3KAIA

Structure-guided design of alpha-amino acid-derived pin1 inhibitors
Total Genus 45
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
45
sequence length
157
structure length
145
Chain Sequence
LPPGWEKAMSRSSGRVYYFNHITNASQWERPSEPARVRCSHLLVKHSQSRRPSSWRQEKITRTKEEALELINGYIQKIKSGEEDFESLASQFSDCSSAKARGDLGAFSRGQMQKPFEDASFALRTGEMSGPVFTDSGIHIILRTE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Peptidyl-prolyl cis-trans isomerase NIMA-interacting 1
publication title Structure-guided design of alpha-amino acid-derived Pin1 inhibitors
pubmed doi rcsb
source organism Homo sapiens
molecule tags Isomerase
total genus 45
structure length 145
sequence length 157
ec nomenclature ec 5.2.1.8: Peptidylprolyl isomerase.
pdb deposition date 2009-10-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00397 WW WW domain
A PF00639 Rotamase PPIC-type PPIASE domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.20.70.10 Mainly Beta Single Sheet Ubiquitin Ligase Nedd4; Chain: W; Ubiquitin Ligase Nedd4; Chain: W; 3kaiA01
3.10.50.40 Alpha Beta Roll Chitinase A; domain 3 Chitinase A; domain 3 3kaiA02
3UQIA 4ODLA 2RUDA 4R0XA 1FKDA 4ITZA 4ODKA 1F8AB 3TCZA 2XP8A 4E5RA 1B6CA 1JNSA 2RSEA 5DIUA 4IQCA 4DRHA 3IKDA 2JMFA 3RFWA 2XP5A 3ODKA 3CNGA 5AHTA 2L4JA 4DRQA 5CQ2A 1FKRA 2XP6A 2L2SA 3KCEA 2DK1A 3NRKA 2YSFA 4DRJA 3LUOA 3O5RA 4GIVA 4DIPA 2DMVA 1Q1CA 1YW5A 2RE3A 2MLYA 2N87A 1Y0OA 4BF8A 4JFJA 2FAPA 2PV3A 4N19A 2MLXA 1I5HW 1Q6UA 3I6CA 1J4IA 1FKLA 5D75A 3KAGA 4DZ2A 3CGNA 3KACA 1QPFA 3CGMA 2EZ5W 3JYMA 3PA7A 1D7IA 4DROA 2AWGA 4U86A 5DIVA 1ROUA 3KAFA 2MNTA 4DZ3A 3UF8A 3KAIA 2YSBA 4ODOA 4TYOA 1JNTA 2JXWA 1QPLA 4TW8A 2VCDA 2PV1A 1QZ2A 2RQSA 3O5MA 3M7NA 2YSIA 4ODRA 4ODMA 2KR7A 2E45A 2M3OW 2LKNA 1R9HA 3NTPA 5HWBA 1JVWA 4QIBA 2VN1A 5HTGA 5HKGA 2MPHA 5J6EA 1WMVA 4U85A 3MDYB 2MLZA 3RGCA 4U84A 3KAHA 1YATA 3WH0A 1D6OA 3NI6A 5HW6A 5B8IC 4DRMA 1C9HA 2PPNA 1EQ3A 1FKSA 4LAVA 1M5YA 1P5QA 1FKGA 2XP3A 2RURA 2ZR5A 1FKJA 5GPGA 4DT4A 1A7XA 1FAPA 1FKBA 2XPBA 4GGQA 4C02B 2KE0A 4MSPA 4IQ2A 1HXVA 2M8IA 1ROTA 4LAYA 2ZAJA 2M1IA 4NNRA 1NMWA 3O5DA 4LAXA 2XPAA 4FN2A 2PPPA 1KT0A 1J6YA 2DK7A 1K9RA 2UZ5A 3O5KA 4JFLA 1PINA 2ITKA 4TW6A 4QT3A 2JZVA 1TCOC 2ZR6A 4JFKA 3O5EA 3KZ7A 3H9RB 3O5OA 4ODNA 1J4RA 4TNSA 3UI6A 2YSGA 3O5PA 3O5LA 3TDBA 3O5FA 2F21A 4JYSA 4DRIA 1FKTA 3PRBA 1FKKA 2PBCA 4REXA 4DRPA 1FKIA 2BA1A 4ODQA 1FKHA 2D9FA 3UQBA 2DWVA 2RUQA 2JX8A 2LPVA 1K9QA 3KADA 3VAWA 1U79A 4W9OA 2PV2A 1KT1A 2PPOA 2JV4A 4DRKA 5I98A 3M85A 1ZCNA 3OOBA 3UI4A 1EG4A 2Y78A 2ZQTA 2LAJA 4G2PA 2KI3A 2DG3A 1ZK6A 1TK7A 2LJ4A 2Q5AA 1J4HA 3KABA 3UI5A 4O2TA 1F40A 4ODPA 2DG9A 4J4OA 3UQAA 1T11A 2FKEA 1Q6IA 3JXVA 3L4HA 2M8JA 2DJYA 1BKFA 4MGVA 4DRNA 1JMQA 4TX0A 2MF9A 2ZQUA 1FJDA 3FAPA 1FD9A 5HWCA 4LAWA 4IPXA 2M08A 2XP4A 2ZQSA 5HW8A 4JFMA 1EG3A 3O5IA 4JFIA 2ZQVA 1PBKA 4TW7A 3TC5A 1O6WA 1WR7A 1D7HA 1D7JA 3B7XA 3GPKA 1Q6HA 5HW7A 2DG4A 4FAPA 2LGOA 3IKGA 5DITA 2KFWA 4G50A 2F2DA 3O5GA 5HUAA 1FKFA 2XP7A 3EY6A 3LE4A 2XP9A 2ZR4A 2K8IA 2YSHA 4QT2A 1L1PA 2F4EA 1W26A 5HT1A 3JYJA 5BXJA 2MDIA 3IHZA 2KO7A 3O5QA 3PRDA 4W9PA 1EYMA 2RUCA 4W9QA 2M2AA 2OFNA 2KXQA 1N1AA 3IK8A 1NSGA 4DH0A 4J4NA 2KGJA 1NMVA 1BL4A 2IF4A 3O5JA
chains in the Genus database with same CATH superfamily
3UQIA 3AS2A 4ODLA 2RUDA 4MNJA 1FKDA 4R0XA 4ITZA 4ODKA 1F8AB 3WD1A 3TCZA 3MQHA 2YAJB 1ZBCA 1W1PA 2XP8A 2WADA 4E5RA 1B6CA 1OGBA 4DWSC 3QOKA 1JNSA 4DWSB 2RSEA 4Q7NA 5DIUA 4IQCA 4DRHA 3IKDA 2JMFA 3CH9A 2XP5A 3RFWA 1LG2A 4L72B 3CZ8A 4Z2IA 3FSCA 2A3CA 3ODKA 4MAVA 3CNGA 1GRJA 4A0UA 3EIPA 1E6PA 4A0TA 2A3AA 1W1VA 5AHTA 2L4JA 4DRQA 1LQ0A 3RM8A 5CQ2A 1FKRA 2XP6A 2WLZA 4MNKA 1HKMA 2L2SA 3KCEA 2DK1A 3BMBA 3NRKA 4P8XA 2YSFA 4DRJA 4HBEA 3LUOA 3O5RA 4GIVA 1FLCA 2DMVA 4DIPA 2WM0A 5U47A 5DF0A 1Q1CA 1YW5A 2RE3A 2MLYA 2N87A 2YBUA 1Y0OA 4BF8A 4JFJA 2FAPA 4ZPTR 2PV3A 3PRAA 4N19A 3B9DA 2MLXA 1I5HW 1Q6UA 3B9EA 3I6CA 1J4IA 1FKLA 5D75A 3KAGA 4DZ2A 3CGNA 3KACA 1SR0A 1QPFA 3CGMA 2EZ5W 3JYMA 3PA7A 1D7IA 4DROA 1ZL1A 2AWGA 4U86A 3WD2A 3MCBB 5DIVA 1H0IA 1HJXA 1ROUA 3RM4A 3KAFA 2F23A 4P8UA 2MNTA 4DZ3A 1W1YA 1UR8A 2EULA 3UF8A 3KAIA 3W4RA 2YSBA 1ZB5A 4WKAA 4ODOA 4TYOA 1JNTA 2JXWA 2ETNA 3ARZA 3ARUA 1QPLA 4TW8A 4PTMA 2VCDA 2PV1A 1QZ2A 1RP5A 4AY1A 2RQSA 2O92A 3O5MA 3M7NA 2YSIA 1EHNA 4ODRA 4P8VA 4ODMA 2KR7A 2E45A 1LL6A 2M3OW 4WKFA 2QF8A 4KQZA 1CTNA 2LKNA 1R9HA 1VF8A 3NTPA 2B5UB 4IT6A 2WLYA 4WKHA 5HWBA 3AS0A 1JVWA 4QIBA 2VN1A 5HTGA 4MTVA 5HKGA 2MPHA 2DT0A 2PI6A 1SYTA 1WB0A 5J6EA 1EDQA 1WMVA 1GOIA 4U85A 4ML4A 3MDYB 1W1TA 2MLZA 3RGCA 1NWTA 4U84A 4NSBA 2DSWA 3KAHA 1YATA 3WH0A 3LKXB 1TR8A 1D6OA 3NI6A 5HW6A 4QZVB 5B8IC 4DRMA 1C9HA 4Z2GA 1NWRA 2PPNA 5E5WA 2G41A 3GTYX 1EQ3A 1FKSA 4LAVA 3WD3A 1M5YA 1P5QA 1FKGA 4ZPVR 2XP3A 1W9VA 2RURA 4LGXA 3WQVA 1XRVA 2ZR5A 2DT1A 1FKJA 5GPGA 3WL0A 2G8ZA 4DT4A 1A7XA 1FAPA 1E6ZA 1FKBA 2XPBA 3ARSA 4GGQA 4C02B 1E15A 3RM9A 2KE0A 1KFWA 4MSPA 4IQ2A 1HXVA 1ITXA 1OWQA 1D2KA 1FFRA 3ARWA 2M8IA 1ZBWA 1ROTA 4LAYA 5E64A 3OA5A 2DSUA 2ZAJA 2M1IA 4NNRA 1GUVA 2YBTA 1NMWA 1XHGA 3O5DA 3B9AA 4LAXA 2XPAA 4FN2A 2PPPA 1KT0A 1J6YA 1ZBVA 3ARXA 2DK7A 1K9RA 1NWUA 2UZ5A 3ALFA 1UR9A 3O5KA 4JFLA 1ZBKA 1PINA 1E9LA 3FY1A 2ITKA 4MNMA 3AQUA 3ARRA 4TW6A 3G6LA 4QT3A 5JH8A 1HJWA 2JZVA 1TCOC 2ZR6A 4JFKA 4WJXA 4DWSA 3LKXA 3KZ7A 3O5EA 3H9RB 3O5OA 4ODNA 1J4RA 4TNSA 3UI6A 2YSGA 4P8WA 1NWSA 3O5PA 3O5LA 3TDBA 1E6RA 3O5FA 2F21A 4JYSA 3WL1A 4S3KA 3AROA 4DRIA 1FKTA 3PRBA 2QRVA 1FKKA 3WQWA 2PBCA 4REXA 4DRPA 4W5UA 1FKIA 5E66A 2BA1A 2WK2A 4ODQA 2PN0A 1FKHA 3ARPA 3GU0A 2D9FA 3UQBA 2DWVA 2WAEA 2RUQA 3ARVA 1WNOA 4IT4A 4ZS6A 3BXWA 2JX8A 2LPVA 3CHDA 1K9QA 1IX5A 1RD6A 3KADA 2DT2A 3VAWA 1GPFA 1X6LA 1U79A 4W9OA 2PV2A 4WK9A 3WD4A 1KT1A 2PPOA 3WD0A 2JV4A 1LG1A 4L3NA 4DRKA 1H0GA 5I98A 3M85A 4MNLA 2FDMA 1O6IA 1ZCNA 3OOBA 5GPRA 2DPEA 1HKKA 1FFQA 3UI4A 1EG4A 2Y78A 3ARTA 2ZQTA 2LAJA 1LJYA 1NH6A 3CHCA 4G2PA 2KI3A 2DG3A 1ZK6A 4Z2LA 1E6NA 2IUZA 1TK7A 2LJ4A 2Q5AA 4Q22A 1J4HA 1W9UA 3MCBA 3G6MA 3KABA 3UI5A 4O2TA 4WIWA 1F40A 3AS1A 4ODPA 4GLXA 3UQAA 4J4OA 1LL7A 1T11A 2FKEA 1Q6IA 3JXVA 3L4HA 2M8JA 2DJYA 1BKFA 4MGVA 2A3BA 5DEZA 4DRNA 1JMQA 4TX0A 2MF9A 4Z2JA 1EIBA 4HBOA 2ZQUA 3WKZA 1FJDA 1JCHB 3FAPA 2DSVA 1FD9A 2DSZA 5HWCA 4Z2HA 2OWOA 1LL4A 4LAWA 4R5EA 4Z2KA 4IPXA 2M08A 4ZPWR 2XP4A 2ZQSA 5HW8A 4URIA 4JFMA 1EG3A 3O5IA 4JFIA 1E44A 5HBFA 2OLHA 2ZQVA 1JNEA 1PBKA 4TW7A 3PQHA 3TC5A 1HKIA 1O6WA 4XAKA 1WR7A 1D7HA 1D7JA 3ARQA 2A3EA 3AS3A 3B7XA 1Q6HA 2B31A 3GPKA 3FSBA 5HW7A 5E65A 2AOSA 2DG4A 4FAPA 4MPKA 2LGOA 3IKGA 2P4VA 5DITA 3MQGA 1X6NA 2KFWA 4G50A 5DO2A 3FS8A 2F2DA 3O5GA 5HUAA 1FKFA 3B8SA 3CHFA 2XP7A 3EY6A 3WIJA 3LE4A 2XP9A 2ZR4A 4NZCA 1K9TA 2K8IA 2YSHA 1OGGA 4QT2A 1L1PA 4UDMA 1WAWA 3RMEA 2F4EA 2DT3A 1W26A 5HT1A 1W9PA 3JYJA 5BXJA 1ZU8A 2MDIA 3ALGA 2KO7A 3IHZA 3O5QA 3PRDA 4KR0B 1TFVA 4W9PA 1EYMA 2RUCA 4W9QA 4S3JA 5E62A 1JNDA 2M2AA 2ESCA 2OFNA 3ARYA 2KXQA 1N1AA 3IK8A 2Y8NB 1NSGA 4DWSD 5GQBA 4DH0A 4J4NA 2KGJA 1NMVA 1HKJA 4HARA 3O5JA 1BL4A 2O9OA 3FXYA 3CHEA 2IF4A 2DG9A 3PR9A 1HJVA
chains in the Genus database with same CATH topology
3UQIA 3AS2A 4ODLA 2RUDA 4MNJA 1FKDA 4R0XA 4ITZA 4ODKA 1F8AB 3WD1A 3TCZA 3MQHA 2YAJB 1ZBCA 1W1PA 2XP8A 2WADA 4E5RA 1B6CA 1OGBA 4DWSC 3QOKA 1JNSA 4DWSB 2RSEA 4Q7NA 5DIUA 4IQCA 4DRHA 3IKDA 2JMFA 3CH9A 2XP5A 3RFWA 1LG2A 4L72B 3CZ8A 4Z2IA 3FSCA 2A3CA 3ODKA 4MAVA 3CNGA 4A0UA 1E6PA 4A0TA 2A3AA 1W1VA 5AHTA 2L4JA 4DRQA 1LQ0A 3RM8A 5CQ2A 1FKRA 2XP6A 2WLZA 4MNKA 1HKMA 2L2SA 3KCEA 2DK1A 3NRKA 4P8XA 2YSFA 4DRJA 4HBEA 3LUOA 3O5RA 4GIVA 1FLCA 2DMVA 4DIPA 2WM0A 5U47A 5DF0A 1Q1CA 1YW5A 2RE3A 2MLYA 2N87A 2YBUA 1Y0OA 4BF8A 4JFJA 2FAPA 4ZPTR 2PV3A 3PRAA 4N19A 3B9DA 2MLXA 1I5HW 1Q6UA 3B9EA 3I6CA 1J4IA 1FKLA 5D75A 3KAGA 4DZ2A 3CGNA 3KACA 1SR0A 1QPFA 3CGMA 2EZ5W 3JYMA 3PA7A 1D7IA 4DROA 1ZL1A 2AWGA 4U86A 3WD2A 3MCBB 5DIVA 1H0IA 1HJXA 1ROUA 3RM4A 3KAFA 4P8UA 2MNTA 4DZ3A 1W1YA 1UR8A 3UF8A 3KAIA 3W4RA 2YSBA 1ZB5A 4WKAA 4ODOA 4TYOA 1JNTA 2JXWA 3ARZA 3ARUA 1QPLA 4TW8A 4PTMA 2VCDA 2PV1A 1QZ2A 1RP5A 4AY1A 2RQSA 2O92A 3O5MA 3M7NA 2YSIA 1EHNA 4ODRA 4P8VA 4ODMA 2KR7A 2E45A 1LL6A 2M3OW 4WKFA 2QF8A 4KQZA 1CTNA 2LKNA 1R9HA 1VF8A 3NTPA 4IT6A 5HWBA 2WLYA 4WKHA 3AS0A 1JVWA 4QIBA 2VN1A 5HTGA 4MTVA 5HKGA 2MPHA 2DT0A 2PI6A 1SYTA 1WB0A 5J6EA 1EDQA 1WMVA 1GOIA 4U85A 4ML4A 3MDYB 1W1TA 2MLZA 3RGCA 1NWTA 4U84A 4NSBA 2DSWA 3KAHA 1YATA 3WH0A 3LKXB 1TR8A 1D6OA 3NI6A 5HW6A 4QZVB 5B8IC 4DRMA 1C9HA 4Z2GA 1NWRA 2PPNA 5E5WA 2G41A 1EQ3A 1FKSA 4LAVA 3WD3A 1M5YA 1P5QA 1FKGA 4ZPVR 2XP3A 1W9VA 2RURA 4LGXA 3WQVA 1XRVA 2ZR5A 2DT1A 1FKJA 5GPGA 3WL0A 2G8ZA 4DT4A 1A7XA 1FAPA 1E6ZA 1FKBA 2XPBA 3ARSA 4GGQA 4C02B 1E15A 3RM9A 2KE0A 1KFWA 4MSPA 4IQ2A 1HXVA 1ITXA 1OWQA 1D2KA 1FFRA 3ARWA 2M8IA 1ZBWA 1ROTA 4LAYA 5E64A 3OA5A 2DSUA 2ZAJA 2M1IA 4NNRA 1GUVA 2YBTA 1NMWA 1XHGA 3O5DA 3B9AA 4LAXA 2XPAA 4FN2A 2PPPA 1KT0A 1J6YA 1ZBVA 3ARXA 2DK7A 1K9RA 1NWUA 2UZ5A 3ALFA 1UR9A 3O5KA 4JFLA 1ZBKA 1PINA 1E9LA 3FY1A 2ITKA 4MNMA 3AQUA 3ARRA 4TW6A 3G6LA 4QT3A 5JH8A 1HJWA 2JZVA 1TCOC 2ZR6A 4JFKA 4WJXA 4DWSA 3LKXA 3KZ7A 3O5EA 3H9RB 3O5OA 4ODNA 1J4RA 4TNSA 3UI6A 2YSGA 4P8WA 1NWSA 3O5PA 3O5LA 3TDBA 1E6RA 3O5FA 2F21A 4JYSA 3WL1A 4S3KA 3AROA 4DRIA 1FKTA 3PRBA 2QRVA 1FKKA 3WQWA 2PBCA 4REXA 4DRPA 4W5UA 1FKIA 5E66A 2BA1A 2WK2A 4ODQA 1FKHA 3ARPA 2D9FA 3UQBA 2DWVA 2WAEA 2RUQA 3ARVA 1WNOA 4IT4A 4ZS6A 3BXWA 2JX8A 2LPVA 3CHDA 1K9QA 1IX5A 1RD6A 3KADA 2DT2A 3VAWA 1GPFA 1X6LA 1U79A 4W9OA 2PV2A 4WK9A 3WD4A 1KT1A 2PPOA 3WD0A 2JV4A 1LG1A 4L3NA 4DRKA 1H0GA 5I98A 3M85A 4MNLA 2FDMA 1O6IA 1ZCNA 3OOBA 5GPRA 2DPEA 1HKKA 1FFQA 3UI4A 1EG4A 2Y78A 3ARTA 2ZQTA 2LAJA 1LJYA 1NH6A 3CHCA 4G2PA 2KI3A 2DG3A 1ZK6A 4Z2LA 1E6NA 2IUZA 1TK7A 2LJ4A 2Q5AA 4Q22A 1J4HA 1W9UA 3MCBA 3G6MA 3KABA 3UI5A 4O2TA 4WIWA 1F40A 3AS1A 4ODPA 4GLXA 3UQAA 4J4OA 1LL7A 1T11A 2FKEA 1Q6IA 3JXVA 3L4HA 2M8JA 2DJYA 1BKFA 4MGVA 2A3BA 5DEZA 4DRNA 1JMQA 4TX0A 2MF9A 4Z2JA 1EIBA 4HBOA 2ZQUA 3WKZA 1FJDA 3FAPA 2DSVA 1FD9A 2DSZA 5HWCA 4Z2HA 2OWOA 1LL4A 4LAWA 4R5EA 4Z2KA 4IPXA 2M08A 4ZPWR 2XP4A 2ZQSA 5HW8A 4URIA 4JFMA 1EG3A 3O5IA 4JFIA 5HBFA 2OLHA 2ZQVA 1JNEA 1PBKA 4TW7A 3PQHA 3TC5A 1HKIA 1O6WA 4XAKA 1WR7A 1D7HA 1D7JA 3ARQA 2A3EA 3AS3A 3B7XA 1Q6HA 2B31A 3GPKA 3FSBA 5HW7A 5E65A 2AOSA 2DG4A 4FAPA 4MPKA 2LGOA 3IKGA 5DITA 3MQGA 1X6NA 2KFWA 4G50A 5DO2A 3FS8A 2F2DA 3O5GA 5HUAA 1FKFA 3B8SA 3CHFA 2XP7A 3EY6A 3WIJA 3LE4A 2XP9A 2ZR4A 4NZCA 1K9TA 2K8IA 2YSHA 1OGGA 4QT2A 1L1PA 1WAWA 3RMEA 2F4EA 2DT3A 1W26A 5HT1A 1W9PA 3JYJA 5BXJA 1ZU8A 2MDIA 3ALGA 2KO7A 3IHZA 3O5QA 3PRDA 4KR0B 1TFVA 4W9PA 1EYMA 2RUCA 4W9QA 4S3JA 5E62A 1JNDA 2M2AA 2ESCA 2OFNA 3ARYA 2KXQA 1N1AA 3IK8A 2Y8NB 1NSGA 4DWSD 5GQBA 4DH0A 4J4NA 2KGJA 1NMVA 1HKJA 4HARA 3O5JA 1BL4A 2O9OA 3FXYA 3CHEA 2IF4A 2DG9A 3PR9A 1HJVA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3UQI A;  4ODL A;  2RUD A;  4R0X A;  1FKD A;  4ITZ A;  4ODK A;  1F8A B;  3TCZ A;  2XP8 A;  4E5R A;  1B6C A;  1JNS A;  2RSE A;  5DIU A;  4IQC A;  4DRH A;  3IKD A;  2JMF A;  3RFW A;  2XP5 A;  3ODK A;  3CNG A;  5AHT A;  2L4J A;  4DRQ A;  5CQ2 A;  1FKR A;  2XP6 A;  2L2S A;  3KCE A;  2DK1 A;  3NRK A;  2YSF A;  4DRJ A;  3LUO A;  3O5R A;  4GIV A;  4DIP A;  2DMV A;  1Q1C A;  1YW5 A;  2RE3 A;  2MLY A;  2N87 A;  1Y0O A;  4BF8 A;  4JFJ A;  2FAP A;  2PV3 A;  4N19 A;  2MLX A;  1I5H W;  1Q6U A;  3I6C A;  1J4I A;  1FKL A;  5D75 A;  3KAG A;  4DZ2 A;  3CGN A;  3KAC A;  1QPF A;  3CGM A;  2EZ5 W;  3JYM A;  3PA7 A;  1D7I A;  4DRO A;  2AWG A;  4U86 A;  5DIV A;  1ROU A;  3KAF A;  2MNT A;  4DZ3 A;  3UF8 A;  3KAI A;  2YSB A;  4ODO A;  4TYO A;  1JNT A;  2JXW A;  1QPL A;  4TW8 A;  2VCD A;  2PV1 A;  1QZ2 A;  2RQS A;  3O5M A;  3M7N A;  2YSI A;  4ODR A;  4ODM A;  2KR7 A;  2E45 A;  2M3O W;  2LKN A;  1R9H A;  3NTP A;  5HWB A;  1JVW A;  4QIB A;  2VN1 A;  5HTG A;  5HKG A;  2MPH A;  5J6E A;  1WMV A;  4U85 A;  3MDY B;  2MLZ A;  3RGC A;  4U84 A;  3KAH A;  1YAT A;  3WH0 A;  1D6O A;  3NI6 A;  5HW6 A;  5B8I C;  4DRM A;  1C9H A;  2PPN A;  1EQ3 A;  1FKS A;  4LAV A;  1M5Y A;  1P5Q A;  1FKG A;  2XP3 A;  2RUR A;  2ZR5 A;  1FKJ A;  5GPG A;  4DT4 A;  1A7X A;  1FAP A;  1FKB A;  2XPB A;  4GGQ A;  4C02 B;  2KE0 A;  4MSP A;  4IQ2 A;  1HXV A;  2M8I A;  1ROT A;  4LAY A;  2ZAJ A;  2M1I A;  4NNR A;  1NMW A;  3O5D A;  4LAX A;  2XPA A;  4FN2 A;  2PPP A;  1KT0 A;  1J6Y A;  2DK7 A;  1K9R A;  2UZ5 A;  3O5K A;  4JFL A;  1PIN A;  2ITK A;  4TW6 A;  4QT3 A;  2JZV A;  1TCO C;  2ZR6 A;  4JFK A;  3O5E A;  3KZ7 A;  3H9R B;  3O5O A;  4ODN A;  1J4R A;  4TNS A;  3UI6 A;  2YSG A;  3O5P A;  3O5L A;  3TDB A;  3O5F A;  2F21 A;  4JYS A;  4DRI A;  1FKT A;  3PRB A;  1FKK A;  2PBC A;  4REX A;  4DRP A;  1FKI A;  2BA1 A;  4ODQ A;  1FKH A;  2D9F A;  3UQB A;  2DWV A;  2RUQ A;  2JX8 A;  2LPV A;  1K9Q A;  3KAD A;  3VAW A;  1U79 A;  4W9O A;  2PV2 A;  1KT1 A;  2PPO A;  2JV4 A;  4DRK A;  5I98 A;  3M85 A;  1ZCN A;  3OOB A;  3UI4 A;  1EG4 A;  2Y78 A;  2ZQT A;  2LAJ A;  4G2P A;  2KI3 A;  2DG3 A;  1ZK6 A;  1TK7 A;  2LJ4 A;  2Q5A A;  1J4H A;  3KAB A;  3UI5 A;  4O2T A;  1F40 A;  4ODP A;  2DG9 A;  4J4O A;  3UQA A;  1T11 A;  2FKE A;  1Q6I A;  3JXV A;  3L4H A;  2M8J A;  2DJY A;  1BKF A;  4MGV A;  4DRN A;  1JMQ A;  4TX0 A;  2MF9 A;  2ZQU A;  1FJD A;  3FAP A;  1FD9 A;  5HWC A;  4LAW A;  4IPX A;  2M08 A;  2XP4 A;  2ZQS A;  5HW8 A;  4JFM A;  1EG3 A;  3O5I A;  4JFI A;  2ZQV A;  1PBK A;  4TW7 A;  3TC5 A;  1O6W A;  1WR7 A;  1D7H A;  1D7J A;  3B7X A;  3GPK A;  1Q6H A;  5HW7 A;  2DG4 A;  4FAP A;  2LGO A;  3IKG A;  5DIT A;  2KFW A;  4G50 A;  2F2D A;  3O5G A;  5HUA A;  1FKF A;  2XP7 A;  3EY6 A;  3LE4 A;  2XP9 A;  2ZR4 A;  2K8I A;  2YSH A;  4QT2 A;  1L1P A;  2F4E A;  1W26 A;  5HT1 A;  3JYJ A;  5BXJ A;  2MDI A;  3IHZ A;  2KO7 A;  3O5Q A;  3PRD A;  4W9P A;  1EYM A;  2RUC A;  4W9Q A;  2M2A A;  2OFN A;  2KXQ A;  1N1A A;  3IK8 A;  1NSG A;  4DH0 A;  4J4N A;  2KGJ A;  1NMV A;  1BL4 A;  2IF4 A;  3O5J A; 
#chains in the Genus database with same CATH topology
 3UQI A;  3AS2 A;  4ODL A;  2RUD A;  4MNJ A;  1FKD A;  4R0X A;  4ITZ A;  4ODK A;  1F8A B;  3WD1 A;  3TCZ A;  3MQH A;  2YAJ B;  1ZBC A;  1W1P A;  2XP8 A;  2WAD A;  4E5R A;  1B6C A;  1OGB A;  4DWS C;  3QOK A;  1JNS A;  4DWS B;  2RSE A;  4Q7N A;  5DIU A;  4IQC A;  4DRH A;  3IKD A;  2JMF A;  3CH9 A;  2XP5 A;  3RFW A;  1LG2 A;  4L72 B;  3CZ8 A;  4Z2I A;  3FSC A;  2A3C A;  3ODK A;  4MAV A;  3CNG A;  1GRJ A;  4A0U A;  3EIP A;  1E6P A;  4A0T A;  2A3A A;  1W1V A;  5AHT A;  2L4J A;  4DRQ A;  1LQ0 A;  3RM8 A;  5CQ2 A;  1FKR A;  2XP6 A;  2WLZ A;  4MNK A;  1HKM A;  2L2S A;  3KCE A;  2DK1 A;  3BMB A;  3NRK A;  4P8X A;  2YSF A;  4DRJ A;  4HBE A;  3LUO A;  3O5R A;  4GIV A;  1FLC A;  2DMV A;  4DIP A;  2WM0 A;  5U47 A;  5DF0 A;  1Q1C A;  1YW5 A;  2RE3 A;  2MLY A;  2N87 A;  2YBU A;  1Y0O A;  4BF8 A;  4JFJ A;  2FAP A;  4ZPT R;  2PV3 A;  3PRA A;  4N19 A;  3B9D A;  2MLX A;  1I5H W;  1Q6U A;  3B9E A;  3I6C A;  1J4I A;  1FKL A;  5D75 A;  3KAG A;  4DZ2 A;  3CGN A;  3KAC A;  1SR0 A;  1QPF A;  3CGM A;  2EZ5 W;  3JYM A;  3PA7 A;  1D7I A;  4DRO A;  1ZL1 A;  2AWG A;  4U86 A;  3WD2 A;  3MCB B;  5DIV A;  1H0I A;  1HJX A;  1ROU A;  3RM4 A;  3KAF A;  2F23 A;  4P8U A;  2MNT A;  4DZ3 A;  1W1Y A;  1UR8 A;  2EUL A;  3UF8 A;  3KAI A;  3W4R A;  2YSB A;  1ZB5 A;  4WKA A;  4ODO A;  4TYO A;  1JNT A;  2JXW A;  2ETN A;  3ARZ A;  3ARU A;  1QPL A;  4TW8 A;  4PTM A;  2VCD A;  2PV1 A;  1QZ2 A;  1RP5 A;  4AY1 A;  2RQS A;  2O92 A;  3O5M A;  3M7N A;  2YSI A;  1EHN A;  4ODR A;  4P8V A;  4ODM A;  2KR7 A;  2E45 A;  1LL6 A;  2M3O W;  4WKF A;  2QF8 A;  4KQZ A;  1CTN A;  2LKN A;  1R9H A;  1VF8 A;  3NTP A;  2B5U B;  4IT6 A;  2WLY A;  4WKH A;  5HWB A;  3AS0 A;  1JVW A;  4QIB A;  2VN1 A;  5HTG A;  4MTV A;  5HKG A;  2MPH A;  2DT0 A;  2PI6 A;  1SYT A;  1WB0 A;  5J6E A;  1EDQ A;  1WMV A;  1GOI A;  4U85 A;  4ML4 A;  3MDY B;  1W1T A;  2MLZ A;  3RGC A;  1NWT A;  4U84 A;  4NSB A;  2DSW A;  3KAH A;  1YAT A;  3WH0 A;  3LKX B;  1TR8 A;  1D6O A;  3NI6 A;  5HW6 A;  4QZV B;  5B8I C;  4DRM A;  1C9H A;  4Z2G A;  1NWR A;  2PPN A;  5E5W A;  2G41 A;  3GTY X;  1EQ3 A;  1FKS A;  4LAV A;  3WD3 A;  1M5Y A;  1P5Q A;  1FKG A;  4ZPV R;  2XP3 A;  1W9V A;  2RUR A;  4LGX A;  3WQV A;  1XRV A;  2ZR5 A;  2DT1 A;  1FKJ A;  5GPG A;  3WL0 A;  2G8Z A;  4DT4 A;  1A7X A;  1FAP A;  1E6Z A;  1FKB A;  2XPB A;  3ARS A;  4GGQ A;  4C02 B;  1E15 A;  3RM9 A;  2KE0 A;  1KFW A;  4MSP A;  4IQ2 A;  1HXV A;  1ITX A;  1OWQ A;  1D2K A;  1FFR A;  3ARW A;  2M8I A;  1ZBW A;  1ROT A;  4LAY A;  5E64 A;  3OA5 A;  2DSU A;  2ZAJ A;  2M1I A;  4NNR A;  1GUV A;  2YBT A;  1NMW A;  1XHG A;  3O5D A;  3B9A A;  4LAX A;  2XPA A;  4FN2 A;  2PPP A;  1KT0 A;  1J6Y A;  1ZBV A;  3ARX A;  2DK7 A;  1K9R A;  1NWU A;  2UZ5 A;  3ALF A;  1UR9 A;  3O5K A;  4JFL A;  1ZBK A;  1PIN A;  1E9L A;  3FY1 A;  2ITK A;  4MNM A;  3AQU A;  3ARR A;  4TW6 A;  3G6L A;  4QT3 A;  5JH8 A;  1HJW A;  2JZV A;  1TCO C;  2ZR6 A;  4JFK A;  4WJX A;  4DWS A;  3LKX A;  3KZ7 A;  3O5E A;  3H9R B;  3O5O A;  4ODN A;  1J4R A;  4TNS A;  3UI6 A;  2YSG A;  4P8W A;  1NWS A;  3O5P A;  3O5L A;  3TDB A;  1E6R A;  3O5F A;  2F21 A;  4JYS A;  3WL1 A;  4S3K A;  3ARO A;  4DRI A;  1FKT A;  3PRB A;  2QRV A;  1FKK A;  3WQW A;  2PBC A;  4REX A;  4DRP A;  4W5U A;  1FKI A;  5E66 A;  2BA1 A;  2WK2 A;  4ODQ A;  2PN0 A;  1FKH A;  3ARP A;  3GU0 A;  2D9F A;  3UQB A;  2DWV A;  2WAE A;  2RUQ A;  3ARV A;  1WNO A;  4IT4 A;  4ZS6 A;  3BXW A;  2JX8 A;  2LPV A;  3CHD A;  1K9Q A;  1IX5 A;  1RD6 A;  3KAD A;  2DT2 A;  3VAW A;  1GPF A;  1X6L A;  1U79 A;  4W9O A;  2PV2 A;  4WK9 A;  3WD4 A;  1KT1 A;  2PPO A;  3WD0 A;  2JV4 A;  1LG1 A;  4L3N A;  4DRK A;  1H0G A;  5I98 A;  3M85 A;  4MNL A;  2FDM A;  1O6I A;  1ZCN A;  3OOB A;  5GPR A;  2DPE A;  1HKK A;  1FFQ A;  3UI4 A;  1EG4 A;  2Y78 A;  3ART A;  2ZQT A;  2LAJ A;  1LJY A;  1NH6 A;  3CHC A;  4G2P A;  2KI3 A;  2DG3 A;  1ZK6 A;  4Z2L A;  1E6N A;  2IUZ A;  1TK7 A;  2LJ4 A;  2Q5A A;  4Q22 A;  1J4H A;  1W9U A;  3MCB A;  3G6M A;  3KAB A;  3UI5 A;  4O2T A;  4WIW A;  1F40 A;  3AS1 A;  4ODP A;  4GLX A;  3UQA A;  4J4O A;  1LL7 A;  1T11 A;  2FKE A;  1Q6I A;  3JXV A;  3L4H A;  2M8J A;  2DJY A;  1BKF A;  4MGV A;  2A3B A;  5DEZ A;  4DRN A;  1JMQ A;  4TX0 A;  2MF9 A;  4Z2J A;  1EIB A;  4HBO A;  2ZQU A;  3WKZ A;  1FJD A;  1JCH B;  3FAP A;  2DSV A;  1FD9 A;  2DSZ A;  5HWC A;  4Z2H A;  2OWO A;  1LL4 A;  4LAW A;  4R5E A;  4Z2K A;  4IPX A;  2M08 A;  4ZPW R;  2XP4 A;  2ZQS A;  5HW8 A;  4URI A;  4JFM A;  1EG3 A;  3O5I A;  4JFI A;  1E44 A;  5HBF A;  2OLH A;  2ZQV A;  1JNE A;  1PBK A;  4TW7 A;  3PQH A;  3TC5 A;  1HKI A;  1O6W A;  4XAK A;  1WR7 A;  1D7H A;  1D7J A;  3ARQ A;  2A3E A;  3AS3 A;  3B7X A;  1Q6H A;  2B31 A;  3GPK A;  3FSB A;  5HW7 A;  5E65 A;  2AOS A;  2DG4 A;  4FAP A;  4MPK A;  2LGO A;  3IKG A;  2P4V A;  5DIT A;  3MQG A;  1X6N A;  2KFW A;  4G50 A;  5DO2 A;  3FS8 A;  2F2D A;  3O5G A;  5HUA A;  1FKF A;  3B8S A;  3CHF A;  2XP7 A;  3EY6 A;  3WIJ A;  3LE4 A;  2XP9 A;  2ZR4 A;  4NZC A;  1K9T A;  2K8I A;  2YSH A;  1OGG A;  4QT2 A;  1L1P A;  4UDM A;  1WAW A;  3RME A;  2F4E A;  2DT3 A;  1W26 A;  5HT1 A;  1W9P A;  3JYJ A;  5BXJ A;  1ZU8 A;  2MDI A;  3ALG A;  2KO7 A;  3IHZ A;  3O5Q A;  3PRD A;  4KR0 B;  1TFV A;  4W9P A;  1EYM A;  2RUC A;  4W9Q A;  4S3J A;  5E62 A;  1JND A;  2M2A A;  2ESC A;  2OFN A;  3ARY A;  2KXQ A;  1N1A A;  3IK8 A;  2Y8N B;  1NSG A;  4DWS D;  5GQB A;  4DH0 A;  4J4N A;  2KGJ A;  1NMV A;  1HKJ A;  4HAR A;  3O5J A;  1BL4 A;  2O9O A;  3FXY A;  3CHE A;  2IF4 A;  2DG9 A;  3PR9 A;  1HJV A; 
#chains in the Genus database with same CATH homology
 3UQI A;  3AS2 A;  4ODL A;  2RUD A;  4MNJ A;  1FKD A;  4R0X A;  4ITZ A;  4ODK A;  1F8A B;  3WD1 A;  3TCZ A;  3MQH A;  2YAJ B;  1ZBC A;  1W1P A;  2XP8 A;  2WAD A;  4E5R A;  1B6C A;  1OGB A;  4DWS C;  3QOK A;  1JNS A;  4DWS B;  2RSE A;  4Q7N A;  5DIU A;  4IQC A;  4DRH A;  3IKD A;  2JMF A;  3CH9 A;  2XP5 A;  3RFW A;  1LG2 A;  4L72 B;  3CZ8 A;  4Z2I A;  3FSC A;  2A3C A;  3ODK A;  4MAV A;  3CNG A;  4A0U A;  1E6P A;  4A0T A;  2A3A A;  1W1V A;  5AHT A;  2L4J A;  4DRQ A;  1LQ0 A;  3RM8 A;  5CQ2 A;  1FKR A;  2XP6 A;  2WLZ A;  4MNK A;  1HKM A;  2L2S A;  3KCE A;  2DK1 A;  3NRK A;  4P8X A;  2YSF A;  4DRJ A;  4HBE A;  3LUO A;  3O5R A;  4GIV A;  1FLC A;  2DMV A;  4DIP A;  2WM0 A;  5U47 A;  5DF0 A;  1Q1C A;  1YW5 A;  2RE3 A;  2MLY A;  2N87 A;  2YBU A;  1Y0O A;  4BF8 A;  4JFJ A;  2FAP A;  4ZPT R;  2PV3 A;  3PRA A;  4N19 A;  3B9D A;  2MLX A;  1I5H W;  1Q6U A;  3B9E A;  3I6C A;  1J4I A;  1FKL A;  5D75 A;  3KAG A;  4DZ2 A;  3CGN A;  3KAC A;  1SR0 A;  1QPF A;  3CGM A;  2EZ5 W;  3JYM A;  3PA7 A;  1D7I A;  4DRO A;  1ZL1 A;  2AWG A;  4U86 A;  3WD2 A;  3MCB B;  5DIV A;  1H0I A;  1HJX A;  1ROU A;  3RM4 A;  3KAF A;  4P8U A;  2MNT A;  4DZ3 A;  1W1Y A;  1UR8 A;  3UF8 A;  3KAI A;  3W4R A;  2YSB A;  1ZB5 A;  4WKA A;  4ODO A;  4TYO A;  1JNT A;  2JXW A;  3ARZ A;  3ARU A;  1QPL A;  4TW8 A;  4PTM A;  2VCD A;  2PV1 A;  1QZ2 A;  1RP5 A;  4AY1 A;  2RQS A;  2O92 A;  3O5M A;  3M7N A;  2YSI A;  1EHN A;  4ODR A;  4P8V A;  4ODM A;  2KR7 A;  2E45 A;  1LL6 A;  2M3O W;  4WKF A;  2QF8 A;  4KQZ A;  1CTN A;  2LKN A;  1R9H A;  1VF8 A;  3NTP A;  4IT6 A;  5HWB A;  2WLY A;  4WKH A;  3AS0 A;  1JVW A;  4QIB A;  2VN1 A;  5HTG A;  4MTV A;  5HKG A;  2MPH A;  2DT0 A;  2PI6 A;  1SYT A;  1WB0 A;  5J6E A;  1EDQ A;  1WMV A;  1GOI A;  4U85 A;  4ML4 A;  3MDY B;  1W1T A;  2MLZ A;  3RGC A;  1NWT A;  4U84 A;  4NSB A;  2DSW A;  3KAH A;  1YAT A;  3WH0 A;  3LKX B;  1TR8 A;  1D6O A;  3NI6 A;  5HW6 A;  4QZV B;  5B8I C;  4DRM A;  1C9H A;  4Z2G A;  1NWR A;  2PPN A;  5E5W A;  2G41 A;  1EQ3 A;  1FKS A;  4LAV A;  3WD3 A;  1M5Y A;  1P5Q A;  1FKG A;  4ZPV R;  2XP3 A;  1W9V A;  2RUR A;  4LGX A;  3WQV A;  1XRV A;  2ZR5 A;  2DT1 A;  1FKJ A;  5GPG A;  3WL0 A;  2G8Z A;  4DT4 A;  1A7X A;  1FAP A;  1E6Z A;  1FKB A;  2XPB A;  3ARS A;  4GGQ A;  4C02 B;  1E15 A;  3RM9 A;  2KE0 A;  1KFW A;  4MSP A;  4IQ2 A;  1HXV A;  1ITX A;  1OWQ A;  1D2K A;  1FFR A;  3ARW A;  2M8I A;  1ZBW A;  1ROT A;  4LAY A;  5E64 A;  3OA5 A;  2DSU A;  2ZAJ A;  2M1I A;  4NNR A;  1GUV A;  2YBT A;  1NMW A;  1XHG A;  3O5D A;  3B9A A;  4LAX A;  2XPA A;  4FN2 A;  2PPP A;  1KT0 A;  1J6Y A;  1ZBV A;  3ARX A;  2DK7 A;  1K9R A;  1NWU A;  2UZ5 A;  3ALF A;  1UR9 A;  3O5K A;  4JFL A;  1ZBK A;  1PIN A;  1E9L A;  3FY1 A;  2ITK A;  4MNM A;  3AQU A;  3ARR A;  4TW6 A;  3G6L A;  4QT3 A;  5JH8 A;  1HJW A;  2JZV A;  1TCO C;  2ZR6 A;  4JFK A;  4WJX A;  4DWS A;  3LKX A;  3KZ7 A;  3O5E A;  3H9R B;  3O5O A;  4ODN A;  1J4R A;  4TNS A;  3UI6 A;  2YSG A;  4P8W A;  1NWS A;  3O5P A;  3O5L A;  3TDB A;  1E6R A;  3O5F A;  2F21 A;  4JYS A;  3WL1 A;  4S3K A;  3ARO A;  4DRI A;  1FKT A;  3PRB A;  2QRV A;  1FKK A;  3WQW A;  2PBC A;  4REX A;  4DRP A;  4W5U A;  1FKI A;  5E66 A;  2BA1 A;  2WK2 A;  4ODQ A;  1FKH A;  3ARP A;  2D9F A;  3UQB A;  2DWV A;  2WAE A;  2RUQ A;  3ARV A;  1WNO A;  4IT4 A;  4ZS6 A;  3BXW A;  2JX8 A;  2LPV A;  3CHD A;  1K9Q A;  1IX5 A;  1RD6 A;  3KAD A;  2DT2 A;  3VAW A;  1GPF A;  1X6L A;  1U79 A;  4W9O A;  2PV2 A;  4WK9 A;  3WD4 A;  1KT1 A;  2PPO A;  3WD0 A;  2JV4 A;  1LG1 A;  4L3N A;  4DRK A;  1H0G A;  5I98 A;  3M85 A;  4MNL A;  2FDM A;  1O6I A;  1ZCN A;  3OOB A;  5GPR A;  2DPE A;  1HKK A;  1FFQ A;  3UI4 A;  1EG4 A;  2Y78 A;  3ART A;  2ZQT A;  2LAJ A;  1LJY A;  1NH6 A;  3CHC A;  4G2P A;  2KI3 A;  2DG3 A;  1ZK6 A;  4Z2L A;  1E6N A;  2IUZ A;  1TK7 A;  2LJ4 A;  2Q5A A;  4Q22 A;  1J4H A;  1W9U A;  3MCB A;  3G6M A;  3KAB A;  3UI5 A;  4O2T A;  4WIW A;  1F40 A;  3AS1 A;  4ODP A;  4GLX A;  3UQA A;  4J4O A;  1LL7 A;  1T11 A;  2FKE A;  1Q6I A;  3JXV A;  3L4H A;  2M8J A;  2DJY A;  1BKF A;  4MGV A;  2A3B A;  5DEZ A;  4DRN A;  1JMQ A;  4TX0 A;  2MF9 A;  4Z2J A;  1EIB A;  4HBO A;  2ZQU A;  3WKZ A;  1FJD A;  3FAP A;  2DSV A;  1FD9 A;  2DSZ A;  5HWC A;  4Z2H A;  2OWO A;  1LL4 A;  4LAW A;  4R5E A;  4Z2K A;  4IPX A;  2M08 A;  4ZPW R;  2XP4 A;  2ZQS A;  5HW8 A;  4URI A;  4JFM A;  1EG3 A;  3O5I A;  4JFI A;  5HBF A;  2OLH A;  2ZQV A;  1JNE A;  1PBK A;  4TW7 A;  3PQH A;  3TC5 A;  1HKI A;  1O6W A;  4XAK A;  1WR7 A;  1D7H A;  1D7J A;  3ARQ A;  2A3E A;  3AS3 A;  3B7X A;  1Q6H A;  2B31 A;  3GPK A;  3FSB A;  5HW7 A;  5E65 A;  2AOS A;  2DG4 A;  4FAP A;  4MPK A;  2LGO A;  3IKG A;  5DIT A;  3MQG A;  1X6N A;  2KFW A;  4G50 A;  5DO2 A;  3FS8 A;  2F2D A;  3O5G A;  5HUA A;  1FKF A;  3B8S A;  3CHF A;  2XP7 A;  3EY6 A;  3WIJ A;  3LE4 A;  2XP9 A;  2ZR4 A;  4NZC A;  1K9T A;  2K8I A;  2YSH A;  1OGG A;  4QT2 A;  1L1P A;  1WAW A;  3RME A;  2F4E A;  2DT3 A;  1W26 A;  5HT1 A;  1W9P A;  3JYJ A;  5BXJ A;  1ZU8 A;  2MDI A;  3ALG A;  2KO7 A;  3IHZ A;  3O5Q A;  3PRD A;  4KR0 B;  1TFV A;  4W9P A;  1EYM A;  2RUC A;  4W9Q A;  4S3J A;  5E62 A;  1JND A;  2M2A A;  2ESC A;  2OFN A;  3ARY A;  2KXQ A;  1N1A A;  3IK8 A;  2Y8N B;  1NSG A;  4DWS D;  5GQB A;  4DH0 A;  4J4N A;  2KGJ A;  1NMV A;  1HKJ A;  4HAR A;  3O5J A;  1BL4 A;  2O9O A;  3FXY A;  3CHE A;  2IF4 A;  2DG9 A;  3PR9 A;  1HJV A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...