3KAIA

Structure-guided design of alpha-amino acid-derived pin1 inhibitors
Total Genus 45
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
45
sequence length
157
structure length
145
Chain Sequence
LPPGWEKAMSRSSGRVYYFNHITNASQWERPSEPARVRCSHLLVKHSQSRRPSSWRQEKITRTKEEALELINGYIQKIKSGEEDFESLASQFSDCSSAKARGDLGAFSRGQMQKPFEDASFALRTGEMSGPVFTDSGIHIILRTE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Isomerase
molecule keywords Peptidyl-prolyl cis-trans isomerase NIMA-interacting 1
publication title Structure-guided design of alpha-amino acid-derived Pin1 inhibitors
pubmed doi rcsb
source organism Homo sapiens
total genus 45
structure length 145
sequence length 157
ec nomenclature ec 5.2.1.8: Peptidylprolyl isomerase.
pdb deposition date 2009-10-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00397 WW WW domain
A PF00639 Rotamase PPIC-type PPIASE domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.20.70.10 Mainly Beta Single Sheet Ubiquitin Ligase Nedd4; Chain: W; Ubiquitin Ligase Nedd4; Chain: W; 3kaiA01
3.10.50.40 Alpha Beta Roll Chitinase A; domain 3 Chitinase A; domain 3 3kaiA02
2PV2A 3I6CA 3O5LA 3B7XA 3UQIA 2LAJA 1WR7A 4IQCA 2KR7A 3IHZA 1R9HA 4DRHA 4DIPA 1Q6IA 2YSGA 2LJ4A 4O2TA 4ODLA 4JFLA 2F4EA 2AWGA 4JFKA 4TX0A 5DITA 5HUAA 4GGQA 4JFMA 5B8IC 2L2SA 1Q6UA 4IPXA 1QPLA 2JV4A 1EYMA 2MLYA 2RE3A 3KADA 1Q6HA 4DRPA 1J6YA 1NMWA 4JFIA 1D7JA 2XP7A 1B6CA 2KXQA 1FKIA 3LUOA 2LPVA 2PV3A 3PRBA 4DRKA 3CNGA 1J4HA 4LAXA 3KACA 2XP5A 3KCEA 1FKTA 4E5RA 3NRKA 2MLZA 1FKFA 4LAVA 1YW5A 1ROTA 4ITZA 5J6EA 3WH0A 3PA7A 4ODPA 5HT1A 4DRIA 4DROA 2DMVA 2XPBA 3OOBA 1PBKA 4G50A 2ZR5A 1JNTA 1FKLA 4R0XA 4U86A 4BF8A 2XPAA 1J4RA 4DRMA 2PV1A 2YSHA 3CGMA 3O5DA 5BXJA 1JVWA 2KGJA 3O5MA 3RFWA 1EQ3A 3NTPA 4JFJA 3O5EA 1FKDA 5CQ2A 1EG4A 5HWBA 1ZCNA 4J4OA 2Y78A 1I5HW 4FAPA 2PPPA 2JX8A 3EY6A 1KT1A 3JXVA 2KI3A 1P5QA 2XP6A 3IK8A 2M8JA 2N87A 2OFNA 1QZ2A 3O5GA 4QT2A 5HW8A 1FKSA 3UI5A 4DRJA 4DRQA 2RSEA 4GIVA 4JYSA 2BA1A 1WMVA 1FD9A 2ZQTA 2ZR4A 1W26A 1BKFA 5HKGA 2D9FA 3FAPA 4MSPA 2DG3A 1YATA 3TCZA 3O5KA 1QPFA 4DH0A 2PPNA 2K8IA 2KO7A 2M3OW 3UQBA 3H9RB 4QT3A 2DK7A 4W9QA 1JNSA 2M2AA 2FKEA 5HTGA 1K9RA 1O6WA 3CGNA 4TYOA 3VAWA 3PRDA 2XP3A 3O5JA 4LAYA 1FKKA 3UI4A 3KAIA 2PPOA 1F40A 3UI6A 3UQAA 3GPKA 3M7NA 2IF4A 2MLXA 1D7HA 5HW7A 2JZVA 3O5RA 4NNRA 3O5PA 2DG4A 2UZ5A 1HXVA 5HWCA 2VCDA 2ZR6A 2EZ5W 5GPGA 3O5FA 2F2DA 4ODQA 5I98A 2KFWA 4LAWA 1L1PA 3O5IA 5DIVA 1TK7A 2ZAJA 4REXA 2MPHA 1ZK6A 1KT0A 2ITKA 3M85A 1FKJA 4IQ2A 2MF9A 2RQSA 4TW7A 1C9HA 3KZ7A 3NI6A 1Y0OA 3ODKA 3JYMA 2ZQUA 1D7IA 2XP9A 5D75A 4ODOA 4DZ2A 1TCOC 1U79A 2M8IA 3KAFA 4N19A 1NSGA 2KE0A 1FAPA 2MDIA 1FKHA 4C02B 4DZ3A 4ODKA 1BL4A 3JYJA 1NMVA 4W9PA 5HW6A 4U85A 1M5YA 2MNTA 2RUDA 4TW8A 4ODMA 4U84A 3O5QA 1A7XA 2ZQSA 3IKGA 3KAHA 3TDBA 3UF8A 1ROUA 1EG3A 2JMFA 2YSBA 1K9QA 3L4HA 4ODNA 2DJYA 1D6OA 2DWVA 1FKGA 2RUCA 4ODRA 4J4NA 2YSFA 4TNSA 2Q5AA 4G2PA 3O5OA 1FJDA 4DRNA 1N1AA 2YSIA 1FKBA 3KAGA 2L4JA 3IKDA 2F21A 2E45A 4FN2A 3TC5A 2VN1A 2M08A 3LE4A 2RURA 3RGCA 2JXWA 2DG9A 4TW6A 3KABA 2LKNA 2M1IA 1JMQA 1T11A 5DIUA 1F8AB 1PINA 5AHTA 1Q1CA 4W9OA 4DT4A 3MDYB 2RUQA 2XP4A 4MGVA 2XP8A 1J4IA 2LGOA 2DK1A 2PBCA 4QIBA 2FAPA 1FKRA 2ZQVA
chains in the Genus database with same CATH superfamily
2PV2A 4W5UA 3I6CA 3O5LA 3B7XA 2IUZA 3WD3A 3FS8A 3UQIA 2LAJA 1WR7A 4IQCA 1E6NA 2OLHA 2KR7A 3IHZA 3B8SA 1R9HA 4DRHA 4DIPA 1W1PA 3MCBB 2YSGA 1Q6IA 2LJ4A 1EIBA 4O2TA 1HKKA 4ODLA 1FFQA 4JFLA 2F4EA 1GOIA 2AWGA 4JFKA 1OGGA 4TX0A 3RM9A 2ESCA 5DITA 5HUAA 1ZBWA 4GGQA 2QRVA 2WAEA 4JFMA 4WIWA 3ARVA 5B8IC 2L2SA 1Q6UA 4ZPTR 3PQHA 1LG1A 4IPXA 1H0GA 1QPLA 2JV4A 2A3AA 2WLYA 1EYMA 1OWQA 2MLYA 3CZ8A 2RE3A 4HBEA 3KADA 2DSUA 1Q6HA 4DRPA 1NWRA 1J6YA 1NMWA 4JFIA 1D7JA 1E6PA 2XP7A 4Z2KA 1B6CA 2KXQA 1FKIA 3ARQA 4HARA 4P8VA 3LUOA 2LPVA 2F23A 1W9PA 3WD4A 1ZBCA 2PV3A 3PRBA 3ARPA 4DRKA 3MCBA 3CNGA 1FLCA 5E66A 1J4HA 4LAXA 3KACA 2XP5A 3KCEA 3MQGA 1FKTA 1GUVA 4E5RA 3NRKA 3BMBA 1ZU8A 3B9AA 2MLZA 1FKFA 4LAVA 1YW5A 1ROTA 4ITZA 4IT4A 1ZB5A 2A3EA 5J6EA 5E65A 1HJWA 1W9UA 2DT0A 3WH0A 3PA7A 3WQVA 4ODPA 4L72B 5HT1A 5E64A 4DRIA 4P8UA 4DROA 2DMVA 1EDQA 4MNMA 3WL0A 2XPBA 3OOBA 1PBKA 4G50A 4L3NA 2ZR5A 4ZS6A 1JNTA 1FKLA 1HKMA 3QOKA 1KFWA 4R0XA 4U86A 3CH9A 4BF8A 3FSCA 2XPAA 2A3CA 4R5EA 1TR8A 1HJVA 1J4RA 4DRMA 2PV1A 2YSHA 3CGMA 4KR0B 3O5DA 2AOSA 1NWUA 5BXJA 3W4RA 1JVWA 2KGJA 5DF0A 3O5MA 3RFWA 1EQ3A 4P8WA 3NTPA 3ALGA 5GPRA 4JFJA 1WB0A 3O5EA 1FKDA 2WLZA 5CQ2A 1EG4A 1OGBA 5HWBA 1ZCNA 4J4OA 3RMEA 2Y78A 1I5HW 3AS2A 4FAPA 2PPPA 2JX8A 3EY6A 3B9DA 1KT1A 5U47A 3ARYA 2G8ZA 3JXVA 1LJYA 2KI3A 4Q7NA 4UDMA 1P5QA 2PN0A 2XP6A 3IK8A 1JCHB 2M8JA 2N87A 2OFNA 1QZ2A 3O5GA 2EULA 4QT2A 5HW8A 2DT1A 1FKSA 4ZPWR 3CHEA 3UI5A 4DRJA 1RP5A 4DRQA 4WKHA 2RSEA 4GIVA 4JYSA 3RM4A 4S3JA 2BA1A 1WMVA 1TFVA 1FD9A 2ZQTA 4HBOA 2ZR4A 2DT3A 1W26A 1BKFA 3CHDA 2DSZA 5HKGA 2D9FA 1WNOA 3FAPA 2WK2A 4MSPA 2DG3A 1YATA 3MQHA 2Y8NB 3TCZA 3O5KA 1XHGA 1QPFA 4DH0A 4Q22A 2PPNA 2K8IA 2KO7A 3AROA 2M3OW 1W9VA 3EIPA 3UQBA 3H9RB 4QT3A 4DWSD 2PI6A 2DK7A 4W9QA 1JNSA 4MNKA 2M2AA 2FKEA 5HTGA 1UR9A 2B31A 1K9RA 3LKXB 1O6WA 4Z2LA 2YBTA 3CGNA 4TYOA 3VAWA 3PRDA 4PTMA 2XP3A 2O92A 3O5JA 1NWTA 4LAYA 1FKKA 3UI4A 3ARWA 2DT2A 3KAIA 3GTYX 2PPOA 1ZBKA 2DPEA 1IX5A 1F40A 3UI6A 3UQAA 1SR0A 1W1YA 3WKZA 4KQZA 2QF8A 4QZVB 3GPKA 3M7NA 2YAJB 4Z2IA 1O6IA 1E44A 2A3BA 2IF4A 1X6NA 4IT6A 2MLXA 1D7HA 5HBFA 4WKAA 5HW7A 2JZVA 3O5RA 4NNRA 1E15A 2DG4A 3O5PA 2UZ5A 3BXWA 1HXVA 5HWCA 2VCDA 2ZR6A 2EZ5W 5DO2A 5GPGA 3WL1A 5GQBA 4MNJA 3O5FA 2F2DA 4ODQA 5I98A 4WKFA 2KFWA 4LAWA 4Z2GA 1L1PA 3O5IA 4MNLA 1HKIA 5DIVA 1GRJA 1TK7A 2ZAJA 4REXA 2MPHA 3CHCA 1XRVA 1ZK6A 1JNDA 1KT0A 2ITKA 3M85A 1EHNA 1FKJA 3G6LA 4WK9A 4IQ2A 2MF9A 3ARTA 2RQSA 4TW7A 1C9HA 1W1TA 3KZ7A 1RD6A 3ARUA 1LL6A 3NI6A 1Y0OA 3ODKA 3ARXA 3JYMA 2DSVA 3G6MA 2ZQUA 1D7IA 1E9LA 2XP9A 4ODOA 5D75A 4DZ2A 4MAVA 1TCOC 1U79A 2M8IA 3KAFA 3WD1A 4N19A 1NSGA 3WIJA 1LQ0A 2KE0A 1FAPA 1D2KA 4XAKA 4A0TA 2MDIA 1FKHA 4C02B 4DZ3A 4ODKA 4DWSB 1BL4A 4MTVA 4NSBA 4AY1A 2G41A 3JYJA 3ARRA 5JH8A 1NMVA 1ZBVA 3PRAA 4NZCA 4U85A 4W9PA 5HW6A 1M5YA 2MNTA 2RUDA 3CHFA 3AS0A 4TW8A 1UR8A 4ODMA 4URIA 2P4VA 4U84A 3O5QA 3AS1A 3OA5A 1SYTA 1E6RA 1HKJA 1E6ZA 1A7XA 2FDMA 2ZQSA 3IKGA 3KAHA 3TDBA 4WJXA 2OWOA 3UF8A 1ROUA 3WD0A 1EG3A 1NH6A 1NWSA 4P8XA 4MPKA 5E5WA 2JMFA 1WAWA 2YSBA 1K9QA 3AS3A 3L4HA 4ODNA 2DJYA 1D6OA 2DWVA 3ARZA 4Z2HA 3WQWA 1LL4A 1FKGA 1W1VA 2RUCA 3GU0A 1H0IA 4ODRA 4J4NA 2DSWA 1FFRA 3RM8A 2YSFA 4TNSA 1GPFA 2Q5AA 3AQUA 1LL7A 3B9EA 4G2PA 4ML4A 4DWSA 3O5OA 3ALFA 3ARSA 1FJDA 4DRNA 1N1AA 2YSIA 1FKBA 3KAGA 1HJXA 1LG2A 2L4JA 3IKDA 2F21A 2E45A 1K9TA 3WD2A 4ZPVR 4FN2A 2ETNA 3TC5A 1JNEA 4DWSC 2VN1A 2M08A 4LGXA 3LE4A 2RURA 3FSBA 5DEZA 3RGCA 2JXWA 2DG9A 2YBUA 4TW6A 4Z2JA 3KABA 2LKNA 1X6LA 2M1IA 1JMQA 1T11A 2WM0A 5DIUA 3FY1A 1F8AB 3FXYA 1PINA 2WADA 5AHTA 3PR9A 1Q1CA 1ZL1A 4W9OA 1ITXA 4DT4A 4A0UA 3MDYB 3LKXA 2RUQA 1VF8A 2XP4A 1CTNA 4MGVA 2XP8A 1J4IA 4GLXA 2LGOA 2DK1A 2PBCA 4QIBA 4S3KA 2B5UB 2FAPA 1FKRA 2ZQVA 5E62A 2O9OA
chains in the Genus database with same CATH topology
2PV2A 4W5UA 3I6CA 3O5LA 3B7XA 2IUZA 3WD3A 3FS8A 3UQIA 2LAJA 1WR7A 4IQCA 1E6NA 2OLHA 2KR7A 3IHZA 3B8SA 1R9HA 4DRHA 4DIPA 1W1PA 3MCBB 2YSGA 1Q6IA 2LJ4A 1EIBA 4O2TA 1HKKA 4ODLA 1FFQA 4JFLA 2F4EA 1GOIA 2AWGA 4JFKA 1OGGA 4TX0A 3RM9A 2ESCA 5DITA 5HUAA 1ZBWA 4GGQA 2QRVA 2WAEA 4JFMA 4WIWA 3ARVA 5B8IC 2L2SA 1Q6UA 4ZPTR 3PQHA 1LG1A 4IPXA 1H0GA 1QPLA 2JV4A 2A3AA 2WLYA 1EYMA 1OWQA 2MLYA 3CZ8A 2RE3A 4HBEA 3KADA 2DSUA 1Q6HA 4DRPA 1NWRA 1J6YA 1NMWA 4JFIA 1D7JA 1E6PA 2XP7A 4Z2KA 1B6CA 2KXQA 1FKIA 3ARQA 4HARA 4P8VA 3LUOA 2LPVA 1W9PA 3WD4A 1ZBCA 2PV3A 3PRBA 3ARPA 4DRKA 3MCBA 3CNGA 1FLCA 5E66A 1J4HA 4LAXA 3KACA 2XP5A 3KCEA 3MQGA 1FKTA 1GUVA 4E5RA 3NRKA 1ZU8A 3B9AA 2MLZA 1FKFA 4LAVA 1YW5A 1ROTA 4ITZA 4IT4A 1ZB5A 2A3EA 5J6EA 5E65A 1HJWA 1W9UA 2DT0A 3WH0A 3PA7A 3WQVA 4ODPA 4L72B 5HT1A 5E64A 4DRIA 4P8UA 4DROA 2DMVA 1EDQA 4MNMA 3WL0A 2XPBA 3OOBA 1PBKA 4G50A 4L3NA 2ZR5A 4ZS6A 1JNTA 1FKLA 1HKMA 3QOKA 1KFWA 4R0XA 4U86A 3CH9A 4BF8A 3FSCA 2XPAA 2A3CA 4R5EA 1TR8A 1HJVA 1J4RA 4DRMA 2PV1A 2YSHA 3CGMA 4KR0B 3O5DA 2AOSA 1NWUA 5BXJA 3W4RA 1JVWA 2KGJA 5DF0A 3O5MA 3RFWA 1EQ3A 4P8WA 3NTPA 3ALGA 5GPRA 4JFJA 1WB0A 3O5EA 1FKDA 2WLZA 5CQ2A 1EG4A 1OGBA 5HWBA 1ZCNA 4J4OA 3RMEA 2Y78A 1I5HW 3AS2A 4FAPA 2PPPA 2JX8A 3EY6A 3B9DA 1KT1A 5U47A 3ARYA 2G8ZA 3JXVA 1LJYA 2KI3A 4Q7NA 1P5QA 2XP6A 3IK8A 2M8JA 2N87A 2OFNA 1QZ2A 3O5GA 4QT2A 5HW8A 2DT1A 1FKSA 4ZPWR 3CHEA 3UI5A 4DRJA 1RP5A 4DRQA 4WKHA 2RSEA 4GIVA 4JYSA 3RM4A 4S3JA 2BA1A 1WMVA 1TFVA 1FD9A 2ZQTA 4HBOA 2ZR4A 2DT3A 1W26A 1BKFA 3CHDA 2DSZA 5HKGA 2D9FA 1WNOA 3FAPA 2WK2A 4MSPA 2DG3A 1YATA 3MQHA 2Y8NB 3TCZA 3O5KA 1XHGA 1QPFA 4DH0A 4Q22A 2PPNA 2K8IA 2KO7A 3AROA 2M3OW 1W9VA 3UQBA 3H9RB 4QT3A 4DWSD 2PI6A 2DK7A 4W9QA 1JNSA 4MNKA 2M2AA 2FKEA 5HTGA 1UR9A 2B31A 1K9RA 3LKXB 1O6WA 4Z2LA 2YBTA 3CGNA 4TYOA 3VAWA 3PRDA 4PTMA 2XP3A 2O92A 3O5JA 1NWTA 4LAYA 1FKKA 3UI4A 3ARWA 2DT2A 3KAIA 2PPOA 1ZBKA 2DPEA 1IX5A 1F40A 3UI6A 3UQAA 1SR0A 1W1YA 3WKZA 4KQZA 2QF8A 4QZVB 3GPKA 3M7NA 2YAJB 4Z2IA 1O6IA 2A3BA 2IF4A 1X6NA 4IT6A 2MLXA 1D7HA 5HBFA 4WKAA 5HW7A 2JZVA 3O5RA 4NNRA 1E15A 2DG4A 3O5PA 2UZ5A 3BXWA 1HXVA 5HWCA 2VCDA 2ZR6A 2EZ5W 5DO2A 5GPGA 3WL1A 5GQBA 4MNJA 3O5FA 2F2DA 4ODQA 5I98A 4WKFA 2KFWA 4LAWA 4Z2GA 1L1PA 3O5IA 4MNLA 1HKIA 5DIVA 1TK7A 2ZAJA 4REXA 2MPHA 3CHCA 1XRVA 1ZK6A 1JNDA 1KT0A 2ITKA 3M85A 1EHNA 1FKJA 3G6LA 4WK9A 4IQ2A 2MF9A 3ARTA 2RQSA 4TW7A 1C9HA 1W1TA 3KZ7A 1RD6A 3ARUA 1LL6A 3NI6A 1Y0OA 3ODKA 3ARXA 3JYMA 2DSVA 3G6MA 2ZQUA 1D7IA 1E9LA 2XP9A 4ODOA 5D75A 4DZ2A 4MAVA 1TCOC 1U79A 2M8IA 3KAFA 3WD1A 4N19A 1NSGA 3WIJA 1LQ0A 2KE0A 1FAPA 1D2KA 4XAKA 4A0TA 2MDIA 1FKHA 4C02B 4DZ3A 4ODKA 4DWSB 1BL4A 4MTVA 4NSBA 4AY1A 2G41A 3JYJA 3ARRA 5JH8A 1NMVA 1ZBVA 3PRAA 4NZCA 4U85A 4W9PA 5HW6A 1M5YA 2MNTA 2RUDA 3CHFA 3AS0A 4TW8A 1UR8A 4ODMA 4URIA 4U84A 3O5QA 3AS1A 3OA5A 1SYTA 1E6RA 1HKJA 1E6ZA 1A7XA 2FDMA 2ZQSA 3IKGA 3KAHA 3TDBA 4WJXA 2OWOA 3UF8A 1ROUA 3WD0A 1EG3A 1NH6A 1NWSA 4P8XA 4MPKA 5E5WA 2JMFA 1WAWA 2YSBA 1K9QA 3AS3A 3L4HA 4ODNA 2DJYA 1D6OA 2DWVA 3ARZA 4Z2HA 3WQWA 1LL4A 1FKGA 1W1VA 2RUCA 1H0IA 4ODRA 4J4NA 2DSWA 1FFRA 3RM8A 2YSFA 4TNSA 1GPFA 2Q5AA 3AQUA 1LL7A 3B9EA 4G2PA 4ML4A 4DWSA 3O5OA 3ALFA 3ARSA 1FJDA 4DRNA 1N1AA 2YSIA 1FKBA 3KAGA 1HJXA 1LG2A 2L4JA 3IKDA 2F21A 2E45A 1K9TA 3WD2A 4ZPVR 4FN2A 4DWSC 3TC5A 1JNEA 2VN1A 2M08A 4LGXA 3LE4A 2RURA 3FSBA 5DEZA 3RGCA 2JXWA 2DG9A 2YBUA 4TW6A 4Z2JA 3KABA 2LKNA 1X6LA 2M1IA 1JMQA 1T11A 2WM0A 5DIUA 3FY1A 1F8AB 3FXYA 1PINA 2WADA 5AHTA 3PR9A 1Q1CA 1ZL1A 4W9OA 1ITXA 4DT4A 4A0UA 3MDYB 3LKXA 2RUQA 1VF8A 2XP4A 1CTNA 4MGVA 2XP8A 1J4IA 4GLXA 2LGOA 2DK1A 2PBCA 4QIBA 4S3KA 2FAPA 1FKRA 2ZQVA 5E62A 2O9OA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2PV2 A;  3I6C A;  3O5L A;  3B7X A;  3UQI A;  2LAJ A;  1WR7 A;  4IQC A;  2KR7 A;  3IHZ A;  1R9H A;  4DRH A;  4DIP A;  1Q6I A;  2YSG A;  2LJ4 A;  4O2T A;  4ODL A;  4JFL A;  2F4E A;  2AWG A;  4JFK A;  4TX0 A;  5DIT A;  5HUA A;  4GGQ A;  4JFM A;  5B8I C;  2L2S A;  1Q6U A;  4IPX A;  1QPL A;  2JV4 A;  1EYM A;  2MLY A;  2RE3 A;  3KAD A;  1Q6H A;  4DRP A;  1J6Y A;  1NMW A;  4JFI A;  1D7J A;  2XP7 A;  1B6C A;  2KXQ A;  1FKI A;  3LUO A;  2LPV A;  2PV3 A;  3PRB A;  4DRK A;  3CNG A;  1J4H A;  4LAX A;  3KAC A;  2XP5 A;  3KCE A;  1FKT A;  4E5R A;  3NRK A;  2MLZ A;  1FKF A;  4LAV A;  1YW5 A;  1ROT A;  4ITZ A;  5J6E A;  3WH0 A;  3PA7 A;  4ODP A;  5HT1 A;  4DRI A;  4DRO A;  2DMV A;  2XPB A;  3OOB A;  1PBK A;  4G50 A;  2ZR5 A;  1JNT A;  1FKL A;  4R0X A;  4U86 A;  4BF8 A;  2XPA A;  1J4R A;  4DRM A;  2PV1 A;  2YSH A;  3CGM A;  3O5D A;  5BXJ A;  1JVW A;  2KGJ A;  3O5M A;  3RFW A;  1EQ3 A;  3NTP A;  4JFJ A;  3O5E A;  1FKD A;  5CQ2 A;  1EG4 A;  5HWB A;  1ZCN A;  4J4O A;  2Y78 A;  1I5H W;  4FAP A;  2PPP A;  2JX8 A;  3EY6 A;  1KT1 A;  3JXV A;  2KI3 A;  1P5Q A;  2XP6 A;  3IK8 A;  2M8J A;  2N87 A;  2OFN A;  1QZ2 A;  3O5G A;  4QT2 A;  5HW8 A;  1FKS A;  3UI5 A;  4DRJ A;  4DRQ A;  2RSE A;  4GIV A;  4JYS A;  2BA1 A;  1WMV A;  1FD9 A;  2ZQT A;  2ZR4 A;  1W26 A;  1BKF A;  5HKG A;  2D9F A;  3FAP A;  4MSP A;  2DG3 A;  1YAT A;  3TCZ A;  3O5K A;  1QPF A;  4DH0 A;  2PPN A;  2K8I A;  2KO7 A;  2M3O W;  3UQB A;  3H9R B;  4QT3 A;  2DK7 A;  4W9Q A;  1JNS A;  2M2A A;  2FKE A;  5HTG A;  1K9R A;  1O6W A;  3CGN A;  4TYO A;  3VAW A;  3PRD A;  2XP3 A;  3O5J A;  4LAY A;  1FKK A;  3UI4 A;  3KAI A;  2PPO A;  1F40 A;  3UI6 A;  3UQA A;  3GPK A;  3M7N A;  2IF4 A;  2MLX A;  1D7H A;  5HW7 A;  2JZV A;  3O5R A;  4NNR A;  3O5P A;  2DG4 A;  2UZ5 A;  1HXV A;  5HWC A;  2VCD A;  2ZR6 A;  2EZ5 W;  5GPG A;  3O5F A;  2F2D A;  4ODQ A;  5I98 A;  2KFW A;  4LAW A;  1L1P A;  3O5I A;  5DIV A;  1TK7 A;  2ZAJ A;  4REX A;  2MPH A;  1ZK6 A;  1KT0 A;  2ITK A;  3M85 A;  1FKJ A;  4IQ2 A;  2MF9 A;  2RQS A;  4TW7 A;  1C9H A;  3KZ7 A;  3NI6 A;  1Y0O A;  3ODK A;  3JYM A;  2ZQU A;  1D7I A;  2XP9 A;  5D75 A;  4ODO A;  4DZ2 A;  1TCO C;  1U79 A;  2M8I A;  3KAF A;  4N19 A;  1NSG A;  2KE0 A;  1FAP A;  2MDI A;  1FKH A;  4C02 B;  4DZ3 A;  4ODK A;  1BL4 A;  3JYJ A;  1NMV A;  4W9P A;  5HW6 A;  4U85 A;  1M5Y A;  2MNT A;  2RUD A;  4TW8 A;  4ODM A;  4U84 A;  3O5Q A;  1A7X A;  2ZQS A;  3IKG A;  3KAH A;  3TDB A;  3UF8 A;  1ROU A;  1EG3 A;  2JMF A;  2YSB A;  1K9Q A;  3L4H A;  4ODN A;  2DJY A;  1D6O A;  2DWV A;  1FKG A;  2RUC A;  4ODR A;  4J4N A;  2YSF A;  4TNS A;  2Q5A A;  4G2P A;  3O5O A;  1FJD A;  4DRN A;  1N1A A;  2YSI A;  1FKB A;  3KAG A;  2L4J A;  3IKD A;  2F21 A;  2E45 A;  4FN2 A;  3TC5 A;  2VN1 A;  2M08 A;  3LE4 A;  2RUR A;  3RGC A;  2JXW A;  2DG9 A;  4TW6 A;  3KAB A;  2LKN A;  2M1I A;  1JMQ A;  1T11 A;  5DIU A;  1F8A B;  1PIN A;  5AHT A;  1Q1C A;  4W9O A;  4DT4 A;  3MDY B;  2RUQ A;  2XP4 A;  4MGV A;  2XP8 A;  1J4I A;  2LGO A;  2DK1 A;  2PBC A;  4QIB A;  2FAP A;  1FKR A;  2ZQV A; 
#chains in the Genus database with same CATH topology
 2PV2 A;  4W5U A;  3I6C A;  3O5L A;  3B7X A;  2IUZ A;  3WD3 A;  3FS8 A;  3UQI A;  2LAJ A;  1WR7 A;  4IQC A;  1E6N A;  2OLH A;  2KR7 A;  3IHZ A;  3B8S A;  1R9H A;  4DRH A;  4DIP A;  1W1P A;  3MCB B;  2YSG A;  1Q6I A;  2LJ4 A;  1EIB A;  4O2T A;  1HKK A;  4ODL A;  1FFQ A;  4JFL A;  2F4E A;  1GOI A;  2AWG A;  4JFK A;  1OGG A;  4TX0 A;  3RM9 A;  2ESC A;  5DIT A;  5HUA A;  1ZBW A;  4GGQ A;  2QRV A;  2WAE A;  4JFM A;  4WIW A;  3ARV A;  5B8I C;  2L2S A;  1Q6U A;  4ZPT R;  3PQH A;  1LG1 A;  4IPX A;  1H0G A;  1QPL A;  2JV4 A;  2A3A A;  2WLY A;  1EYM A;  1OWQ A;  2MLY A;  3CZ8 A;  2RE3 A;  4HBE A;  3KAD A;  2DSU A;  1Q6H A;  4DRP A;  1NWR A;  1J6Y A;  1NMW A;  4JFI A;  1D7J A;  1E6P A;  2XP7 A;  4Z2K A;  1B6C A;  2KXQ A;  1FKI A;  3ARQ A;  4HAR A;  4P8V A;  3LUO A;  2LPV A;  2F23 A;  1W9P A;  3WD4 A;  1ZBC A;  2PV3 A;  3PRB A;  3ARP A;  4DRK A;  3MCB A;  3CNG A;  1FLC A;  5E66 A;  1J4H A;  4LAX A;  3KAC A;  2XP5 A;  3KCE A;  3MQG A;  1FKT A;  1GUV A;  4E5R A;  3NRK A;  3BMB A;  1ZU8 A;  3B9A A;  2MLZ A;  1FKF A;  4LAV A;  1YW5 A;  1ROT A;  4ITZ A;  4IT4 A;  1ZB5 A;  2A3E A;  5J6E A;  5E65 A;  1HJW A;  1W9U A;  2DT0 A;  3WH0 A;  3PA7 A;  3WQV A;  4ODP A;  4L72 B;  5HT1 A;  5E64 A;  4DRI A;  4P8U A;  4DRO A;  2DMV A;  1EDQ A;  4MNM A;  3WL0 A;  2XPB A;  3OOB A;  1PBK A;  4G50 A;  4L3N A;  2ZR5 A;  4ZS6 A;  1JNT A;  1FKL A;  1HKM A;  3QOK A;  1KFW A;  4R0X A;  4U86 A;  3CH9 A;  4BF8 A;  3FSC A;  2XPA A;  2A3C A;  4R5E A;  1TR8 A;  1HJV A;  1J4R A;  4DRM A;  2PV1 A;  2YSH A;  3CGM A;  4KR0 B;  3O5D A;  2AOS A;  1NWU A;  5BXJ A;  3W4R A;  1JVW A;  2KGJ A;  5DF0 A;  3O5M A;  3RFW A;  1EQ3 A;  4P8W A;  3NTP A;  3ALG A;  5GPR A;  4JFJ A;  1WB0 A;  3O5E A;  1FKD A;  2WLZ A;  5CQ2 A;  1EG4 A;  1OGB A;  5HWB A;  1ZCN A;  4J4O A;  3RME A;  2Y78 A;  1I5H W;  3AS2 A;  4FAP A;  2PPP A;  2JX8 A;  3EY6 A;  3B9D A;  1KT1 A;  5U47 A;  3ARY A;  2G8Z A;  3JXV A;  1LJY A;  2KI3 A;  4Q7N A;  4UDM A;  1P5Q A;  2PN0 A;  2XP6 A;  3IK8 A;  1JCH B;  2M8J A;  2N87 A;  2OFN A;  1QZ2 A;  3O5G A;  2EUL A;  4QT2 A;  5HW8 A;  2DT1 A;  1FKS A;  4ZPW R;  3CHE A;  3UI5 A;  4DRJ A;  1RP5 A;  4DRQ A;  4WKH A;  2RSE A;  4GIV A;  4JYS A;  3RM4 A;  4S3J A;  2BA1 A;  1WMV A;  1TFV A;  1FD9 A;  2ZQT A;  4HBO A;  2ZR4 A;  2DT3 A;  1W26 A;  1BKF A;  3CHD A;  2DSZ A;  5HKG A;  2D9F A;  1WNO A;  3FAP A;  2WK2 A;  4MSP A;  2DG3 A;  1YAT A;  3MQH A;  2Y8N B;  3TCZ A;  3O5K A;  1XHG A;  1QPF A;  4DH0 A;  4Q22 A;  2PPN A;  2K8I A;  2KO7 A;  3ARO A;  2M3O W;  1W9V A;  3EIP A;  3UQB A;  3H9R B;  4QT3 A;  4DWS D;  2PI6 A;  2DK7 A;  4W9Q A;  1JNS A;  4MNK A;  2M2A A;  2FKE A;  5HTG A;  1UR9 A;  2B31 A;  1K9R A;  3LKX B;  1O6W A;  4Z2L A;  2YBT A;  3CGN A;  4TYO A;  3VAW A;  3PRD A;  4PTM A;  2XP3 A;  2O92 A;  3O5J A;  1NWT A;  4LAY A;  1FKK A;  3UI4 A;  3ARW A;  2DT2 A;  3KAI A;  3GTY X;  2PPO A;  1ZBK A;  2DPE A;  1IX5 A;  1F40 A;  3UI6 A;  3UQA A;  1SR0 A;  1W1Y A;  3WKZ A;  4KQZ A;  2QF8 A;  4QZV B;  3GPK A;  3M7N A;  2YAJ B;  4Z2I A;  1O6I A;  1E44 A;  2A3B A;  2IF4 A;  1X6N A;  4IT6 A;  2MLX A;  1D7H A;  5HBF A;  4WKA A;  5HW7 A;  2JZV A;  3O5R A;  4NNR A;  1E15 A;  2DG4 A;  3O5P A;  2UZ5 A;  3BXW A;  1HXV A;  5HWC A;  2VCD A;  2ZR6 A;  2EZ5 W;  5DO2 A;  5GPG A;  3WL1 A;  5GQB A;  4MNJ A;  3O5F A;  2F2D A;  4ODQ A;  5I98 A;  4WKF A;  2KFW A;  4LAW A;  4Z2G A;  1L1P A;  3O5I A;  4MNL A;  1HKI A;  5DIV A;  1GRJ A;  1TK7 A;  2ZAJ A;  4REX A;  2MPH A;  3CHC A;  1XRV A;  1ZK6 A;  1JND A;  1KT0 A;  2ITK A;  3M85 A;  1EHN A;  1FKJ A;  3G6L A;  4WK9 A;  4IQ2 A;  2MF9 A;  3ART A;  2RQS A;  4TW7 A;  1C9H A;  1W1T A;  3KZ7 A;  1RD6 A;  3ARU A;  1LL6 A;  3NI6 A;  1Y0O A;  3ODK A;  3ARX A;  3JYM A;  2DSV A;  3G6M A;  2ZQU A;  1D7I A;  1E9L A;  2XP9 A;  4ODO A;  5D75 A;  4DZ2 A;  4MAV A;  1TCO C;  1U79 A;  2M8I A;  3KAF A;  3WD1 A;  4N19 A;  1NSG A;  3WIJ A;  1LQ0 A;  2KE0 A;  1FAP A;  1D2K A;  4XAK A;  4A0T A;  2MDI A;  1FKH A;  4C02 B;  4DZ3 A;  4ODK A;  4DWS B;  1BL4 A;  4MTV A;  4NSB A;  4AY1 A;  2G41 A;  3JYJ A;  3ARR A;  5JH8 A;  1NMV A;  1ZBV A;  3PRA A;  4NZC A;  4U85 A;  4W9P A;  5HW6 A;  1M5Y A;  2MNT A;  2RUD A;  3CHF A;  3AS0 A;  4TW8 A;  1UR8 A;  4ODM A;  4URI A;  2P4V A;  4U84 A;  3O5Q A;  3AS1 A;  3OA5 A;  1SYT A;  1E6R A;  1HKJ A;  1E6Z A;  1A7X A;  2FDM A;  2ZQS A;  3IKG A;  3KAH A;  3TDB A;  4WJX A;  2OWO A;  3UF8 A;  1ROU A;  3WD0 A;  1EG3 A;  1NH6 A;  1NWS A;  4P8X A;  4MPK A;  5E5W A;  2JMF A;  1WAW A;  2YSB A;  1K9Q A;  3AS3 A;  3L4H A;  4ODN A;  2DJY A;  1D6O A;  2DWV A;  3ARZ A;  4Z2H A;  3WQW A;  1LL4 A;  1FKG A;  1W1V A;  2RUC A;  3GU0 A;  1H0I A;  4ODR A;  4J4N A;  2DSW A;  1FFR A;  3RM8 A;  2YSF A;  4TNS A;  1GPF A;  2Q5A A;  3AQU A;  1LL7 A;  3B9E A;  4G2P A;  4ML4 A;  4DWS A;  3O5O A;  3ALF A;  3ARS A;  1FJD A;  4DRN A;  1N1A A;  2YSI A;  1FKB A;  3KAG A;  1HJX A;  1LG2 A;  2L4J A;  3IKD A;  2F21 A;  2E45 A;  1K9T A;  3WD2 A;  4ZPV R;  4FN2 A;  2ETN A;  3TC5 A;  1JNE A;  4DWS C;  2VN1 A;  2M08 A;  4LGX A;  3LE4 A;  2RUR A;  3FSB A;  5DEZ A;  3RGC A;  2JXW A;  2DG9 A;  2YBU A;  4TW6 A;  4Z2J A;  3KAB A;  2LKN A;  1X6L A;  2M1I A;  1JMQ A;  1T11 A;  2WM0 A;  5DIU A;  3FY1 A;  1F8A B;  3FXY A;  1PIN A;  2WAD A;  5AHT A;  3PR9 A;  1Q1C A;  1ZL1 A;  4W9O A;  1ITX A;  4DT4 A;  4A0U A;  3MDY B;  3LKX A;  2RUQ A;  1VF8 A;  2XP4 A;  1CTN A;  4MGV A;  2XP8 A;  1J4I A;  4GLX A;  2LGO A;  2DK1 A;  2PBC A;  4QIB A;  4S3K A;  2B5U B;  2FAP A;  1FKR A;  2ZQV A;  5E62 A;  2O9O A; 
#chains in the Genus database with same CATH homology
 2PV2 A;  4W5U A;  3I6C A;  3O5L A;  3B7X A;  2IUZ A;  3WD3 A;  3FS8 A;  3UQI A;  2LAJ A;  1WR7 A;  4IQC A;  1E6N A;  2OLH A;  2KR7 A;  3IHZ A;  3B8S A;  1R9H A;  4DRH A;  4DIP A;  1W1P A;  3MCB B;  2YSG A;  1Q6I A;  2LJ4 A;  1EIB A;  4O2T A;  1HKK A;  4ODL A;  1FFQ A;  4JFL A;  2F4E A;  1GOI A;  2AWG A;  4JFK A;  1OGG A;  4TX0 A;  3RM9 A;  2ESC A;  5DIT A;  5HUA A;  1ZBW A;  4GGQ A;  2QRV A;  2WAE A;  4JFM A;  4WIW A;  3ARV A;  5B8I C;  2L2S A;  1Q6U A;  4ZPT R;  3PQH A;  1LG1 A;  4IPX A;  1H0G A;  1QPL A;  2JV4 A;  2A3A A;  2WLY A;  1EYM A;  1OWQ A;  2MLY A;  3CZ8 A;  2RE3 A;  4HBE A;  3KAD A;  2DSU A;  1Q6H A;  4DRP A;  1NWR A;  1J6Y A;  1NMW A;  4JFI A;  1D7J A;  1E6P A;  2XP7 A;  4Z2K A;  1B6C A;  2KXQ A;  1FKI A;  3ARQ A;  4HAR A;  4P8V A;  3LUO A;  2LPV A;  1W9P A;  3WD4 A;  1ZBC A;  2PV3 A;  3PRB A;  3ARP A;  4DRK A;  3MCB A;  3CNG A;  1FLC A;  5E66 A;  1J4H A;  4LAX A;  3KAC A;  2XP5 A;  3KCE A;  3MQG A;  1FKT A;  1GUV A;  4E5R A;  3NRK A;  1ZU8 A;  3B9A A;  2MLZ A;  1FKF A;  4LAV A;  1YW5 A;  1ROT A;  4ITZ A;  4IT4 A;  1ZB5 A;  2A3E A;  5J6E A;  5E65 A;  1HJW A;  1W9U A;  2DT0 A;  3WH0 A;  3PA7 A;  3WQV A;  4ODP A;  4L72 B;  5HT1 A;  5E64 A;  4DRI A;  4P8U A;  4DRO A;  2DMV A;  1EDQ A;  4MNM A;  3WL0 A;  2XPB A;  3OOB A;  1PBK A;  4G50 A;  4L3N A;  2ZR5 A;  4ZS6 A;  1JNT A;  1FKL A;  1HKM A;  3QOK A;  1KFW A;  4R0X A;  4U86 A;  3CH9 A;  4BF8 A;  3FSC A;  2XPA A;  2A3C A;  4R5E A;  1TR8 A;  1HJV A;  1J4R A;  4DRM A;  2PV1 A;  2YSH A;  3CGM A;  4KR0 B;  3O5D A;  2AOS A;  1NWU A;  5BXJ A;  3W4R A;  1JVW A;  2KGJ A;  5DF0 A;  3O5M A;  3RFW A;  1EQ3 A;  4P8W A;  3NTP A;  3ALG A;  5GPR A;  4JFJ A;  1WB0 A;  3O5E A;  1FKD A;  2WLZ A;  5CQ2 A;  1EG4 A;  1OGB A;  5HWB A;  1ZCN A;  4J4O A;  3RME A;  2Y78 A;  1I5H W;  3AS2 A;  4FAP A;  2PPP A;  2JX8 A;  3EY6 A;  3B9D A;  1KT1 A;  5U47 A;  3ARY A;  2G8Z A;  3JXV A;  1LJY A;  2KI3 A;  4Q7N A;  1P5Q A;  2XP6 A;  3IK8 A;  2M8J A;  2N87 A;  2OFN A;  1QZ2 A;  3O5G A;  4QT2 A;  5HW8 A;  2DT1 A;  1FKS A;  4ZPW R;  3CHE A;  3UI5 A;  4DRJ A;  1RP5 A;  4DRQ A;  4WKH A;  2RSE A;  4GIV A;  4JYS A;  3RM4 A;  4S3J A;  2BA1 A;  1WMV A;  1TFV A;  1FD9 A;  2ZQT A;  4HBO A;  2ZR4 A;  2DT3 A;  1W26 A;  1BKF A;  3CHD A;  2DSZ A;  5HKG A;  2D9F A;  1WNO A;  3FAP A;  2WK2 A;  4MSP A;  2DG3 A;  1YAT A;  3MQH A;  2Y8N B;  3TCZ A;  3O5K A;  1XHG A;  1QPF A;  4DH0 A;  4Q22 A;  2PPN A;  2K8I A;  2KO7 A;  3ARO A;  2M3O W;  1W9V A;  3UQB A;  3H9R B;  4QT3 A;  4DWS D;  2PI6 A;  2DK7 A;  4W9Q A;  1JNS A;  4MNK A;  2M2A A;  2FKE A;  5HTG A;  1UR9 A;  2B31 A;  1K9R A;  3LKX B;  1O6W A;  4Z2L A;  2YBT A;  3CGN A;  4TYO A;  3VAW A;  3PRD A;  4PTM A;  2XP3 A;  2O92 A;  3O5J A;  1NWT A;  4LAY A;  1FKK A;  3UI4 A;  3ARW A;  2DT2 A;  3KAI A;  2PPO A;  1ZBK A;  2DPE A;  1IX5 A;  1F40 A;  3UI6 A;  3UQA A;  1SR0 A;  1W1Y A;  3WKZ A;  4KQZ A;  2QF8 A;  4QZV B;  3GPK A;  3M7N A;  2YAJ B;  4Z2I A;  1O6I A;  2A3B A;  2IF4 A;  1X6N A;  4IT6 A;  2MLX A;  1D7H A;  5HBF A;  4WKA A;  5HW7 A;  2JZV A;  3O5R A;  4NNR A;  1E15 A;  2DG4 A;  3O5P A;  2UZ5 A;  3BXW A;  1HXV A;  5HWC A;  2VCD A;  2ZR6 A;  2EZ5 W;  5DO2 A;  5GPG A;  3WL1 A;  5GQB A;  4MNJ A;  3O5F A;  2F2D A;  4ODQ A;  5I98 A;  4WKF A;  2KFW A;  4LAW A;  4Z2G A;  1L1P A;  3O5I A;  4MNL A;  1HKI A;  5DIV A;  1TK7 A;  2ZAJ A;  4REX A;  2MPH A;  3CHC A;  1XRV A;  1ZK6 A;  1JND A;  1KT0 A;  2ITK A;  3M85 A;  1EHN A;  1FKJ A;  3G6L A;  4WK9 A;  4IQ2 A;  2MF9 A;  3ART A;  2RQS A;  4TW7 A;  1C9H A;  1W1T A;  3KZ7 A;  1RD6 A;  3ARU A;  1LL6 A;  3NI6 A;  1Y0O A;  3ODK A;  3ARX A;  3JYM A;  2DSV A;  3G6M A;  2ZQU A;  1D7I A;  1E9L A;  2XP9 A;  4ODO A;  5D75 A;  4DZ2 A;  4MAV A;  1TCO C;  1U79 A;  2M8I A;  3KAF A;  3WD1 A;  4N19 A;  1NSG A;  3WIJ A;  1LQ0 A;  2KE0 A;  1FAP A;  1D2K A;  4XAK A;  4A0T A;  2MDI A;  1FKH A;  4C02 B;  4DZ3 A;  4ODK A;  4DWS B;  1BL4 A;  4MTV A;  4NSB A;  4AY1 A;  2G41 A;  3JYJ A;  3ARR A;  5JH8 A;  1NMV A;  1ZBV A;  3PRA A;  4NZC A;  4U85 A;  4W9P A;  5HW6 A;  1M5Y A;  2MNT A;  2RUD A;  3CHF A;  3AS0 A;  4TW8 A;  1UR8 A;  4ODM A;  4URI A;  4U84 A;  3O5Q A;  3AS1 A;  3OA5 A;  1SYT A;  1E6R A;  1HKJ A;  1E6Z A;  1A7X A;  2FDM A;  2ZQS A;  3IKG A;  3KAH A;  3TDB A;  4WJX A;  2OWO A;  3UF8 A;  1ROU A;  3WD0 A;  1EG3 A;  1NH6 A;  1NWS A;  4P8X A;  4MPK A;  5E5W A;  2JMF A;  1WAW A;  2YSB A;  1K9Q A;  3AS3 A;  3L4H A;  4ODN A;  2DJY A;  1D6O A;  2DWV A;  3ARZ A;  4Z2H A;  3WQW A;  1LL4 A;  1FKG A;  1W1V A;  2RUC A;  1H0I A;  4ODR A;  4J4N A;  2DSW A;  1FFR A;  3RM8 A;  2YSF A;  4TNS A;  1GPF A;  2Q5A A;  3AQU A;  1LL7 A;  3B9E A;  4G2P A;  4ML4 A;  4DWS A;  3O5O A;  3ALF A;  3ARS A;  1FJD A;  4DRN A;  1N1A A;  2YSI A;  1FKB A;  3KAG A;  1HJX A;  1LG2 A;  2L4J A;  3IKD A;  2F21 A;  2E45 A;  1K9T A;  3WD2 A;  4ZPV R;  4FN2 A;  4DWS C;  3TC5 A;  1JNE A;  2VN1 A;  2M08 A;  4LGX A;  3LE4 A;  2RUR A;  3FSB A;  5DEZ A;  3RGC A;  2JXW A;  2DG9 A;  2YBU A;  4TW6 A;  4Z2J A;  3KAB A;  2LKN A;  1X6L A;  2M1I A;  1JMQ A;  1T11 A;  2WM0 A;  5DIU A;  3FY1 A;  1F8A B;  3FXY A;  1PIN A;  2WAD A;  5AHT A;  3PR9 A;  1Q1C A;  1ZL1 A;  4W9O A;  1ITX A;  4DT4 A;  4A0U A;  3MDY B;  3LKX A;  2RUQ A;  1VF8 A;  2XP4 A;  1CTN A;  4MGV A;  2XP8 A;  1J4I A;  4GLX A;  2LGO A;  2DK1 A;  2PBC A;  4QIB A;  4S3K A;  2FAP A;  1FKR A;  2ZQV A;  5E62 A;  2O9O A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...