 A;  4DRJ A;  4MNM A;  1HJV A;  4WK9 A;  1WB0 A;  3O5E A;  3OOB A;  4DH0 A;  5E65 A;  5GQB A;  4DRO A;  1FKS A;  4DZ2 A;  2B5U B;  3FSC A;  4L3N A;  5GPR A;  4DRM A;  4KR0 B;  2A3A A;  2G8Z A;  3O5R A;  4DWS C;  1LL6 A;  5DEZ A;  1HKM A;  1ZB5 A;  2PBC A;  4WIW A;  4FAP A;  3GPK A;  3UQI A;  1O6W A;  3QOK A;  1FFR A;  2M2A A;  3WL0 A;  1FJD A;  4URI A;  2ESC A;  4DRQ A;  2MLZ A;  2JZV A;  5HW8 A;  3O5J A;  1HKK A;  2VN1 A;  3GTY X;  2B31 A;  1QPL A;  1GOI A;  3WH0 A;  1FKG A;  2DK7 A;  2ZQS A;  4HAR A;  1YAT A;  2ZR6 A;  4ML4 A;  3ARZ A;  1FKH A;  3IHZ A;  1ZBV A;  2O9O A;  3ARP A;  4LAV A;  4ODQ A;  2M08 A;  2Q5A A;  5HTG A;  4ODN A;  3VAW A;  1L1P A;  2YSG A;  3RME A;  4QZV B;  5E66 A;  1CTN A;  1FKD A;  2ZQV A;  3ODK A;  4TX0 A;  1W9U A;  3UF8 A;  5HW6 A;  1A7X A;  1FKL A;  3TDB A;  4IT4 A;  1P5Q A;  1FKT A;  4TNS A;  4L72 B;  3BMB A;  2XP9 A;  2MF9 A;  3CGN A;  3ARO A;  4Z2H A;  5I98 A;  3ARW A;  2DSW A;  3FSB A;  3WD2 A;  1JND A;  1TCO C;  2RQS A;  4MAV A;  4MTV A;  3WD3 A;  3I6C A;  2DPE A;  3PA7 A;  4WJX A;  3JYJ A;  2OFN A;  2LJ4 A;  2ZR5 A;  4ZPW R;  3RGC A;  4HBE A;  2ETN A;  4N19 A;  2YSH A;  2KO7 A;  3CH9 A;  3IKG A;  3AQU A;  1D6O A;  1X6N A;  1EG4 A;  1FKJ A;  1LG2 A;  4TW8 A;  1EYM A;  1VF8 A;  1NWR A;  2PN0 A;  1JNE A;  1WMV A;  2PPN A;  3PRA A;  2A3B A;  1EQ3 A;  5HKG A;  2KR7 A;  3MCB A;  2XP4 A;  3G6L A;  1LL4 A;  2A3E A;  1H0I A;  2DWV A;  1W26 A;  3RFW A;  2DT3 A;  2M8J A;  3CHD A;  1H0G A;  3WIJ A;  2WAD A;  4LAW A;  1K9Q A;  1J4H A;  1OWQ A;  2G41 A;  1UR8 A;  3ARS A;  4C02 B;  1O6I A;  2M3O W;  3M85 A;  1W1V A;  2JX8 A;  4W5U A;  5BXJ A;  1OGB A;  5HWB A;  2YSF A;  3AS1 A;  2F2D A;  2Y78 A;  4LGX A;  3ARV A;  4JFJ A;  4QT3 A;  3PQH A;  3TC5 A;  5E64 A;  1D7I A;  1JVW A;  1E6Z A;  1NSG A;  1ZCN A;  2WLZ A;  3PRB A;  1K9T A;  3FAP A;  1LJY A;  3B9D A;  4WKH A;  3KAC A;  3O5M A;  4S3J A;  1W9P A;  5GPG A;  4DWS B;  3ARR A;  2LAJ A;  1HJW A;  2KXQ A;  2XP5 A;  1WAW A;  1JCH B;  1R9H A;  1LG1 A;  4JFM A;  2N87 A;  2LPV A;  2K8I A;  3FS8 A;  1U79 A;  2OWO A;  1FFQ A;  1TR8 A;  2QRV A;  1JNT A;  4W9P A;  2RE3 A;  4TYO A;  2RUR A;  4ITZ A;  4XAK A;  1KFW A;  2FKE A;  3CHF A;  1JMQ A;  1KT1 A;  4S3K A;  4Z2L A;  3M7N A;  2IF4 A; 
#chains in the Genus database with same CATH homology
 1F8A B;  1F40 A;  4U85 A;  3MDY B;  5D75 A;  2MPH A;  1PBK A;  1W1P A;  3ARX A;  2WAE A;  3RM4 A;  1TFV A;  2O92 A;  1GPF A;  5U47 A;  4R0X A;  1HJX A;  4NZC A;  5HUA A;  2PV1 A;  2DMV A;  2EZ5 W;  4ODK A;  5DO2 A;  3ART A;  2RUD A;  3O5L A;  2DG3 A;  4GLX A;  1ROU A;  1ZU8 A;  3WKZ A;  3H9R B;  1E6P A;  4ODR A;  4TW7 A;  1NWU A;  2DT1 A;  1HKJ A;  4FN2 A;  3O5Q A;  5DF0 A;  1Q6I A;  3O5O A;  1D7J A;  3EY6 A;  3JXV A;  3UI4 A;  2MLY A;  3RM9 A;  5HW7 A;  1NMV A;  5CQ2 A;  3KAB A;  2DSZ A;  2F4E A;  2KGJ A;  2MLX A;  2YBU A;  3LKX B;  1NMW A;  3B9E A;  2BA1 A;  5HBF A;  3KAH A;  3PRD A;  4NSB A;  5DIT A;  2QF8 A;  3IKD A;  4P8X A;  1LL7 A;  4MNK A;  2L2S A;  3WQV A;  2XP8 A;  4W9O A;  2D9F A;  4Z2G A;  4ODL A;  1ZBC A;  3RM8 A;  1J4R A;  3KAG A;  3B8S A;  2KE0 A;  1QPF A;  2XP3 A;  2WM0 A;  2DT2 A;  2JXW A;  4PTM A;  1FKR A;  1E9L A;  3ARY A;  2XP6 A;  2MDI A;  4DWS D;  2AWG A;  1QZ2 A;  3CHC A;  1I5H W;  4LAY A;  1BL4 A;  1W9V A;  3KAF A;  1FKB A;  4DRP A;  3NTP A;  3UQB A;  1LQ0 A;  3WL1 A;  1E6N A;  1ROT A;  1E6R A;  3WD4 A;  2YAJ B;  3O5K A;  2E45 A;  1D7H A;  3CZ8 A;  2YBT A;  3B9A A;  3ARQ A;  4DT4 A;  5E62 A;  1K9R A;  2ZR4 A;  1JNS A;  2DT0 A;  4MGV A;  2M8I A;  1E15 A;  5DIV A;  3ALF A;  1RD6 A;  1N1A A;  4ODP A;  3O5D A;  3MQH A;  1FKI A;  2DK1 A;  2DG9 A;  3CNG A;  4ODM A;  3WQW A;  1FKK A;  3O5G A;  2PI6 A;  1FKF A;  1ZK6 A;  4BF8 A;  4Z2I A;  4IT6 A;  2WK2 A;  3UI6 A;  5E5W A;  2LGO A;  3O5F A;  3KCE A;  3KAI A;  4NNR A;  3KAD A;  4P8V A;  1HKI A;  3AS3 A;  3NI6 A;  2DJY A;  1Q6U A;  1PIN A;  3LKX A;  1KT0 A;  3G6M A;  2PPO A;  3FXY A;  5HWC A;  1X6L A;  1T11 A;  3TCZ A;  5DIU A;  4A0T A;  4Z2J A;  1ITX A;  1FLC A;  3NRK A;  1WNO A;  4LAX A;  1C9H A;  3BXW A;  4DRN A;  2FDM A;  3LE4 A;  4MPK A;  2FAP A;  4MNL A;  4Q22 A;  4J4O A;  3WD0 A;  4JFI A;  4Z2K A;  2LKN A;  3CHE A;  3O5P A;  2DSU A;  2PV2 A;  2RSE A;  3MCB B;  1FAP A;  4WKF A;  4U86 A;  1IX5 A;  1D2K A;  1OGG A;  3W4R A;  1NWT A;  2OLH A;  2AOS A;  4ZS6 A;  4DRH A;  1BKF A;  1Q1C A;  4TW6 A;  4U84 A;  4A0U A;  2WLY A;  4JFL A;  1EDQ A;  2ZQU A;  2RUC A;  2DG4 A;  2A3C A;  1UR9 A;  4P8W A;  1ZBK A;  4ZPT R;  4HBO A;  3UQA A;  2VCD A;  2MNT A;  2XP7 A;  4G50 A;  2L4J A;  1FD9 A;  5AHT A;  3AS2 A;  1Y0O A;  1XRV A;  4AY1 A;  4O2T A;  5HT1 A;  4GGQ A;  1SYT A;  1HXV A;  4WKA A;  4IQ2 A;  4ODO A;  2JMF A;  3B7X A;  4DWS A;  2XPA A;  1ZBW A;  3ARU A;  2RUQ A;  5JH8 A;  1W1Y A;  2F21 A;  1Q6H A;  1B6C A;  4GIV A;  4DRK A;  2YSB A;  1SR0 A;  1M5Y A;  2IUZ A;  4ZPV R;  2XPB A;  4G2P A;  3UI5 A;  2PPP A;  4QT2 A;  3JYM A;  3KZ7 A;  1TK7 A;  3ALG A;  4QIB A;  2PV3 A;  2M1I A;  1YW5 A;  4R5E A;  1J4I A;  1EIB A;  1XHG A;  1RP5 A;  2ZAJ A;  4DRI A;  5B8I C;  3O5I A;  2ZQT A;  4P8U A;  1J6Y A;  2DSV A;  1W1T A;  3IK8 A;  4IPX A;  3FY1 A;  4MNJ A;  4Q7N A;  3LUO A;  3OA5 A;  2JV4 A;  4REX A;  3MQG A;  4IQC A;  5J6E A;  1WR7 A;  4JYS A;  1GUV A;  2UZ5 A;  4J4N A;  2KFW A;  3WD1 A;  4KQZ A;  3CGM A;  4DZ3 A;  4JFK A;  2YSI A;  1EHN A;  4E5R A;  1EG3 A;  4W9Q A;  2KI3 A;  3AS0 A;  4MSP A;  1NWS A;  3PR9 A;  1NH6 A;  3L4H A;  4DIP A;  2ITK A;  2Y8N B;  1ZL1 A;  4DRJ A;  4MNM A;  1HJV A;  4WK9 A;  1WB0 A;  3O5E A;  3OOB A;  4DH0 A;  5E65 A;  5GQB A;  4DRO A;  1FKS A;  4DZ2 A;  3FSC A;  4L3N A;  5GPR A;  4DRM A;  4KR0 B;  2A3A A;  2G8Z A;  3O5R A;  4DWS C;  1LL6 A;  5DEZ A;  1HKM A;  1ZB5 A;  2PBC A;  4WIW A;  4FAP A;  3GPK A;  3UQI A;  1O6W A;  3QOK A;  1FFR A;  2M2A A;  3WL0 A;  1FJD A;  4URI A;  2ESC A;  4DRQ A;  2MLZ A;  2JZV A;  5HW8 A;  3O5J A;  1HKK A;  2VN1 A;  2B31 A;  1QPL A;  1GOI A;  3WH0 A;  1FKG A;  2DK7 A;  2ZQS A;  4HAR A;  1YAT A;  2ZR6 A;  4ML4 A;  3ARZ A;  1FKH A;  3IHZ A;  1ZBV A;  2O9O A;  3ARP A;  4LAV A;  4ODQ A;  2M08 A;  2Q5A A;  5HTG A;  4ODN A;  3VAW A;  1L1P A;  2YSG A;  3RME A;  4QZV B;  5E66 A;  1CTN A;  1FKD A;  2ZQV A;  3ODK A;  4TX0 A;  1W9U A;  3UF8 A;  5HW6 A;  1A7X A;  1FKL A;  3TDB A;  4IT4 A;  1P5Q A;  1FKT A;  4TNS A;  4L72 B;  2XP9 A;  2MF9 A;  3CGN A;  3ARO A;  4Z2H A;  5I98 A;  3ARW A;  2DSW A;  3FSB A;  3WD2 A;  1JND A;  1TCO C;  2RQS A;  4MAV A;  4MTV A;  3WD3 A;  3I6C A;  2DPE A;  3PA7 A;  4WJX A;  3JYJ A;  2OFN A;  2LJ4 A;  2ZR5 A;  4ZPW R;  3RGC A;  4HBE A;  4N19 A;  2YSH A;  2KO7 A;  3CH9 A;  3IKG A;  3AQU A;  1D6O A;  1X6N A;  1EG4 A;  1FKJ A;  1LG2 A;  4TW8 A;  1EYM A;  1VF8 A;  1NWR A;  1JNE A;  1WMV A;  2PPN A;  3PRA A;  2A3B A;  1EQ3 A;  5HKG A;  2KR7 A;  3MCB A;  2XP4 A;  3G6L A;  1LL4 A;  2A3E A;  1H0I A;  2DWV A;  1W26 A;  3RFW A;  2DT3 A;  2M8J A;  3CHD A;  1H0G A;  3WIJ A;  2WAD A;  4LAW A;  1K9Q A;  1J4H A;  1OWQ A;  2G41 A;  1UR8 A;  3ARS A;  4C02 B;  1O6I A;  2M3O W;  3M85 A;  1W1V A;  2JX8 A;  4W5U A;  5BXJ A;  1OGB A;  5HWB A;  2YSF A;  3AS1 A;  2F2D A;  2Y78 A;  4LGX A;  3ARV A;  4JFJ A;  4QT3 A;  3PQH A;  3TC5 A;  5E64 A;  1D7I A;  1JVW A;  1E6Z A;  1NSG A;  1ZCN A;  2WLZ A;  3PRB A;  1K9T A;  3FAP A;  1LJY A;  3B9D A;  4WKH A;  3KAC A;  3O5M A;  4S3J A;  1W9P A;  5GPG A;  4DWS B;  3ARR A;  2LAJ A;  1HJW A;  2KXQ A;  2XP5 A;  1WAW A;  1R9H A;  1LG1 A;  4JFM A;  2N87 A;  2LPV A;  3FS8 A;  2K8I A;  1U79 A;  2OWO A;  1FFQ A;  1TR8 A;  2QRV A;  1JNT A;  4W9P A;  2RE3 A;  4TYO A;  2RUR A;  4ITZ A;  4XAK A;  1KFW A;  2FKE A;  3CHF A;  1JMQ A;  1KT1 A;  4S3K A;  4Z2L A;  3M7N A;  2IF4 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...