3KAIA

Structure-guided design of alpha-amino acid-derived pin1 inhibitors
Total Genus 45
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
45
sequence length
157
structure length
145
Chain Sequence
LPPGWEKAMSRSSGRVYYFNHITNASQWERPSEPARVRCSHLLVKHSQSRRPSSWRQEKITRTKEEALELINGYIQKIKSGEEDFESLASQFSDCSSAKARGDLGAFSRGQMQKPFEDASFALRTGEMSGPVFTDSGIHIILRTE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure-guided design of alpha-amino acid-derived Pin1 inhibitors
pubmed doi rcsb
source organism Homo sapiens
molecule tags Isomerase
molecule keywords Peptidyl-prolyl cis-trans isomerase NIMA-interacting 1
total genus 45
structure length 145
sequence length 157
ec nomenclature ec 5.2.1.8: Peptidylprolyl isomerase.
pdb deposition date 2009-10-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00397 WW WW domain
A PF00639 Rotamase PPIC-type PPIASE domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.20.70.10 Mainly Beta Single Sheet Ubiquitin Ligase Nedd4; Chain: W; Ubiquitin Ligase Nedd4; Chain: W; 3kaiA01
3.10.50.40 Alpha Beta Roll Chitinase A; domain 3 Chitinase A; domain 3 3kaiA02
4MSPA 3JXVA 2XPBA 2OFNA 2JMFA 3OOBA 2XP5A 2XP4A 1FKKA 2YSFA 2ZR4A 2PBCA 4BF8A 4FN2A 3M7NA 1YW5A 4C02B 5DITA 2DMVA 1JNSA 3RFWA 1FKFA 2MLXA 4DROA 3PRDA 3I6CA 5HW6A 2M8IA 1J6YA 3FAPA 1FJDA 3TC5A 2KR7A 2RUCA 2LJ4A 4R0XA 4LAVA 4TX0A 4TYOA 1D7HA 4ODOA 5HWCA 2Q5AA 2M3OW 3O5GA 1WR7A 1JMQA 2ZAJA 3PRBA 4LAXA 1N1AA 5DIVA 4DH0A 4DZ2A 4DRPA 5AHTA 2XP7A 1ROUA 1FKLA 2DK7A 2PV3A 2DJYA 2RQSA 1FKRA 2L2SA 2M08A 3JYMA 1C9HA 2BA1A 4U85A 3O5MA 2F21A 3KAFA 1P5QA 2MLZA 5GPGA 3CGNA 5HKGA 2ZQTA 3WH0A 1JVWA 1QPLA 3NTPA 1FAPA 4JFIA 4O2TA 2PV2A 3KAIA 1QPFA 2KXQA 3ODKA 1D6OA 2E45A 3UI4A 4ODQA 2K8IA 2RSEA 2DG4A 1FKGA 2PPPA 2FAPA 1ZCNA 1K9QA 2M1IA 3LUOA 1FD9A 4LAYA 4N19A 4TNSA 2KFWA 4ODMA 4DRNA 5HWBA 1FKDA 4DRQA 2PV1A 5J6EA 5HUAA 3UQAA 2AWGA 1QZ2A 2YSGA 2KO7A 1D7JA 3IK8A 3RGCA 3NI6A 2ITKA 3IKGA 3KADA 1F8AB 3O5OA 2MLYA 3O5PA 3O5QA 1PINA 3KCEA 4ITZA 4W9OA 2RE3A 4GIVA 1Q6UA 1Q1CA 1D7IA 3UQBA 1ZK6A 4DRJA 5HTGA 3O5KA 2LKNA 1FKHA 5B8IC 2LAJA 1BKFA 2MPHA 4DIPA 3TDBA 1K9RA 1JNTA 1Y0OA 1J4HA 3NRKA 4QT3A 3VAWA 5HW7A 2EZ5W 5BXJA 1L1PA 2RURA 3KAHA 1J4IA 3LE4A 2DG3A 2JZVA 2KE0A 3MDYB 2PPNA 3O5LA 4G50A 2N87A 4JFLA 4ODKA 3KAGA 4E5RA 2LGOA 3H9RB 3EY6A 4IQCA 4ODNA 4ODLA 2F2DA 1PBKA 2JV4A 2XP8A 2XP9A 3KZ7A 4QT2A 1Q6IA 4U86A 4U84A 2YSIA 3UI6A 1FKSA 1T11A 2ZQSA 3O5JA 1FKBA 1FKIA 4NNRA 5HT1A 2XP3A 3TCZA 2JXWA 1TK7A 2DK1A 3O5DA 3IHZA 1EQ3A 1FKTA 1EYMA 2FKEA 2Y78A 3UQIA 5I98A 2MF9A 4J4NA 4FAPA 1EG3A 1FKJA 2MDIA 1M5YA 2VN1A 4JYSA 1F40A 4LAWA 4TW6A 1YATA 4TW7A 4JFJA 3CNGA 4DRKA 4JFKA 3M85A 2M2AA 1HXVA 2L4JA 4W9QA 2KI3A 4REXA 1NSGA 3JYJA 3UF8A 3O5RA 2D9FA 4G2PA 4DZ3A 2LPVA 2MNTA 4ODRA 3O5FA 4ODPA 5D75A 4DT4A 3L4HA 1ROTA 1TCOC 2RUDA 2KGJA 2JX8A 2RUQA 2VCDA 2DWVA 3B7XA 3PA7A 1EG4A 2XPAA 2YSHA 5HW8A 1I5HW 4GGQA 2XP6A 3KABA 1BL4A 2YSBA 2UZ5A 1W26A 4IPXA 4QIBA 5DIUA 1A7XA 4JFMA 1NMVA 1NMWA 2ZR5A 4DRIA 4W9PA 4DRMA 1J4RA 2ZQVA 3GPKA 5CQ2A 4J4OA 4TW8A 4IQ2A 1WMVA 1B6CA 1O6WA 1R9HA 4DRHA 3CGMA 1KT1A 2PPOA 1U79A 3IKDA 2DG9A 1KT0A 2M8JA 2IF4A 3O5EA 2F4EA 2ZQUA 3KACA 4MGVA 3UI5A 3O5IA 2ZR6A 1Q6HA
chains in the Genus database with same CATH superfamily
3JXVA 1ZBWA 2XP5A 1TR8A 1FKKA 2YSFA 1WAWA 2WK2A 3BXWA 4ML4A 4QZVB 4MNLA 4C02B 1E6PA 1W1YA 2PN0A 5DITA 1JNSA 4DWSC 4IT4A 1E9LA 3I6CA 5HBFA 2RUCA 2LJ4A 5JH8A 4LAVA 2A3CA 1WR7A 1JMQA 2ZAJA 4LAXA 4DH0A 1N1AA 4DZ2A 2O92A 4DRPA 2L2SA 4HARA 1C9HA 2QF8A 2F21A 2MLZA 3B9DA 4WJXA 4O2TA 1FAPA 1LL6A 3RM8A 2B31A 4Z2KA 2K8IA 4PTMA 2PPPA 4DRNA 2DT2A 1EIBA 1FKDA 2PV1A 2AWGA 2YSGA 4MAVA 3IK8A 3RGCA 3IKGA 3O5PA 3WD3A 2RE3A 1Q6UA 3O5KA 4A0UA 1JCHB 2MPHA 5E66A 1K9RA 1Y0OA 1J4HA 3ARSA 4ZPVR 5BXJA 2RURA 3CHCA 2DG3A 2KE0A 1X6NA 3H9RB 1JNDA 3EY6A 1FFRA 4ODLA 4XAKA 1PBKA 2JV4A 2XP8A 2XP9A 4QT2A 4U86A 2YSIA 5E65A 1FKBA 1NH6A 5E62A 2OLHA 3TCZA 3IHZA 3RM9A 1FKTA 2MF9A 4FAPA 1LJYA 3QOKA 4JFJA 4S3JA 1OGGA 3CNGA 1LL4A 1HXVA 1FLCA 2KI3A 2EULA 2O9OA 1NSGA 4S3KA 3O5RA 1NWRA 4MPKA 4ODPA 4NZCA 4DT4A 2VCDA 3O5JA 1EQ3A 1EG4A 3RMEA 1W26A 5DIUA 4JFMA 2OWOA 1NMWA 4IT6A 4W9PA 2WM0A 3AS0A 4DRMA 3GPKA 1R9HA 1O6WA 4P8VA 3CGMA 1HJWA 2G8ZA 4DRHA 2DG9A 1HJXA 1XRVA 1ITXA 2ZQUA 2A3BA 3CHFA 4MGVA 3FSCA 3ALGA 5HT1A 3VAWA 4MTVA 1Q6HA 3CHDA 2JMFA 2XP4A 2ZR4A 3B8SA 1ZBCA 2DMVA 2A3AA 3PRDA 4NSBA 5HW6A 1FJDA 2KR7A 4DWSB 2YAJB 4TYOA 1D7HA 4ODOA 1H0IA 3O5GA 5U47A 1OWQA 1LL7A 3PRBA 2QRVA 1OGBA 1ROUA 2DK7A 2DJYA 3WD2A 3JYMA 2BA1A 3O5MA 5GPGA 4LGXA 5HKGA 3B9AA 3WL0A 4JFIA 2E45A 4ODQA 4HBOA 4WKAA 1ZCNA 1K9QA 3LUOA 5HWBA 4DWSD 5DEZA 3ARQA 4DRQA 4W5UA 5HUAA 1QZ2A 1ZBVA 1E6ZA 3O5OA 3WD4A 1KFWA 1NWUA 4DRJA 3WIJA 1FKHA 4L3NA 1BKFA 2ESCA 3ARTA 1H0GA 1W1TA 4G50A 4DRKA 3LE4A 1NWTA 2JZVA 3O5LA 2G41A 4MNJA 3KAGA 4E5RA 4IQCA 4KQZA 4HBEA 2B5UB 3KZ7A 1Q6IA 1W9VA 2WLZA 1W9PA 5E64A 4Z2IA 1FKIA 1GPFA 2XP3A 1E44A 3ARPA 4MNMA 5I98A 3W4RA 1M5YA 4AY1A 4A0TA 2YBTA 3ARWA 2IUZA 4WKFA 4ZPWR 4G2PA 2MNTA 3O5FA 1SYTA 2RUQA 3PA7A 5DIVA 5HW8A 1I5HW 4GGQA 2XP6A 1BL4A 2DSUA 2DT1A 4IPXA 3CZ8A 1LG2A 4DRIA 2ZR5A 3PR9A 1LQ0A 4URIA 2YBUA 2ZQVA 4J4OA 1KT1A 1NWSA 2PPOA 1U79A 3IKDA 3GU0A 4Z2GA 2PI6A 3O5IA 4MSPA 2OFNA 1LG1A 2PBCA 2DT3A 4FN2A 1E6RA 1YW5A 3WQVA 1X6LA 3MCBA 3RFWA 3AQUA 1J6YA 2M8IA 4Z2JA 3ARVA 4P8UA 4WKHA 3ARRA 1E15A 5AHTA 2XP7A 1FKRA 3CHEA 3FS8A 3RM4A 2M08A 4U85A 1CTNA 1P5QA 2ZQTA 1QPLA 2WAEA 4KR0B 1HKIA 5GPRA 2PV2A 3UI4A 2KXQA 3ODKA 2DG4A 1FKGA 2M1IA 3ALFA 1GUVA 3MCBB 4N19A 4TNSA 2KFWA 4ODMA 3WQWA 5J6EA 4Z2HA 3KADA 3AS1A 3MQGA 1PINA 4GIVA 1IX5A 1Q1CA 1D7IA 3UQBA 1ZK6A 3ARYA 3CH9A 5B8IC 1D2KA 1JNTA 4QT3A 5HW7A 2WLYA 4ODKA 2PPNA 2N87A 2P4VA 2LGOA 1HJVA 3G6LA 1UR8A 4U84A 5DF0A 3UI6A 1FKSA 3AS2A 1WNOA 1HKMA 3O5DA 2FKEA 2Y78A 4DWSA 4J4NA 2VN1A 3MQHA 4JYSA 1YATA 2FDMA 3LKXA 1W1PA 4JFKA 2M2AA 2DSZA 1JNEA 2LPVA 1TCOC 1ROTA 3B7XA 2DT0A 3OA5A 2DWVA 3B9EA 2XPAA 3GTYX 4WIWA 2UZ5A 1EDQA 1RD6A 1SR0A 3LKXB 3FY1A 5GQBA 5CQ2A 4TW8A 1W1VA 1KT0A 2IF4A 3EIPA 3O5EA 2F4EA 3WD0A 1ZL1A 3BMBA 4Q22A 1HKJA 2XPBA 4BF8A 3OOBA 4L72B 3WD1A 3M7NA 4P8WA 1UR9A 5E5WA 1FKFA 2MLXA 4DROA 3AROA 2AOSA 2Y8NB 3FAPA 3TC5A 1E6NA 4R0XA 4TX0A 1O6IA 5HWCA 2Q5AA 2M3OW 2DSVA 4GLXA 3AS3A 2F23A 1FKLA 2PV3A 2RQSA 4P8XA 3WL1A 5DO2A 3KAFA 3CGNA 3WH0A 1JVWA 1K9TA 3NTPA 3KAIA 1QPFA 1D6OA 2RSEA 3G6MA 2FAPA 4LAYA 4WK9A 1FD9A 2ETNA 3UQAA 1RP5A 2DSWA 2KO7A 1D7JA 4Q7NA 3NI6A 2ITKA 1F8AB 2MLYA 3O5QA 3KCEA 4ITZA 4W9OA 1GRJA 2LKNA 2LAJA 3WKZA 4DIPA 3TDBA 1W9UA 1ZB5A 3NRKA 2EZ5W 1L1PA 3KAHA 1J4IA 3MDYB 4JFLA 2A3EA 4ODNA 4R5EA 4ZS6A 2F2DA 1T11A 2ZQSA 3PRAA 1VF8A 1FFQA 4NNRA 1XHGA 2JXWA 1TK7A 2DK1A 3ARZA 3ARXA 1WB0A 1EYMA 3UQIA 2DPEA 1EG3A 1FKJA 2MDIA 4ZPTR 4LAWA 4TW6A 4TW7A 3M85A 2L4JA 2WADA 4W9QA 4REXA 3JYJA 1HKKA 3UF8A 2D9FA 4Z2LA 4DZ3A 4ODRA 5D75A 1F40A 3L4HA 5HTGA 2RUDA 2KGJA 2JX8A 1ZBKA 2YSHA 3KABA 2YSBA 1GOIA 1EHNA 4MNKA 4QIBA 3FSBA 1A7XA 1NMVA 1TFVA 1J4RA 4IQ2A 1ZU8A 1WMVA 1B6CA 3FXYA 3ARUA 3PQHA 2M8JA 3KACA 3UI5A 2ZR6A 4UDMA
chains in the Genus database with same CATH topology
3JXVA 1ZBWA 2XP5A 1TR8A 1FKKA 2YSFA 1WAWA 2WK2A 3BXWA 4ML4A 4QZVB 4MNLA 4C02B 1E6PA 1W1YA 5DITA 1JNSA 4DWSC 4IT4A 1E9LA 3I6CA 5HBFA 2RUCA 2LJ4A 5JH8A 4LAVA 2A3CA 1WR7A 1JMQA 2ZAJA 4LAXA 4DH0A 1N1AA 4DZ2A 2O92A 4DRPA 2L2SA 4HARA 1C9HA 2QF8A 2F21A 2MLZA 3B9DA 4WJXA 4O2TA 1FAPA 1LL6A 3RM8A 2B31A 4Z2KA 2K8IA 4PTMA 2PPPA 4DRNA 2DT2A 1EIBA 1FKDA 2PV1A 2AWGA 2YSGA 4MAVA 3IK8A 3RGCA 3IKGA 3O5PA 3WD3A 2RE3A 1Q6UA 3O5KA 4A0UA 2MPHA 5E66A 1K9RA 1Y0OA 1J4HA 3ARSA 4ZPVR 5BXJA 2RURA 3CHCA 2DG3A 2KE0A 1X6NA 3H9RB 1JNDA 3EY6A 1FFRA 4ODLA 4XAKA 1PBKA 2JV4A 2XP8A 2XP9A 4QT2A 4U86A 2YSIA 5E65A 1FKBA 1NH6A 5E62A 2OLHA 3TCZA 3IHZA 3RM9A 1FKTA 2MF9A 4FAPA 1LJYA 3QOKA 4JFJA 4S3JA 1OGGA 3CNGA 1LL4A 1HXVA 1FLCA 2KI3A 2O9OA 4S3KA 1NSGA 3O5RA 1NWRA 4MPKA 4ODPA 4NZCA 4DT4A 2VCDA 3O5JA 1EQ3A 1EG4A 3RMEA 1W26A 5DIUA 4JFMA 2OWOA 1NMWA 4IT6A 4W9PA 2WM0A 3AS0A 4DRMA 3GPKA 1R9HA 1O6WA 4P8VA 3CGMA 1HJWA 2G8ZA 4DRHA 2DG9A 1HJXA 1XRVA 1ITXA 2ZQUA 2A3BA 3CHFA 4MGVA 3FSCA 3ALGA 5HT1A 3VAWA 4MTVA 1Q6HA 3CHDA 2JMFA 2XP4A 2ZR4A 3B8SA 1ZBCA 2DMVA 2A3AA 3PRDA 4NSBA 5HW6A 1FJDA 2KR7A 4DWSB 2YAJB 4TYOA 1D7HA 4ODOA 1H0IA 3O5GA 5U47A 1OWQA 1LL7A 3PRBA 2QRVA 1OGBA 1ROUA 2DK7A 2DJYA 3WD2A 3JYMA 2BA1A 3O5MA 5GPGA 4LGXA 5HKGA 3B9AA 3WL0A 4JFIA 2E45A 4ODQA 4HBOA 4WKAA 1ZCNA 1K9QA 3LUOA 5HWBA 4DWSD 5DEZA 3ARQA 4DRQA 4W5UA 5HUAA 1QZ2A 1ZBVA 1E6ZA 3O5OA 3WD4A 1KFWA 1NWUA 4DRJA 3WIJA 1FKHA 4L3NA 1BKFA 2ESCA 3ARTA 1H0GA 1W1TA 4G50A 4DRKA 3LE4A 1NWTA 2JZVA 3O5LA 2G41A 4MNJA 3KAGA 4E5RA 4IQCA 4KQZA 4HBEA 3KZ7A 1Q6IA 1W9VA 2WLZA 1W9PA 5E64A 4Z2IA 1FKIA 1GPFA 2XP3A 3ARPA 4MNMA 5I98A 3W4RA 1M5YA 4AY1A 4A0TA 2YBTA 3ARWA 2IUZA 4WKFA 4ZPWR 4G2PA 2MNTA 3O5FA 1SYTA 2RUQA 3PA7A 5DIVA 5HW8A 1I5HW 4GGQA 2XP6A 1BL4A 2DSUA 2DT1A 4IPXA 3CZ8A 1LG2A 4DRIA 2ZR5A 3PR9A 1LQ0A 4URIA 2YBUA 2ZQVA 4J4OA 1KT1A 1NWSA 2PPOA 1U79A 3IKDA 4Z2GA 2PI6A 3O5IA 4MSPA 2OFNA 1LG1A 2PBCA 2DT3A 4FN2A 1E6RA 1YW5A 3WQVA 1X6LA 3MCBA 3RFWA 3AQUA 1J6YA 2M8IA 4Z2JA 3ARVA 4P8UA 4WKHA 3ARRA 1E15A 5AHTA 2XP7A 1FKRA 3CHEA 3FS8A 3RM4A 2M08A 4U85A 1CTNA 1P5QA 2ZQTA 1QPLA 2WAEA 4KR0B 1HKIA 5GPRA 2PV2A 3UI4A 2KXQA 3ODKA 2DG4A 1FKGA 2M1IA 3ALFA 1GUVA 3MCBB 4N19A 4TNSA 2KFWA 4ODMA 3WQWA 5J6EA 4Z2HA 3KADA 3AS1A 3MQGA 1PINA 4GIVA 1IX5A 1Q1CA 1D7IA 3UQBA 1ZK6A 3ARYA 3CH9A 5B8IC 1D2KA 1JNTA 4QT3A 5HW7A 2WLYA 4ODKA 2PPNA 2N87A 2LGOA 1HJVA 3G6LA 1UR8A 4U84A 5DF0A 3UI6A 1FKSA 3AS2A 1WNOA 1HKMA 3O5DA 2FKEA 2Y78A 4DWSA 4J4NA 2VN1A 3MQHA 4JYSA 1YATA 2FDMA 3LKXA 1W1PA 4JFKA 2M2AA 2DSZA 1JNEA 2LPVA 1TCOC 1ROTA 3B7XA 2DT0A 3OA5A 2DWVA 3B9EA 2XPAA 4WIWA 2UZ5A 1EDQA 1RD6A 1SR0A 3LKXB 3FY1A 5GQBA 5CQ2A 4TW8A 1W1VA 1KT0A 2IF4A 3O5EA 2F4EA 3WD0A 1ZL1A 4Q22A 1HKJA 2XPBA 4BF8A 3OOBA 4L72B 3WD1A 3M7NA 4P8WA 1UR9A 5E5WA 1FKFA 2MLXA 4DROA 3AROA 2AOSA 2Y8NB 3FAPA 3TC5A 1E6NA 4R0XA 4TX0A 1O6IA 5HWCA 2Q5AA 2M3OW 2DSVA 4GLXA 3AS3A 1FKLA 2PV3A 2RQSA 4P8XA 3WL1A 5DO2A 3KAFA 3CGNA 3WH0A 1JVWA 1K9TA 3NTPA 3KAIA 1QPFA 1D6OA 2RSEA 3G6MA 2FAPA 4LAYA 4WK9A 1FD9A 3UQAA 1RP5A 2DSWA 2KO7A 1D7JA 4Q7NA 3NI6A 2ITKA 1F8AB 2MLYA 3O5QA 3KCEA 4ITZA 4W9OA 2LKNA 2LAJA 3WKZA 4DIPA 3TDBA 1W9UA 1ZB5A 3NRKA 2EZ5W 1L1PA 3KAHA 1J4IA 3MDYB 4JFLA 2A3EA 4ODNA 4R5EA 4ZS6A 2F2DA 1T11A 2ZQSA 3PRAA 1VF8A 1FFQA 4NNRA 1XHGA 2JXWA 1TK7A 2DK1A 3ARZA 3ARXA 1WB0A 1EYMA 3UQIA 2DPEA 1EG3A 1FKJA 2MDIA 4ZPTR 4LAWA 4TW6A 4TW7A 3M85A 2L4JA 2WADA 4W9QA 4REXA 3JYJA 1HKKA 3UF8A 2D9FA 4Z2LA 4DZ3A 4ODRA 5D75A 1F40A 3L4HA 5HTGA 2RUDA 2KGJA 2JX8A 1ZBKA 2YSHA 3KABA 2YSBA 1GOIA 1EHNA 4MNKA 4QIBA 3FSBA 1A7XA 1NMVA 1TFVA 1J4RA 4IQ2A 1ZU8A 1WMVA 1B6CA 3FXYA 3ARUA 3PQHA 2M8JA 3KACA 3UI5A 2ZR6A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4MSP A;  3JXV A;  2XPB A;  2OFN A;  2JMF A;  3OOB A;  2XP5 A;  2XP4 A;  1FKK A;  2YSF A;  2ZR4 A;  2PBC A;  4BF8 A;  4FN2 A;  3M7N A;  1YW5 A;  4C02 B;  5DIT A;  2DMV A;  1JNS A;  3RFW A;  1FKF A;  2MLX A;  4DRO A;  3PRD A;  3I6C A;  5HW6 A;  2M8I A;  1J6Y A;  3FAP A;  1FJD A;  3TC5 A;  2KR7 A;  2RUC A;  2LJ4 A;  4R0X A;  4LAV A;  4TX0 A;  4TYO A;  1D7H A;  4ODO A;  5HWC A;  2Q5A A;  2M3O W;  3O5G A;  1WR7 A;  1JMQ A;  2ZAJ A;  3PRB A;  4LAX A;  1N1A A;  5DIV A;  4DH0 A;  4DZ2 A;  4DRP A;  5AHT A;  2XP7 A;  1ROU A;  1FKL A;  2DK7 A;  2PV3 A;  2DJY A;  2RQS A;  1FKR A;  2L2S A;  2M08 A;  3JYM A;  1C9H A;  2BA1 A;  4U85 A;  3O5M A;  2F21 A;  3KAF A;  1P5Q A;  2MLZ A;  5GPG A;  3CGN A;  5HKG A;  2ZQT A;  3WH0 A;  1JVW A;  1QPL A;  3NTP A;  1FAP A;  4JFI A;  4O2T A;  2PV2 A;  3KAI A;  1QPF A;  2KXQ A;  3ODK A;  1D6O A;  2E45 A;  3UI4 A;  4ODQ A;  2K8I A;  2RSE A;  2DG4 A;  1FKG A;  2PPP A;  2FAP A;  1ZCN A;  1K9Q A;  2M1I A;  3LUO A;  1FD9 A;  4LAY A;  4N19 A;  4TNS A;  2KFW A;  4ODM A;  4DRN A;  5HWB A;  1FKD A;  4DRQ A;  2PV1 A;  5J6E A;  5HUA A;  3UQA A;  2AWG A;  1QZ2 A;  2YSG A;  2KO7 A;  1D7J A;  3IK8 A;  3RGC A;  3NI6 A;  2ITK A;  3IKG A;  3KAD A;  1F8A B;  3O5O A;  2MLY A;  3O5P A;  3O5Q A;  1PIN A;  3KCE A;  4ITZ A;  4W9O A;  2RE3 A;  4GIV A;  1Q6U A;  1Q1C A;  1D7I A;  3UQB A;  1ZK6 A;  4DRJ A;  5HTG A;  3O5K A;  2LKN A;  1FKH A;  5B8I C;  2LAJ A;  1BKF A;  2MPH A;  4DIP A;  3TDB A;  1K9R A;  1JNT A;  1Y0O A;  1J4H A;  3NRK A;  4QT3 A;  3VAW A;  5HW7 A;  2EZ5 W;  5BXJ A;  1L1P A;  2RUR A;  3KAH A;  1J4I A;  3LE4 A;  2DG3 A;  2JZV A;  2KE0 A;  3MDY B;  2PPN A;  3O5L A;  4G50 A;  2N87 A;  4JFL A;  4ODK A;  3KAG A;  4E5R A;  2LGO A;  3H9R B;  3EY6 A;  4IQC A;  4ODN A;  4ODL A;  2F2D A;  1PBK A;  2JV4 A;  2XP8 A;  2XP9 A;  3KZ7 A;  4QT2 A;  1Q6I A;  4U86 A;  4U84 A;  2YSI A;  3UI6 A;  1FKS A;  1T11 A;  2ZQS A;  3O5J A;  1FKB A;  1FKI A;  4NNR A;  5HT1 A;  2XP3 A;  3TCZ A;  2JXW A;  1TK7 A;  2DK1 A;  3O5D A;  3IHZ A;  1EQ3 A;  1FKT A;  1EYM A;  2FKE A;  2Y78 A;  3UQI A;  5I98 A;  2MF9 A;  4J4N A;  4FAP A;  1EG3 A;  1FKJ A;  2MDI A;  1M5Y A;  2VN1 A;  4JYS A;  1F40 A;  4LAW A;  4TW6 A;  1YAT A;  4TW7 A;  4JFJ A;  3CNG A;  4DRK A;  4JFK A;  3M85 A;  2M2A A;  1HXV A;  2L4J A;  4W9Q A;  2KI3 A;  4REX A;  1NSG A;  3JYJ A;  3UF8 A;  3O5R A;  2D9F A;  4G2P A;  4DZ3 A;  2LPV A;  2MNT A;  4ODR A;  3O5F A;  4ODP A;  5D75 A;  4DT4 A;  3L4H A;  1ROT A;  1TCO C;  2RUD A;  2KGJ A;  2JX8 A;  2RUQ A;  2VCD A;  2DWV A;  3B7X A;  3PA7 A;  1EG4 A;  2XPA A;  2YSH A;  5HW8 A;  1I5H W;  4GGQ A;  2XP6 A;  3KAB A;  1BL4 A;  2YSB A;  2UZ5 A;  1W26 A;  4IPX A;  4QIB A;  5DIU A;  1A7X A;  4JFM A;  1NMV A;  1NMW A;  2ZR5 A;  4DRI A;  4W9P A;  4DRM A;  1J4R A;  2ZQV A;  3GPK A;  5CQ2 A;  4J4O A;  4TW8 A;  4IQ2 A;  1WMV A;  1B6C A;  1O6W A;  1R9H A;  4DRH A;  3CGM A;  1KT1 A;  2PPO A;  1U79 A;  3IKD A;  2DG9 A;  1KT0 A;  2M8J A;  2IF4 A;  3O5E A;  2F4E A;  2ZQU A;  3KAC A;  4MGV A;  3UI5 A;  3O5I A;  2ZR6 A;  1Q6H A; 
#chains in the Genus database with same CATH topology
 3JXV A;  1ZBW A;  2XP5 A;  1TR8 A;  1FKK A;  2YSF A;  1WAW A;  2WK2 A;  3BXW A;  4ML4 A;  4QZV B;  4MNL A;  4C02 B;  1E6P A;  1W1Y A;  2PN0 A;  5DIT A;  1JNS A;  4DWS C;  4IT4 A;  1E9L A;  3I6C A;  5HBF A;  2RUC A;  2LJ4 A;  5JH8 A;  4LAV A;  2A3C A;  1WR7 A;  1JMQ A;  2ZAJ A;  4LAX A;  4DH0 A;  1N1A A;  4DZ2 A;  2O92 A;  4DRP A;  2L2S A;  4HAR A;  1C9H A;  2QF8 A;  2F21 A;  2MLZ A;  3B9D A;  4WJX A;  4O2T A;  1FAP A;  1LL6 A;  3RM8 A;  2B31 A;  4Z2K A;  2K8I A;  4PTM A;  2PPP A;  4DRN A;  2DT2 A;  1EIB A;  1FKD A;  2PV1 A;  2AWG A;  2YSG A;  4MAV A;  3IK8 A;  3RGC A;  3IKG A;  3O5P A;  3WD3 A;  2RE3 A;  1Q6U A;  3O5K A;  4A0U A;  1JCH B;  2MPH A;  5E66 A;  1K9R A;  1Y0O A;  1J4H A;  3ARS A;  4ZPV R;  5BXJ A;  2RUR A;  3CHC A;  2DG3 A;  2KE0 A;  1X6N A;  3H9R B;  1JND A;  3EY6 A;  1FFR A;  4ODL A;  4XAK A;  1PBK A;  2JV4 A;  2XP8 A;  2XP9 A;  4QT2 A;  4U86 A;  2YSI A;  5E65 A;  1FKB A;  1NH6 A;  5E62 A;  2OLH A;  3TCZ A;  3IHZ A;  3RM9 A;  1FKT A;  2MF9 A;  4FAP A;  1LJY A;  3QOK A;  4JFJ A;  4S3J A;  1OGG A;  3CNG A;  1LL4 A;  1HXV A;  1FLC A;  2KI3 A;  2EUL A;  2O9O A;  1NSG A;  4S3K A;  3O5R A;  1NWR A;  4MPK A;  4ODP A;  4NZC A;  4DT4 A;  2VCD A;  3O5J A;  1EQ3 A;  1EG4 A;  3RME A;  1W26 A;  5DIU A;  4JFM A;  2OWO A;  1NMW A;  4IT6 A;  4W9P A;  2WM0 A;  3AS0 A;  4DRM A;  3GPK A;  1R9H A;  1O6W A;  4P8V A;  3CGM A;  1HJW A;  2G8Z A;  4DRH A;  2DG9 A;  1HJX A;  1XRV A;  1ITX A;  2ZQU A;  2A3B A;  3CHF A;  4MGV A;  3FSC A;  3ALG A;  5HT1 A;  3VAW A;  4MTV A;  1Q6H A;  3CHD A;  2JMF A;  2XP4 A;  2ZR4 A;  3B8S A;  1ZBC A;  2DMV A;  2A3A A;  3PRD A;  4NSB A;  5HW6 A;  1FJD A;  2KR7 A;  4DWS B;  2YAJ B;  4TYO A;  1D7H A;  4ODO A;  1H0I A;  3O5G A;  5U47 A;  1OWQ A;  1LL7 A;  3PRB A;  2QRV A;  1OGB A;  1ROU A;  2DK7 A;  2DJY A;  3WD2 A;  3JYM A;  2BA1 A;  3O5M A;  5GPG A;  4LGX A;  5HKG A;  3B9A A;  3WL0 A;  4JFI A;  2E45 A;  4ODQ A;  4HBO A;  4WKA A;  1ZCN A;  1K9Q A;  3LUO A;  5HWB A;  4DWS D;  5DEZ A;  3ARQ A;  4DRQ A;  4W5U A;  5HUA A;  1QZ2 A;  1ZBV A;  1E6Z A;  3O5O A;  3WD4 A;  1KFW A;  1NWU A;  4DRJ A;  3WIJ A;  1FKH A;  4L3N A;  1BKF A;  2ESC A;  3ART A;  1H0G A;  1W1T A;  4G50 A;  4DRK A;  3LE4 A;  1NWT A;  2JZV A;  3O5L A;  2G41 A;  4MNJ A;  3KAG A;  4E5R A;  4IQC A;  4KQZ A;  4HBE A;  2B5U B;  3KZ7 A;  1Q6I A;  1W9V A;  2WLZ A;  1W9P A;  5E64 A;  4Z2I A;  1FKI A;  1GPF A;  2XP3 A;  1E44 A;  3ARP A;  4MNM A;  5I98 A;  3W4R A;  1M5Y A;  4AY1 A;  4A0T A;  2YBT A;  3ARW A;  2IUZ A;  4WKF A;  4ZPW R;  4G2P A;  2MNT A;  3O5F A;  1SYT A;  2RUQ A;  3PA7 A;  5DIV A;  5HW8 A;  1I5H W;  4GGQ A;  2XP6 A;  1BL4 A;  2DSU A;  2DT1 A;  4IPX A;  3CZ8 A;  1LG2 A;  4DRI A;  2ZR5 A;  3PR9 A;  1LQ0 A;  4URI A;  2YBU A;  2ZQV A;  4J4O A;  1KT1 A;  1NWS A;  2PPO A;  1U79 A;  3IKD A;  3GU0 A;  4Z2G A;  2PI6 A;  3O5I A;  4MSP A;  2OFN A;  1LG1 A;  2PBC A;  2DT3 A;  4FN2 A;  1E6R A;  1YW5 A;  3WQV A;  1X6L A;  3MCB A;  3RFW A;  3AQU A;  1J6Y A;  2M8I A;  4Z2J A;  3ARV A;  4P8U A;  4WKH A;  3ARR A;  1E15 A;  5AHT A;  2XP7 A;  1FKR A;  3CHE A;  3FS8 A;  3RM4 A;  2M08 A;  4U85 A;  1CTN A;  1P5Q A;  2ZQT A;  1QPL A;  2WAE A;  4KR0 B;  1HKI A;  5GPR A;  2PV2 A;  3UI4 A;  2KXQ A;  3ODK A;  2DG4 A;  1FKG A;  2M1I A;  3ALF A;  1GUV A;  3MCB B;  4N19 A;  4TNS A;  2KFW A;  4ODM A;  3WQW A;  5J6E A;  4Z2H A;  3KAD A;  3AS1 A;  3MQG A;  1PIN A;  4GIV A;  1IX5 A;  1Q1C A;  1D7I A;  3UQB A;  1ZK6 A;  3ARY A;  3CH9 A;  5B8I C;  1D2K A;  1JNT A;  4QT3 A;  5HW7 A;  2WLY A;  4ODK A;  2PPN A;  2N87 A;  2P4V A;  2LGO A;  1HJV A;  3G6L A;  1UR8 A;  4U84 A;  5DF0 A;  3UI6 A;  1FKS A;  3AS2 A;  1WNO A;  1HKM A;  3O5D A;  2FKE A;  2Y78 A;  4DWS A;  4J4N A;  2VN1 A;  3MQH A;  4JYS A;  1YAT A;  2FDM A;  3LKX A;  1W1P A;  4JFK A;  2M2A A;  2DSZ A;  1JNE A;  2LPV A;  1TCO C;  1ROT A;  3B7X A;  2DT0 A;  3OA5 A;  2DWV A;  3B9E A;  2XPA A;  3GTY X;  4WIW A;  2UZ5 A;  1EDQ A;  1RD6 A;  1SR0 A;  3LKX B;  3FY1 A;  5GQB A;  5CQ2 A;  4TW8 A;  1W1V A;  1KT0 A;  2IF4 A;  3EIP A;  3O5E A;  2F4E A;  3WD0 A;  1ZL1 A;  3BMB A;  4Q22 A;  1HKJ A;  2XPB A;  4BF8 A;  3OOB A;  4L72 B;  3WD1 A;  3M7N A;  4P8W A;  1UR9 A;  5E5W A;  1FKF A;  2MLX A;  4DRO A;  3ARO A;  2AOS A;  2Y8N B;  3FAP A;  3TC5 A;  1E6N A;  4R0X A;  4TX0 A;  1O6I A;  5HWC A;  2Q5A A;  2M3O W;  2DSV A;  4GLX A;  3AS3 A;  2F23 A;  1FKL A;  2PV3 A;  2RQS A;  4P8X A;  3WL1 A;  5DO2 A;  3KAF A;  3CGN A;  3WH0 A;  1JVW A;  1K9T A;  3NTP A;  3KAI A;  1QPF A;  1D6O A;  2RSE A;  3G6M A;  2FAP A;  4LAY A;  4WK9 A;  1FD9 A;  2ETN A;  3UQA A;  1RP5 A;  2DSW A;  2KO7 A;  1D7J A;  4Q7N A;  3NI6 A;  2ITK A;  1F8A B;  2MLY A;  3O5Q A;  3KCE A;  4ITZ A;  4W9O A;  1GRJ A;  2LKN A;  2LAJ A;  3WKZ A;  4DIP A;  3TDB A;  1W9U A;  1ZB5 A;  3NRK A;  2EZ5 W;  1L1P A;  3KAH A;  1J4I A;  3MDY B;  4JFL A;  2A3E A;  4ODN A;  4R5E A;  4ZS6 A;  2F2D A;  1T11 A;  2ZQS A;  3PRA A;  1VF8 A;  1FFQ A;  4NNR A;  1XHG A;  2JXW A;  1TK7 A;  2DK1 A;  3ARZ A;  3ARX A;  1WB0 A;  1EYM A;  3UQI A;  2DPE A;  1EG3 A;  1FKJ A;  2MDI A;  4ZPT R;  4LAW A;  4TW6 A;  4TW7 A;  3M85 A;  2L4J A;  2WAD A;  4W9Q A;  4REX A;  3JYJ A;  1HKK A;  3UF8 A;  2D9F A;  4Z2L A;  4DZ3 A;  4ODR A;  5D75 A;  1F40 A;  3L4H A;  5HTG A;  2RUD A;  2KGJ A;  2JX8 A;  1ZBK A;  2YSH A;  3KAB A;  2YSB A;  1GOI A;  1EHN A;  4MNK A;  4QIB A;  3FSB A;  1A7X A;  1NMV A;  1TFV A;  1J4R A;  4IQ2 A;  1ZU8 A;  1WMV A;  1B6C A;  3FXY A;  3ARU A;  3PQH A;  2M8J A;  3KAC A;  3UI5 A;  2ZR6 A;  4UDM A; 
#chains in the Genus database with same CATH homology
 3JXV A;  1ZBW A;  2XP5 A;  1TR8 A;  1FKK A;  2YSF A;  1WAW A;  2WK2 A;  3BXW A;  4ML4 A;  4QZV B;  4MNL A;  4C02 B;  1E6P A;  1W1Y A;  5DIT A;  1JNS A;  4DWS C;  4IT4 A;  1E9L A;  3I6C A;  5HBF A;  2RUC A;  2LJ4 A;  5JH8 A;  4LAV A;  2A3C A;  1WR7 A;  1JMQ A;  2ZAJ A;  4LAX A;  4DH0 A;  1N1A A;  4DZ2 A;  2O92 A;  4DRP A;  2L2S A;  4HAR A;  1C9H A;  2QF8 A;  2F21 A;  2MLZ A;  3B9D A;  4WJX A;  4O2T A;  1FAP A;  1LL6 A;  3RM8 A;  2B31 A;  4Z2K A;  2K8I A;  4PTM A;  2PPP A;  4DRN A;  2DT2 A;  1EIB A;  1FKD A;  2PV1 A;  2AWG A;  2YSG A;  4MAV A;  3IK8 A;  3RGC A;  3IKG A;  3O5P A;  3WD3 A;  2RE3 A;  1Q6U A;  3O5K A;  4A0U A;  2MPH A;  5E66 A;  1K9R A;  1Y0O A;  1J4H A;  3ARS A;  4ZPV R;  5BXJ A;  2RUR A;  3CHC A;  2DG3 A;  2KE0 A;  1X6N A;  3H9R B;  1JND A;  3EY6 A;  1FFR A;  4ODL A;  4XAK A;  1PBK A;  2JV4 A;  2XP8 A;  2XP9 A;  4QT2 A;  4U86 A;  2YSI A;  5E65 A;  1FKB A;  1NH6 A;  5E62 A;  2OLH A;  3TCZ A;  3IHZ A;  3RM9 A;  1FKT A;  2MF9 A;  4FAP A;  1LJY A;  3QOK A;  4JFJ A;  4S3J A;  1OGG A;  3CNG A;  1LL4 A;  1HXV A;  1FLC A;  2KI3 A;  2O9O A;  4S3K A;  1NSG A;  3O5R A;  1NWR A;  4MPK A;  4ODP A;  4NZC A;  4DT4 A;  2VCD A;  3O5J A;  1EQ3 A;  1EG4 A;  3RME A;  1W26 A;  5DIU A;  4JFM A;  2OWO A;  1NMW A;  4IT6 A;  4W9P A;  2WM0 A;  3AS0 A;  4DRM A;  3GPK A;  1R9H A;  1O6W A;  4P8V A;  3CGM A;  1HJW A;  2G8Z A;  4DRH A;  2DG9 A;  1HJX A;  1XRV A;  1ITX A;  2ZQU A;  2A3B A;  3CHF A;  4MGV A;  3FSC A;  3ALG A;  5HT1 A;  3VAW A;  4MTV A;  1Q6H A;  3CHD A;  2JMF A;  2XP4 A;  2ZR4 A;  3B8S A;  1ZBC A;  2DMV A;  2A3A A;  3PRD A;  4NSB A;  5HW6 A;  1FJD A;  2KR7 A;  4DWS B;  2YAJ B;  4TYO A;  1D7H A;  4ODO A;  1H0I A;  3O5G A;  5U47 A;  1OWQ A;  1LL7 A;  3PRB A;  2QRV A;  1OGB A;  1ROU A;  2DK7 A;  2DJY A;  3WD2 A;  3JYM A;  2BA1 A;  3O5M A;  5GPG A;  4LGX A;  5HKG A;  3B9A A;  3WL0 A;  4JFI A;  2E45 A;  4ODQ A;  4HBO A;  4WKA A;  1ZCN A;  1K9Q A;  3LUO A;  5HWB A;  4DWS D;  5DEZ A;  3ARQ A;  4DRQ A;  4W5U A;  5HUA A;  1QZ2 A;  1ZBV A;  1E6Z A;  3O5O A;  3WD4 A;  1KFW A;  1NWU A;  4DRJ A;  3WIJ A;  1FKH A;  4L3N A;  1BKF A;  2ESC A;  3ART A;  1H0G A;  1W1T A;  4G50 A;  4DRK A;  3LE4 A;  1NWT A;  2JZV A;  3O5L A;  2G41 A;  4MNJ A;  3KAG A;  4E5R A;  4IQC A;  4KQZ A;  4HBE A;  3KZ7 A;  1Q6I A;  1W9V A;  2WLZ A;  1W9P A;  5E64 A;  4Z2I A;  1FKI A;  1GPF A;  2XP3 A;  3ARP A;  4MNM A;  5I98 A;  3W4R A;  1M5Y A;  4AY1 A;  4A0T A;  2YBT A;  3ARW A;  2IUZ A;  4WKF A;  4ZPW R;  4G2P A;  2MNT A;  3O5F A;  1SYT A;  2RUQ A;  3PA7 A;  5DIV A;  5HW8 A;  1I5H W;  4GGQ A;  2XP6 A;  1BL4 A;  2DSU A;  2DT1 A;  4IPX A;  3CZ8 A;  1LG2 A;  4DRI A;  2ZR5 A;  3PR9 A;  1LQ0 A;  4URI A;  2YBU A;  2ZQV A;  4J4O A;  1KT1 A;  1NWS A;  2PPO A;  1U79 A;  3IKD A;  4Z2G A;  2PI6 A;  3O5I A;  4MSP A;  2OFN A;  1LG1 A;  2PBC A;  2DT3 A;  4FN2 A;  1E6R A;  1YW5 A;  3WQV A;  1X6L A;  3MCB A;  3RFW A;  3AQU A;  1J6Y A;  2M8I A;  4Z2J A;  3ARV A;  4P8U A;  4WKH A;  3ARR A;  1E15 A;  5AHT A;  2XP7 A;  1FKR A;  3CHE A;  3FS8 A;  3RM4 A;  2M08 A;  4U85 A;  1CTN A;  1P5Q A;  2ZQT A;  1QPL A;  2WAE A;  4KR0 B;  1HKI A;  5GPR A;  2PV2 A;  3UI4 A;  2KXQ A;  3ODK A;  2DG4 A;  1FKG A;  2M1I A;  3ALF A;  1GUV A;  3MCB B;  4N19 A;  4TNS A;  2KFW A;  4ODM A;  3WQW A;  5J6E A;  4Z2H A;  3KAD A;  3AS1 A;  3MQG A;  1PIN A;  4GIV A;  1IX5 A;  1Q1C A;  1D7I A;  3UQB A;  1ZK6 A;  3ARY A;  3CH9 A;  5B8I C;  1D2K A;  1JNT A;  4QT3 A;  5HW7 A;  2WLY A;  4ODK A;  2PPN A;  2N87 A;  2LGO A;  1HJV A;  3G6L A;  1UR8 A;  4U84 A;  5DF0 A;  3UI6 A;  1FKS A;  3AS2 A;  1WNO A;  1HKM A;  3O5D A;  2FKE A;  2Y78 A;  4DWS A;  4J4N A;  2VN1 A;  3MQH A;  4JYS A;  1YAT A;  2FDM A;  3LKX A;  1W1P A;  4JFK A;  2M2A A;  2DSZ A;  1JNE A;  2LPV A;  1TCO C;  1ROT A;  3B7X A;  2DT0 A;  3OA5 A;  2DWV A;  3B9E A;  2XPA A;  4WIW A;  2UZ5 A;  1EDQ A;  1RD6 A;  1SR0 A;  3LKX B;  3FY1 A;  5GQB A;  5CQ2 A;  4TW8 A;  1W1V A;  1KT0 A;  2IF4 A;  3O5E A;  2F4E A;  3WD0 A;  1ZL1 A;  4Q22 A;  1HKJ A;  2XPB A;  4BF8 A;  3OOB A;  4L72 B;  3WD1 A;  3M7N A;  4P8W A;  1UR9 A;  5E5W A;  1FKF A;  2MLX A;  4DRO A;  3ARO A;  2AOS A;  2Y8N B;  3FAP A;  3TC5 A;  1E6N A;  4R0X A;  4TX0 A;  1O6I A;  5HWC A;  2Q5A A;  2M3O W;  2DSV A;  4GLX A;  3AS3 A;  1FKL A;  2PV3 A;  2RQS A;  4P8X A;  3WL1 A;  5DO2 A;  3KAF A;  3CGN A;  3WH0 A;  1JVW A;  1K9T A;  3NTP A;  3KAI A;  1QPF A;  1D6O A;  2RSE A;  3G6M A;  2FAP A;  4LAY A;  4WK9 A;  1FD9 A;  3UQA A;  1RP5 A;  2DSW A;  2KO7 A;  1D7J A;  4Q7N A;  3NI6 A;  2ITK A;  1F8A B;  2MLY A;  3O5Q A;  3KCE A;  4ITZ A;  4W9O A;  2LKN A;  2LAJ A;  3WKZ A;  4DIP A;  3TDB A;  1W9U A;  1ZB5 A;  3NRK A;  2EZ5 W;  1L1P A;  3KAH A;  1J4I A;  3MDY B;  4JFL A;  2A3E A;  4ODN A;  4R5E A;  4ZS6 A;  2F2D A;  1T11 A;  2ZQS A;  3PRA A;  1VF8 A;  1FFQ A;  4NNR A;  1XHG A;  2JXW A;  1TK7 A;  2DK1 A;  3ARZ A;  3ARX A;  1WB0 A;  1EYM A;  3UQI A;  2DPE A;  1EG3 A;  1FKJ A;  2MDI A;  4ZPT R;  4LAW A;  4TW6 A;  4TW7 A;  3M85 A;  2L4J A;  2WAD A;  4W9Q A;  4REX A;  3JYJ A;  1HKK A;  3UF8 A;  2D9F A;  4Z2L A;  4DZ3 A;  4ODR A;  5D75 A;  1F40 A;  3L4H A;  5HTG A;  2RUD A;  2KGJ A;  2JX8 A;  1ZBK A;  2YSH A;  3KAB A;  2YSB A;  1GOI A;  1EHN A;  4MNK A;  4QIB A;  3FSB A;  1A7X A;  1NMV A;  1TFV A;  1J4R A;  4IQ2 A;  1ZU8 A;  1WMV A;  1B6C A;  3FXY A;  3ARU A;  3PQH A;  2M8J A;  3KAC A;  3UI5 A;  2ZR6 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...