3KAIA

Structure-guided design of alpha-amino acid-derived pin1 inhibitors
Total Genus 45
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
45
sequence length
157
structure length
145
Chain Sequence
LPPGWEKAMSRSSGRVYYFNHITNASQWERPSEPARVRCSHLLVKHSQSRRPSSWRQEKITRTKEEALELINGYIQKIKSGEEDFESLASQFSDCSSAKARGDLGAFSRGQMQKPFEDASFALRTGEMSGPVFTDSGIHIILRTE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure-guided design of alpha-amino acid-derived Pin1 inhibitors
pubmed doi rcsb
source organism Homo sapiens
molecule tags Isomerase
molecule keywords Peptidyl-prolyl cis-trans isomerase NIMA-interacting 1
total genus 45
structure length 145
sequence length 157
ec nomenclature ec 5.2.1.8: Peptidylprolyl isomerase.
pdb deposition date 2009-10-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00397 WW WW domain
A PF00639 Rotamase PPIC-type PPIASE domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.20.70.10 Mainly Beta Single Sheet Ubiquitin Ligase Nedd4; Chain: W; Ubiquitin Ligase Nedd4; Chain: W; 3kaiA01
3.10.50.40 Alpha Beta Roll Chitinase A; domain 3 Chitinase A; domain 3 3kaiA02
3H9RB 2EZ5W 3JYJA 3O5GA 1ZCNA 2XP9A 3ODKA 2YSIA 3O5MA 1FKLA 4TYOA 1FKSA 3KAHA 3CNGA 1FKTA 2D9FA 2FAPA 4J4NA 4IQ2A 2Q5AA 1O6WA 2ZAJA 1FKHA 2XP3A 2KI3A 4ODNA 3KZ7A 2M1IA 4IQCA 1QPFA 5HKGA 1P5QA 2DG4A 1I5HW 3PRDA 2RUQA 1B6CA 2JV4A 3KABA 1D7IA 1JNTA 2UZ5A 3JXVA 3NRKA 1L1PA 3IKDA 2ZQTA 1K9RA 1YATA 3O5EA 3VAWA 1F8AB 2DG3A 2N87A 5BXJA 2LKNA 1FD9A 1EG4A 1EG3A 2XP7A 4DH0A 4JFJA 3IHZA 1JMQA 4TW6A 3LUOA 3PA7A 4G2PA 4JYSA 4NNRA 3O5OA 3B7XA 4G50A 1F40A 2JX8A 3KADA 3NTPA 2Y78A 4C02B 1J4HA 4GIVA 4DIPA 1EYMA 5HT1A 1WR7A 4ODMA 2M8JA 5DITA 3O5DA 4JFLA 5B8IC 2KO7A 1HXVA 1YW5A 5HTGA 2YSBA 1Q6IA 2K8IA 1WMVA 2MF9A 5CQ2A 3KCEA 2LGOA 2PV2A 3KACA 4ODPA 4QT3A 2JXWA 4DRHA 1BKFA 4DZ2A 2ZQUA 1KT0A 4TW8A 5HWCA 2E45A 2XP4A 2LAJA 3UI4A 3O5QA 4ODRA 5GPGA 3UF8A 1QZ2A 2PV1A 4TX0A 3JYMA 3UQBA 1Y0OA 4BF8A 1K9QA 3WH0A 2KXQA 1J4IA 2M8IA 1D7JA 1FKKA 2MLZA 1TK7A 3CGMA 3I6CA 1TCOC 2JMFA 4JFMA 2ZR5A 3PRBA 2RURA 3L4HA 2ZQVA 3KAGA 1C9HA 1PBKA 2PPPA 4W9PA 4J4OA 4FAPA 4U84A 2M08A 4JFIA 3O5PA 3TDBA 4ODKA 4TW7A 1T11A 2KGJA 2ZQSA 2DJYA 2RE3A 1FKRA 4DRQA 2ZR6A 4LAWA 1NMWA 2F4EA 1FKBA 3O5RA 4ITZA 2VN1A 2DG9A 3UQAA 4DRMA 2BA1A 2AWGA 3RFWA 4DRJA 2L4JA 3GPKA 1D7HA 2M3OW 4ODQA 2RSEA 1PINA 2FKEA 2OFNA 4W9OA 2PV3A 3IK8A 2DWVA 1FAPA 4DRKA 2LPVA 1W26A 4IPXA 3O5KA 5I98A 2M2AA 1FKIA 1Q6UA 3OOBA 1R9HA 2RQSA 3FAPA 4W9QA 5J6EA 1FKFA 4U86A 1NMVA 3LE4A 3MDYB 5HW6A 1JNSA 5HW7A 3UQIA 4DT4A 4U85A 4GGQA 4QIBA 1NSGA 4E5RA 2VCDA 4REXA 2LJ4A 4MSPA 1QPLA 2KR7A 4N19A 3NI6A 3UI5A 2ZR4A 3TCZA 5D75A 4DRPA 2L2SA 4LAVA 3UI6A 4QT2A 2XP5A 2YSHA 2DK1A 1U79A 3KAFA 1KT1A 2MLXA 3O5FA 2JZVA 2YSGA 2KE0A 4O2TA 1JVWA 4DRNA 5HWBA 2XP8A 2MPHA 4DRIA 4LAYA 4ODOA 2XPAA 2RUCA 2MLYA 1M5YA 3M7NA 1FJDA 3O5LA 1Q1CA 5AHTA 4JFKA 5HUAA 2KFWA 4ODLA 4TNSA 2PBCA 1FKJA 1FKGA 4DZ3A 1J6YA 1EQ3A 3EY6A 4FN2A 3TC5A 1BL4A 2IF4A 2DMVA 4LAXA 3O5JA 2YSFA 5DIUA 5DIVA 2MDIA 1N1AA 1FKDA 1ROUA 3KAIA 2DK7A 4MGVA 2MNTA 4R0XA 3O5IA 1J4RA 2F21A 1Q6HA 3RGCA 2XPBA 2F2DA 3IKGA 1ZK6A 2RUDA 1D6OA 3CGNA 2ITKA 5HW8A 2XP6A 1A7XA 4DROA 2PPNA 3M85A 1ROTA 2PPOA
chains in the Genus database with same CATH superfamily
3H9RB 4TYOA 1FKLA 4Q22A 3KAHA 2B31A 2D9FA 4IQ2A 2Q5AA 1O6WA 1CTNA 1QPFA 3PRDA 2QRVA 1D7IA 3IKDA 2ZQTA 1K9RA 1OGBA 1JNEA 3O5EA 3VAWA 2O9OA 1FD9A 3ARZA 1TFVA 3WKZA 1NWRA 1FLCA 4Z2LA 1J4HA 1LJYA 4ODMA 2M8JA 3FSCA 1HXVA 4JFLA 1YW5A 5JH8A 2PV2A 3FXYA 2DSVA 3KCEA 4DRHA 1E6PA 3CH9A 2XP4A 2LAJA 3UI4A 1H0GA 4Z2HA 1LL4A 1QZ2A 1W1PA 4TX0A 1K9QA 3WH0A 1J4IA 3AROA 5E65A 1OGGA 2RURA 1UR8A 3RM9A 2B5UB 4DWSD 2PPPA 4ZPTR 4W9PA 4JFIA 3O5PA 3TDBA 2FDMA 2F4EA 4MNJA 3CHCA 4XAKA 1HKIA 2G41A 3CHFA 3GPKA 2DSZA 1HKMA 2M3OW 4LGXA 1E9LA 2RSEA 2OFNA 3RMEA 3IK8A 2QF8A 5J6EA 3OOBA 4W9QA 3MDYB 4U86A 3LE4A 5HW6A 3UQIA 4DT4A 1LL6A 2VCDA 4P8WA 4MSPA 1QPLA 2ESCA 2ZR4A 1EDQA 4WIWA 2XP5A 2YSHA 3GU0A 1W9VA 2YSGA 2KE0A 1IX5A 1JVWA 3WD0A 4Q7NA 2MPHA 4NSBA 2YAJB 2XPAA 1LG2A 1M5YA 1O6IA 3O5LA 4JFKA 1HKJA 2DPEA 2KFWA 2DT0A 2PBCA 1ZBCA 3EY6A 1ROUA 3KAIA 2MNTA 1Q6HA 3GTYX 2XPBA 2F2DA 2DT2A 2RUDA 3CGNA 4MPKA 2ITKA 1NH6A 2XP6A 5E5WA 1A7XA 3ARRA 3BXWA 3M85A 2EZ5W 3O5GA 2XP9A 3O5MA 3WIJA 3MQGA 1ZBWA 2FAPA 4J4NA 4HBOA 2XP3A 3OA5A 1GPFA 2RUQA 1B6CA 4A0UA 3NRKA 3JXVA 1W1TA 1WAWA 1F8AB 3ALFA 2N87A 1EG4A 1EG3A 4P8XA 2IUZA 3IHZA 1OWQA 3LUOA 3PA7A 4NNRA 3O5OA 3B7XA 1W9UA 2JX8A 1NWTA 2YBTA 4C02B 4MAVA 1EYMA 5HT1A 5DITA 2KO7A 2YSBA 2K8IA 1WMVA 1D2KA 3KACA 5E66A 2E45A 4WKAA 4DWSC 4ODRA 5GPGA 2AOSA 2PV1A 1NWSA 1TR8A 1W1YA 1TCOC 4W5UA 5DEZA 4IT6A 1X6NA 1EIBA 4J4OA 4FAPA 1XHGA 4Z2IA 4TW7A 1FKRA 1ZBKA 5GPRA 1FKBA 1H0IA 2DG9A 2P4VA 3UQAA 1ZBVA 2AWGA 5HBFA 4DRJA 3W4RA 1PINA 4W9OA 4L3NA 1FAPA 4P8UA 1NWUA 1W26A 5I98A 3O5KA 4ZS6A 1FKIA 1R9HA 2DT3A 4S3JA 1FKFA 4A0TA 1LL7A 1NSGA 4MNMA 4S3KA 4N19A 3TCZA 4LAVA 1FFRA 3MCBA 1VF8A 3UI6A 2DK1A 1HJXA 2WAEA 1U79A 1RP5A 3AS1A 3O5FA 4O2TA 5HWBA 1HJWA 4QZVB 4LAYA 2RUCA 3MCBB 4Z2KA 3AQUA 2DT1A 4Z2JA 1W1VA 1Q1CA 5AHTA 4ML4A 1SR0A 3PR9A 4DZ3A 2EULA 5DIUA 1N1AA 2WM0A 1W9PA 4MGVA 3FSBA 4URIA 4WKHA 4KQZA 3ARQA 3IKGA 1JCHB 1D6OA 2G8ZA 1ZU8A 3WQVA 3JYJA 2YSIA 3ARVA 1FKSA 3CNGA 5U47A 1FKHA 2KI3A 3KZ7A 2M1IA 4IQCA 3ARSA 2YBUA 4ZPWR 5HTGA 5BXJA 2DG3A 2LKNA 3ARXA 2XP7A 4DH0A 1JMQA 4TW6A 4G2PA 4JYSA 3ALGA 3KADA 3NTPA 2Y78A 3ARWA 4GIVA 2WLZA 1WR7A 5B8IC 3O5DA 3CHEA 2F23A 3PRAA 5CQ2A 2LGOA 1RD6A 2JXWA 1BKFA 4UDMA 4DZ2A 2ZQUA 4WK9A 3PQHA 3O5QA 4R5EA 3UF8A 2WK2A 4P8VA 3ARTA 1Y0OA 2KXQA 3ARYA 3CGMA 3B9DA 4JFMA 1E6NA 3PRBA 4MNLA 3WD4A 2ZQVA 2ETNA 1PBKA 1ZL1A 5E64A 4U84A 2M08A 1LG1A 4ODKA 1T11A 2DJYA 2ZR6A 4ITZA 2VN1A 3AS0A 2BA1A 3RFWA 2OWOA 2DSUA 1GRJA 3RM4A 2FKEA 2PV3A 4DRKA 2LPVA 3CHDA 4IPXA 2M2AA 5GQBA 1Q6UA 3FAPA 1E6RA 1UR9A 4GGQA 4QIBA 3ARUA 4E5RA 1K9TA 4REXA 2LJ4A 2PI6A 4QT2A 2MLXA 2WLYA 2JZVA 4DRNA 2XP8A 4IT4A 4DRIA 4ODOA 1FJDA 4PTMA 3M7NA 1ITXA 1GOIA 1LQ0A 1FFQA 4TNSA 1J6YA 1EQ3A 3AS2A 1BL4A 3O5JA 2YSFA 5DIVA 1E44A 4HARA 4ZPVR 4DWSB 3O5IA 2DSWA 1J4RA 2F21A 3RGCA 3FY1A 5HW8A 1GUVA 4DROA 4MTVA 2PPNA 3B9EA 3CZ8A 1ZCNA 3ODKA 1HJVA 1FKTA 1JNDA 2ZAJA 4ODNA 2Y8NB 4L72B 5HKGA 1HKKA 1P5QA 1I5HW 2DG4A 2JV4A 3KABA 1JNTA 2UZ5A 3WD1A 1L1PA 1EHNA 4KR0B 1YATA 3ARPA 3WD2A 1WNOA 3LKXA 4JFJA 1XRVA 4G50A 1F40A 4DIPA 1Q6IA 2A3CA 4ODPA 2MF9A 3RM8A 4QT3A 5DF0A 1KT0A 5HWCA 4TW8A 3WL1A 3EIPA 2A3BA 3UQBA 3JYMA 4BF8A 1FKKA 2M8IA 1D7JA 3BMBA 2MLZA 1TK7A 3I6CA 2JMFA 2ZR5A 3L4HA 3B8SA 3KAGA 1C9HA 2A3AA 2O92A 2KGJA 2ZQSA 2RE3A 4MNKA 4WKFA 3WD3A 4DRQA 3MQHA 1NMWA 4LAWA 3O5RA 4HBEA 3B9AA 4DRMA 2L4JA 3WL0A 1D7HA 4ODQA 1E6ZA 3AS3A 4DWSA 2DWVA 2RQSA 1KFWA 1JNSA 1NMVA 5E62A 5HW7A 3G6MA 4U85A 3FS8A 3UI5A 2OLHA 2KR7A 4DRPA 3NI6A 5D75A 1X6LA 2L2SA 4Z2GA 3KAFA 1KT1A 1WB0A 3QOKA 1ZB5A 4NZCA 2MLYA 2A3EA 4GLXA 5DO2A 2PN0A 5HUAA 4WJXA 3LKXB 4ODLA 1FKJA 1FKGA 3G6LA 4FN2A 3TC5A 2IF4A 2DMVA 4LAXA 1SYTA 2MDIA 2WADA 1FKDA 4AY1A 2DK7A 4R0XA 3WQWA 1ZK6A 1E15A 1ROTA 2PPOA
chains in the Genus database with same CATH topology
3H9RB 4TYOA 1FKLA 4Q22A 3KAHA 2B31A 2D9FA 4IQ2A 2Q5AA 1O6WA 1CTNA 1QPFA 3PRDA 2QRVA 1D7IA 3IKDA 2ZQTA 1K9RA 1OGBA 1JNEA 3O5EA 3VAWA 2O9OA 1FD9A 3ARZA 1TFVA 3WKZA 1NWRA 1FLCA 4Z2LA 1J4HA 1LJYA 4ODMA 2M8JA 3FSCA 1HXVA 4JFLA 1YW5A 5JH8A 2PV2A 3FXYA 2DSVA 3KCEA 4DRHA 1E6PA 3CH9A 2XP4A 2LAJA 3UI4A 1H0GA 4Z2HA 1LL4A 1QZ2A 1W1PA 4TX0A 1K9QA 3WH0A 1J4IA 3AROA 5E65A 1OGGA 2RURA 1UR8A 3RM9A 4DWSD 2PPPA 4ZPTR 4W9PA 4JFIA 3O5PA 3TDBA 2FDMA 2F4EA 4MNJA 3CHCA 4XAKA 1HKIA 2G41A 3CHFA 3GPKA 2DSZA 1HKMA 2M3OW 4LGXA 1E9LA 2RSEA 2OFNA 3RMEA 3IK8A 2QF8A 5J6EA 3OOBA 4W9QA 3MDYB 4U86A 3LE4A 5HW6A 3UQIA 4DT4A 1LL6A 2VCDA 4P8WA 4MSPA 1QPLA 2ESCA 2ZR4A 1EDQA 4WIWA 2XP5A 2YSHA 1W9VA 2YSGA 2KE0A 1IX5A 1JVWA 3WD0A 4Q7NA 2MPHA 4NSBA 2YAJB 2XPAA 1LG2A 1M5YA 1O6IA 3O5LA 4JFKA 1HKJA 2DPEA 2KFWA 2DT0A 2PBCA 1ZBCA 3EY6A 1ROUA 3KAIA 2MNTA 1Q6HA 2XPBA 2F2DA 2DT2A 2RUDA 3CGNA 4MPKA 2ITKA 1NH6A 2XP6A 5E5WA 1A7XA 3ARRA 3BXWA 3M85A 2EZ5W 3O5GA 2XP9A 3O5MA 3WIJA 3MQGA 1ZBWA 2FAPA 4J4NA 4HBOA 2XP3A 3OA5A 1GPFA 2RUQA 1B6CA 4A0UA 3NRKA 3JXVA 1W1TA 1WAWA 1F8AB 3ALFA 2N87A 1EG4A 1EG3A 4P8XA 2IUZA 3IHZA 1OWQA 3LUOA 3PA7A 4NNRA 3O5OA 3B7XA 1W9UA 2JX8A 1NWTA 2YBTA 4C02B 4MAVA 1EYMA 5HT1A 5DITA 2KO7A 2YSBA 2K8IA 1WMVA 1D2KA 3KACA 5E66A 2E45A 4WKAA 4DWSC 4ODRA 5GPGA 2AOSA 2PV1A 1NWSA 1TR8A 1W1YA 1TCOC 4W5UA 5DEZA 4IT6A 1X6NA 1EIBA 4J4OA 4FAPA 1XHGA 4Z2IA 4TW7A 1FKRA 1ZBKA 5GPRA 1FKBA 1H0IA 2DG9A 3UQAA 1ZBVA 2AWGA 5HBFA 4DRJA 3W4RA 1PINA 4W9OA 4L3NA 1FAPA 4P8UA 1NWUA 1W26A 5I98A 3O5KA 4ZS6A 1FKIA 1R9HA 2DT3A 4S3JA 1FKFA 4A0TA 1LL7A 1NSGA 4MNMA 4S3KA 4N19A 3TCZA 4LAVA 1FFRA 3MCBA 1VF8A 3UI6A 2DK1A 1HJXA 2WAEA 1U79A 1RP5A 3AS1A 3O5FA 4O2TA 5HWBA 1HJWA 4QZVB 4LAYA 2RUCA 3MCBB 4Z2KA 3AQUA 2DT1A 4Z2JA 1W1VA 1Q1CA 5AHTA 4ML4A 1SR0A 3PR9A 4DZ3A 5DIUA 1N1AA 2WM0A 1W9PA 4MGVA 3FSBA 4URIA 4WKHA 4KQZA 3ARQA 3IKGA 1D6OA 2G8ZA 1ZU8A 3WQVA 3JYJA 2YSIA 3ARVA 1FKSA 3CNGA 5U47A 1FKHA 2KI3A 3KZ7A 2M1IA 4IQCA 3ARSA 2YBUA 4ZPWR 5HTGA 5BXJA 2DG3A 2LKNA 3ARXA 2XP7A 4DH0A 1JMQA 4TW6A 4G2PA 4JYSA 3ALGA 3KADA 3NTPA 2Y78A 3ARWA 4GIVA 2WLZA 1WR7A 5B8IC 3O5DA 3CHEA 3PRAA 5CQ2A 2LGOA 1RD6A 2JXWA 1BKFA 4DZ2A 2ZQUA 4WK9A 3PQHA 3O5QA 4R5EA 3UF8A 2WK2A 4P8VA 3ARTA 1Y0OA 2KXQA 3ARYA 3CGMA 3B9DA 4JFMA 1E6NA 3PRBA 4MNLA 3WD4A 2ZQVA 1PBKA 1ZL1A 5E64A 4U84A 2M08A 1LG1A 4ODKA 1T11A 2DJYA 2ZR6A 4ITZA 2VN1A 3AS0A 2BA1A 3RFWA 2OWOA 2DSUA 3RM4A 2FKEA 2PV3A 4DRKA 2LPVA 3CHDA 4IPXA 2M2AA 5GQBA 1Q6UA 3FAPA 1E6RA 1UR9A 4GGQA 4QIBA 3ARUA 4E5RA 1K9TA 4REXA 2LJ4A 2PI6A 4QT2A 2MLXA 2WLYA 2JZVA 4DRNA 2XP8A 4IT4A 4DRIA 4ODOA 1FJDA 4PTMA 3M7NA 1ITXA 1GOIA 1LQ0A 1FFQA 4TNSA 1J6YA 1EQ3A 3AS2A 1BL4A 3O5JA 2YSFA 5DIVA 4HARA 4ZPVR 4DWSB 3O5IA 2DSWA 1J4RA 2F21A 3RGCA 3FY1A 5HW8A 1GUVA 4DROA 4MTVA 2PPNA 3B9EA 3CZ8A 1ZCNA 3ODKA 1HJVA 1FKTA 1JNDA 2ZAJA 4ODNA 2Y8NB 4L72B 5HKGA 1HKKA 1P5QA 1I5HW 2DG4A 2JV4A 3KABA 1JNTA 2UZ5A 3WD1A 1L1PA 1EHNA 4KR0B 1YATA 3ARPA 3WD2A 1WNOA 3LKXA 4JFJA 1XRVA 4G50A 1F40A 4DIPA 1Q6IA 2A3CA 4ODPA 2MF9A 3RM8A 4QT3A 5DF0A 1KT0A 5HWCA 4TW8A 3WL1A 2A3BA 3UQBA 3JYMA 4BF8A 1FKKA 2M8IA 1D7JA 3I6CA 2MLZA 1TK7A 2JMFA 2ZR5A 3L4HA 3B8SA 3KAGA 1C9HA 2A3AA 2O92A 2KGJA 2ZQSA 2RE3A 4MNKA 4WKFA 3WD3A 4DRQA 3MQHA 1NMWA 4LAWA 3O5RA 4HBEA 3B9AA 4DRMA 2L4JA 3WL0A 1D7HA 4ODQA 1E6ZA 3AS3A 4DWSA 2DWVA 2RQSA 1KFWA 1JNSA 1NMVA 5E62A 5HW7A 3G6MA 4U85A 3FS8A 3UI5A 2OLHA 2KR7A 4DRPA 3NI6A 5D75A 1X6LA 2L2SA 4Z2GA 3KAFA 1KT1A 1WB0A 3QOKA 1ZB5A 4NZCA 2MLYA 2A3EA 4GLXA 5DO2A 5HUAA 4WJXA 3LKXB 4ODLA 1FKJA 1FKGA 3G6LA 4FN2A 3TC5A 2IF4A 2DMVA 4LAXA 1SYTA 2MDIA 2WADA 1FKDA 4AY1A 2DK7A 4R0XA 3WQWA 1ZK6A 1E15A 1ROTA 2PPOA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3H9R B;  2EZ5 W;  3JYJ A;  3O5G A;  1ZCN A;  2XP9 A;  3ODK A;  2YSI A;  3O5M A;  1FKL A;  4TYO A;  1FKS A;  3KAH A;  3CNG A;  1FKT A;  2D9F A;  2FAP A;  4J4N A;  4IQ2 A;  2Q5A A;  1O6W A;  2ZAJ A;  1FKH A;  2XP3 A;  2KI3 A;  4ODN A;  3KZ7 A;  2M1I A;  4IQC A;  1QPF A;  5HKG A;  1P5Q A;  2DG4 A;  1I5H W;  3PRD A;  2RUQ A;  1B6C A;  2JV4 A;  3KAB A;  1D7I A;  1JNT A;  2UZ5 A;  3JXV A;  3NRK A;  1L1P A;  3IKD A;  2ZQT A;  1K9R A;  1YAT A;  3O5E A;  3VAW A;  1F8A B;  2DG3 A;  2N87 A;  5BXJ A;  2LKN A;  1FD9 A;  1EG4 A;  1EG3 A;  2XP7 A;  4DH0 A;  4JFJ A;  3IHZ A;  1JMQ A;  4TW6 A;  3LUO A;  3PA7 A;  4G2P A;  4JYS A;  4NNR A;  3O5O A;  3B7X A;  4G50 A;  1F40 A;  2JX8 A;  3KAD A;  3NTP A;  2Y78 A;  4C02 B;  1J4H A;  4GIV A;  4DIP A;  1EYM A;  5HT1 A;  1WR7 A;  4ODM A;  2M8J A;  5DIT A;  3O5D A;  4JFL A;  5B8I C;  2KO7 A;  1HXV A;  1YW5 A;  5HTG A;  2YSB A;  1Q6I A;  2K8I A;  1WMV A;  2MF9 A;  5CQ2 A;  3KCE A;  2LGO A;  2PV2 A;  3KAC A;  4ODP A;  4QT3 A;  2JXW A;  4DRH A;  1BKF A;  4DZ2 A;  2ZQU A;  1KT0 A;  4TW8 A;  5HWC A;  2E45 A;  2XP4 A;  2LAJ A;  3UI4 A;  3O5Q A;  4ODR A;  5GPG A;  3UF8 A;  1QZ2 A;  2PV1 A;  4TX0 A;  3JYM A;  3UQB A;  1Y0O A;  4BF8 A;  1K9Q A;  3WH0 A;  2KXQ A;  1J4I A;  2M8I A;  1D7J A;  1FKK A;  2MLZ A;  1TK7 A;  3CGM A;  3I6C A;  1TCO C;  2JMF A;  4JFM A;  2ZR5 A;  3PRB A;  2RUR A;  3L4H A;  2ZQV A;  3KAG A;  1C9H A;  1PBK A;  2PPP A;  4W9P A;  4J4O A;  4FAP A;  4U84 A;  2M08 A;  4JFI A;  3O5P A;  3TDB A;  4ODK A;  4TW7 A;  1T11 A;  2KGJ A;  2ZQS A;  2DJY A;  2RE3 A;  1FKR A;  4DRQ A;  2ZR6 A;  4LAW A;  1NMW A;  2F4E A;  1FKB A;  3O5R A;  4ITZ A;  2VN1 A;  2DG9 A;  3UQA A;  4DRM A;  2BA1 A;  2AWG A;  3RFW A;  4DRJ A;  2L4J A;  3GPK A;  1D7H A;  2M3O W;  4ODQ A;  2RSE A;  1PIN A;  2FKE A;  2OFN A;  4W9O A;  2PV3 A;  3IK8 A;  2DWV A;  1FAP A;  4DRK A;  2LPV A;  1W26 A;  4IPX A;  3O5K A;  5I98 A;  2M2A A;  1FKI A;  1Q6U A;  3OOB A;  1R9H A;  2RQS A;  3FAP A;  4W9Q A;  5J6E A;  1FKF A;  4U86 A;  1NMV A;  3LE4 A;  3MDY B;  5HW6 A;  1JNS A;  5HW7 A;  3UQI A;  4DT4 A;  4U85 A;  4GGQ A;  4QIB A;  1NSG A;  4E5R A;  2VCD A;  4REX A;  2LJ4 A;  4MSP A;  1QPL A;  2KR7 A;  4N19 A;  3NI6 A;  3UI5 A;  2ZR4 A;  3TCZ A;  5D75 A;  4DRP A;  2L2S A;  4LAV A;  3UI6 A;  4QT2 A;  2XP5 A;  2YSH A;  2DK1 A;  1U79 A;  3KAF A;  1KT1 A;  2MLX A;  3O5F A;  2JZV A;  2YSG A;  2KE0 A;  4O2T A;  1JVW A;  4DRN A;  5HWB A;  2XP8 A;  2MPH A;  4DRI A;  4LAY A;  4ODO A;  2XPA A;  2RUC A;  2MLY A;  1M5Y A;  3M7N A;  1FJD A;  3O5L A;  1Q1C A;  5AHT A;  4JFK A;  5HUA A;  2KFW A;  4ODL A;  4TNS A;  2PBC A;  1FKJ A;  1FKG A;  4DZ3 A;  1J6Y A;  1EQ3 A;  3EY6 A;  4FN2 A;  3TC5 A;  1BL4 A;  2IF4 A;  2DMV A;  4LAX A;  3O5J A;  2YSF A;  5DIU A;  5DIV A;  2MDI A;  1N1A A;  1FKD A;  1ROU A;  3KAI A;  2DK7 A;  4MGV A;  2MNT A;  4R0X A;  3O5I A;  1J4R A;  2F21 A;  1Q6H A;  3RGC A;  2XPB A;  2F2D A;  3IKG A;  1ZK6 A;  2RUD A;  1D6O A;  3CGN A;  2ITK A;  5HW8 A;  2XP6 A;  1A7X A;  4DRO A;  2PPN A;  3M85 A;  1ROT A;  2PPO A; 
#chains in the Genus database with same CATH topology
 3H9R B;  4TYO A;  1FKL A;  4Q22 A;  3KAH A;  2B31 A;  2D9F A;  4IQ2 A;  2Q5A A;  1O6W A;  1CTN A;  1QPF A;  3PRD A;  2QRV A;  1D7I A;  3IKD A;  2ZQT A;  1K9R A;  1OGB A;  1JNE A;  3O5E A;  3VAW A;  2O9O A;  1FD9 A;  3ARZ A;  1TFV A;  3WKZ A;  1NWR A;  1FLC A;  4Z2L A;  1J4H A;  1LJY A;  4ODM A;  2M8J A;  3FSC A;  1HXV A;  4JFL A;  1YW5 A;  5JH8 A;  2PV2 A;  3FXY A;  2DSV A;  3KCE A;  4DRH A;  1E6P A;  3CH9 A;  2XP4 A;  2LAJ A;  3UI4 A;  1H0G A;  4Z2H A;  1LL4 A;  1QZ2 A;  1W1P A;  4TX0 A;  1K9Q A;  3WH0 A;  1J4I A;  3ARO A;  5E65 A;  1OGG A;  2RUR A;  1UR8 A;  3RM9 A;  2B5U B;  4DWS D;  2PPP A;  4ZPT R;  4W9P A;  4JFI A;  3O5P A;  3TDB A;  2FDM A;  2F4E A;  4MNJ A;  3CHC A;  4XAK A;  1HKI A;  2G41 A;  3CHF A;  3GPK A;  2DSZ A;  1HKM A;  2M3O W;  4LGX A;  1E9L A;  2RSE A;  2OFN A;  3RME A;  3IK8 A;  2QF8 A;  5J6E A;  3OOB A;  4W9Q A;  3MDY B;  4U86 A;  3LE4 A;  5HW6 A;  3UQI A;  4DT4 A;  1LL6 A;  2VCD A;  4P8W A;  4MSP A;  1QPL A;  2ESC A;  2ZR4 A;  1EDQ A;  4WIW A;  2XP5 A;  2YSH A;  3GU0 A;  1W9V A;  2YSG A;  2KE0 A;  1IX5 A;  1JVW A;  3WD0 A;  4Q7N A;  2MPH A;  4NSB A;  2YAJ B;  2XPA A;  1LG2 A;  1M5Y A;  1O6I A;  3O5L A;  4JFK A;  1HKJ A;  2DPE A;  2KFW A;  2DT0 A;  2PBC A;  1ZBC A;  3EY6 A;  1ROU A;  3KAI A;  2MNT A;  1Q6H A;  3GTY X;  2XPB A;  2F2D A;  2DT2 A;  2RUD A;  3CGN A;  4MPK A;  2ITK A;  1NH6 A;  2XP6 A;  5E5W A;  1A7X A;  3ARR A;  3BXW A;  3M85 A;  2EZ5 W;  3O5G A;  2XP9 A;  3O5M A;  3WIJ A;  3MQG A;  1ZBW A;  2FAP A;  4J4N A;  4HBO A;  2XP3 A;  3OA5 A;  1GPF A;  2RUQ A;  1B6C A;  4A0U A;  3NRK A;  3JXV A;  1W1T A;  1WAW A;  1F8A B;  3ALF A;  2N87 A;  1EG4 A;  1EG3 A;  4P8X A;  2IUZ A;  3IHZ A;  1OWQ A;  3LUO A;  3PA7 A;  4NNR A;  3O5O A;  3B7X A;  1W9U A;  2JX8 A;  1NWT A;  2YBT A;  4C02 B;  4MAV A;  1EYM A;  5HT1 A;  5DIT A;  2KO7 A;  2YSB A;  2K8I A;  1WMV A;  1D2K A;  3KAC A;  5E66 A;  2E45 A;  4WKA A;  4DWS C;  4ODR A;  5GPG A;  2AOS A;  2PV1 A;  1NWS A;  1TR8 A;  1W1Y A;  1TCO C;  4W5U A;  5DEZ A;  4IT6 A;  1X6N A;  1EIB A;  4J4O A;  4FAP A;  1XHG A;  4Z2I A;  4TW7 A;  1FKR A;  1ZBK A;  5GPR A;  1FKB A;  1H0I A;  2DG9 A;  2P4V A;  3UQA A;  1ZBV A;  2AWG A;  5HBF A;  4DRJ A;  3W4R A;  1PIN A;  4W9O A;  4L3N A;  1FAP A;  4P8U A;  1NWU A;  1W26 A;  5I98 A;  3O5K A;  4ZS6 A;  1FKI A;  1R9H A;  2DT3 A;  4S3J A;  1FKF A;  4A0T A;  1LL7 A;  1NSG A;  4MNM A;  4S3K A;  4N19 A;  3TCZ A;  4LAV A;  1FFR A;  3MCB A;  1VF8 A;  3UI6 A;  2DK1 A;  1HJX A;  2WAE A;  1U79 A;  1RP5 A;  3AS1 A;  3O5F A;  4O2T A;  5HWB A;  1HJW A;  4QZV B;  4LAY A;  2RUC A;  3MCB B;  4Z2K A;  3AQU A;  2DT1 A;  4Z2J A;  1W1V A;  1Q1C A;  5AHT A;  4ML4 A;  1SR0 A;  3PR9 A;  4DZ3 A;  2EUL A;  5DIU A;  1N1A A;  2WM0 A;  1W9P A;  4MGV A;  3FSB A;  4URI A;  4WKH A;  4KQZ A;  3ARQ A;  3IKG A;  1JCH B;  1D6O A;  2G8Z A;  1ZU8 A;  3WQV A;  3JYJ A;  2YSI A;  3ARV A;  1FKS A;  3CNG A;  5U47 A;  1FKH A;  2KI3 A;  3KZ7 A;  2M1I A;  4IQC A;  3ARS A;  2YBU A;  4ZPW R;  5HTG A;  5BXJ A;  2DG3 A;  2LKN A;  3ARX A;  2XP7 A;  4DH0 A;  1JMQ A;  4TW6 A;  4G2P A;  4JYS A;  3ALG A;  3KAD A;  3NTP A;  2Y78 A;  3ARW A;  4GIV A;  2WLZ A;  1WR7 A;  5B8I C;  3O5D A;  3CHE A;  2F23 A;  3PRA A;  5CQ2 A;  2LGO A;  1RD6 A;  2JXW A;  1BKF A;  4UDM A;  4DZ2 A;  2ZQU A;  4WK9 A;  3PQH A;  3O5Q A;  4R5E A;  3UF8 A;  2WK2 A;  4P8V A;  3ART A;  1Y0O A;  2KXQ A;  3ARY A;  3CGM A;  3B9D A;  4JFM A;  1E6N A;  3PRB A;  4MNL A;  3WD4 A;  2ZQV A;  2ETN A;  1PBK A;  1ZL1 A;  5E64 A;  4U84 A;  2M08 A;  1LG1 A;  4ODK A;  1T11 A;  2DJY A;  2ZR6 A;  4ITZ A;  2VN1 A;  3AS0 A;  2BA1 A;  3RFW A;  2OWO A;  2DSU A;  1GRJ A;  3RM4 A;  2FKE A;  2PV3 A;  4DRK A;  2LPV A;  3CHD A;  4IPX A;  2M2A A;  5GQB A;  1Q6U A;  3FAP A;  1E6R A;  1UR9 A;  4GGQ A;  4QIB A;  3ARU A;  4E5R A;  1K9T A;  4REX A;  2LJ4 A;  2PI6 A;  4QT2 A;  2MLX A;  2WLY A;  2JZV A;  4DRN A;  2XP8 A;  4IT4 A;  4DRI A;  4ODO A;  1FJD A;  4PTM A;  3M7N A;  1ITX A;  1GOI A;  1LQ0 A;  1FFQ A;  4TNS A;  1J6Y A;  1EQ3 A;  3AS2 A;  1BL4 A;  3O5J A;  2YSF A;  5DIV A;  1E44 A;  4HAR A;  4ZPV R;  4DWS B;  3O5I A;  2DSW A;  1J4R A;  2F21 A;  3RGC A;  3FY1 A;  5HW8 A;  1GUV A;  4DRO A;  4MTV A;  2PPN A;  3B9E A;  3CZ8 A;  1ZCN A;  3ODK A;  1HJV A;  1FKT A;  1JND A;  2ZAJ A;  4ODN A;  2Y8N B;  4L72 B;  5HKG A;  1HKK A;  1P5Q A;  1I5H W;  2DG4 A;  2JV4 A;  3KAB A;  1JNT A;  2UZ5 A;  3WD1 A;  1L1P A;  1EHN A;  4KR0 B;  1YAT A;  3ARP A;  3WD2 A;  1WNO A;  3LKX A;  4JFJ A;  1XRV A;  4G50 A;  1F40 A;  4DIP A;  1Q6I A;  2A3C A;  4ODP A;  2MF9 A;  3RM8 A;  4QT3 A;  5DF0 A;  1KT0 A;  5HWC A;  4TW8 A;  3WL1 A;  3EIP A;  2A3B A;  3UQB A;  3JYM A;  4BF8 A;  1FKK A;  2M8I A;  1D7J A;  3BMB A;  2MLZ A;  1TK7 A;  3I6C A;  2JMF A;  2ZR5 A;  3L4H A;  3B8S A;  3KAG A;  1C9H A;  2A3A A;  2O92 A;  2KGJ A;  2ZQS A;  2RE3 A;  4MNK A;  4WKF A;  3WD3 A;  4DRQ A;  3MQH A;  1NMW A;  4LAW A;  3O5R A;  4HBE A;  3B9A A;  4DRM A;  2L4J A;  3WL0 A;  1D7H A;  4ODQ A;  1E6Z A;  3AS3 A;  4DWS A;  2DWV A;  2RQS A;  1KFW A;  1JNS A;  1NMV A;  5E62 A;  5HW7 A;  3G6M A;  4U85 A;  3FS8 A;  3UI5 A;  2OLH A;  2KR7 A;  4DRP A;  3NI6 A;  5D75 A;  1X6L A;  2L2S A;  4Z2G A;  3KAF A;  1KT1 A;  1WB0 A;  3QOK A;  1ZB5 A;  4NZC A;  2MLY A;  2A3E A;  4GLX A;  5DO2 A;  2PN0 A;  5HUA A;  4WJX A;  3LKX B;  4ODL A;  1FKJ A;  1FKG A;  3G6L A;  4FN2 A;  3TC5 A;  2IF4 A;  2DMV A;  4LAX A;  1SYT A;  2MDI A;  2WAD A;  1FKD A;  4AY1 A;  2DK7 A;  4R0X A;  3WQW A;  1ZK6 A;  1E15 A;  1ROT A;  2PPO A; 
#chains in the Genus database with same CATH homology
 3H9R B;  4TYO A;  1FKL A;  4Q22 A;  3KAH A;  2B31 A;  2D9F A;  4IQ2 A;  2Q5A A;  1O6W A;  1CTN A;  1QPF A;  3PRD A;  2QRV A;  1D7I A;  3IKD A;  2ZQT A;  1K9R A;  1OGB A;  1JNE A;  3O5E A;  3VAW A;  2O9O A;  1FD9 A;  3ARZ A;  1TFV A;  3WKZ A;  1NWR A;  1FLC A;  4Z2L A;  1J4H A;  1LJY A;  4ODM A;  2M8J A;  3FSC A;  1HXV A;  4JFL A;  1YW5 A;  5JH8 A;  2PV2 A;  3FXY A;  2DSV A;  3KCE A;  4DRH A;  1E6P A;  3CH9 A;  2XP4 A;  2LAJ A;  3UI4 A;  1H0G A;  4Z2H A;  1LL4 A;  1QZ2 A;  1W1P A;  4TX0 A;  1K9Q A;  3WH0 A;  1J4I A;  3ARO A;  5E65 A;  1OGG A;  2RUR A;  1UR8 A;  3RM9 A;  4DWS D;  2PPP A;  4ZPT R;  4W9P A;  4JFI A;  3O5P A;  3TDB A;  2FDM A;  2F4E A;  4MNJ A;  3CHC A;  4XAK A;  1HKI A;  2G41 A;  3CHF A;  3GPK A;  2DSZ A;  1HKM A;  2M3O W;  4LGX A;  1E9L A;  2RSE A;  2OFN A;  3RME A;  3IK8 A;  2QF8 A;  5J6E A;  3OOB A;  4W9Q A;  3MDY B;  4U86 A;  3LE4 A;  5HW6 A;  3UQI A;  4DT4 A;  1LL6 A;  2VCD A;  4P8W A;  4MSP A;  1QPL A;  2ESC A;  2ZR4 A;  1EDQ A;  4WIW A;  2XP5 A;  2YSH A;  1W9V A;  2YSG A;  2KE0 A;  1IX5 A;  1JVW A;  3WD0 A;  4Q7N A;  2MPH A;  4NSB A;  2YAJ B;  2XPA A;  1LG2 A;  1M5Y A;  1O6I A;  3O5L A;  4JFK A;  1HKJ A;  2DPE A;  2KFW A;  2DT0 A;  2PBC A;  1ZBC A;  3EY6 A;  1ROU A;  3KAI A;  2MNT A;  1Q6H A;  2XPB A;  2F2D A;  2DT2 A;  2RUD A;  3CGN A;  4MPK A;  2ITK A;  1NH6 A;  2XP6 A;  5E5W A;  1A7X A;  3ARR A;  3BXW A;  3M85 A;  2EZ5 W;  3O5G A;  2XP9 A;  3O5M A;  3WIJ A;  3MQG A;  1ZBW A;  2FAP A;  4J4N A;  4HBO A;  2XP3 A;  3OA5 A;  1GPF A;  2RUQ A;  1B6C A;  4A0U A;  3NRK A;  3JXV A;  1W1T A;  1WAW A;  1F8A B;  3ALF A;  2N87 A;  1EG4 A;  1EG3 A;  4P8X A;  2IUZ A;  3IHZ A;  1OWQ A;  3LUO A;  3PA7 A;  4NNR A;  3O5O A;  3B7X A;  1W9U A;  2JX8 A;  1NWT A;  2YBT A;  4C02 B;  4MAV A;  1EYM A;  5HT1 A;  5DIT A;  2KO7 A;  2YSB A;  2K8I A;  1WMV A;  1D2K A;  3KAC A;  5E66 A;  2E45 A;  4WKA A;  4DWS C;  4ODR A;  5GPG A;  2AOS A;  2PV1 A;  1NWS A;  1TR8 A;  1W1Y A;  1TCO C;  4W5U A;  5DEZ A;  4IT6 A;  1X6N A;  1EIB A;  4J4O A;  4FAP A;  1XHG A;  4Z2I A;  4TW7 A;  1FKR A;  1ZBK A;  5GPR A;  1FKB A;  1H0I A;  2DG9 A;  3UQA A;  1ZBV A;  2AWG A;  5HBF A;  4DRJ A;  3W4R A;  1PIN A;  4W9O A;  4L3N A;  1FAP A;  4P8U A;  1NWU A;  1W26 A;  5I98 A;  3O5K A;  4ZS6 A;  1FKI A;  1R9H A;  2DT3 A;  4S3J A;  1FKF A;  4A0T A;  1LL7 A;  1NSG A;  4MNM A;  4S3K A;  4N19 A;  3TCZ A;  4LAV A;  1FFR A;  3MCB A;  1VF8 A;  3UI6 A;  2DK1 A;  1HJX A;  2WAE A;  1U79 A;  1RP5 A;  3AS1 A;  3O5F A;  4O2T A;  5HWB A;  1HJW A;  4QZV B;  4LAY A;  2RUC A;  3MCB B;  4Z2K A;  3AQU A;  2DT1 A;  4Z2J A;  1W1V A;  1Q1C A;  5AHT A;  4ML4 A;  1SR0 A;  3PR9 A;  4DZ3 A;  5DIU A;  1N1A A;  2WM0 A;  1W9P A;  4MGV A;  3FSB A;  4URI A;  4WKH A;  4KQZ A;  3ARQ A;  3IKG A;  1D6O A;  2G8Z A;  1ZU8 A;  3WQV A;  3JYJ A;  2YSI A;  3ARV A;  1FKS A;  3CNG A;  5U47 A;  1FKH A;  2KI3 A;  3KZ7 A;  2M1I A;  4IQC A;  3ARS A;  2YBU A;  4ZPW R;  5HTG A;  5BXJ A;  2DG3 A;  2LKN A;  3ARX A;  2XP7 A;  4DH0 A;  1JMQ A;  4TW6 A;  4G2P A;  4JYS A;  3ALG A;  3KAD A;  3NTP A;  2Y78 A;  3ARW A;  4GIV A;  2WLZ A;  1WR7 A;  5B8I C;  3O5D A;  3CHE A;  3PRA A;  5CQ2 A;  2LGO A;  1RD6 A;  2JXW A;  1BKF A;  4DZ2 A;  2ZQU A;  4WK9 A;  3PQH A;  3O5Q A;  4R5E A;  3UF8 A;  2WK2 A;  4P8V A;  3ART A;  1Y0O A;  2KXQ A;  3ARY A;  3CGM A;  3B9D A;  4JFM A;  1E6N A;  3PRB A;  4MNL A;  3WD4 A;  2ZQV A;  1PBK A;  1ZL1 A;  5E64 A;  4U84 A;  2M08 A;  1LG1 A;  4ODK A;  1T11 A;  2DJY A;  2ZR6 A;  4ITZ A;  2VN1 A;  3AS0 A;  2BA1 A;  3RFW A;  2OWO A;  2DSU A;  3RM4 A;  2FKE A;  2PV3 A;  4DRK A;  2LPV A;  3CHD A;  4IPX A;  2M2A A;  5GQB A;  1Q6U A;  3FAP A;  1E6R A;  1UR9 A;  4GGQ A;  4QIB A;  3ARU A;  4E5R A;  1K9T A;  4REX A;  2LJ4 A;  2PI6 A;  4QT2 A;  2MLX A;  2WLY A;  2JZV A;  4DRN A;  2XP8 A;  4IT4 A;  4DRI A;  4ODO A;  1FJD A;  4PTM A;  3M7N A;  1ITX A;  1GOI A;  1LQ0 A;  1FFQ A;  4TNS A;  1J6Y A;  1EQ3 A;  3AS2 A;  1BL4 A;  3O5J A;  2YSF A;  5DIV A;  4HAR A;  4ZPV R;  4DWS B;  3O5I A;  2DSW A;  1J4R A;  2F21 A;  3RGC A;  3FY1 A;  5HW8 A;  1GUV A;  4DRO A;  4MTV A;  2PPN A;  3B9E A;  3CZ8 A;  1ZCN A;  3ODK A;  1HJV A;  1FKT A;  1JND A;  2ZAJ A;  4ODN A;  2Y8N B;  4L72 B;  5HKG A;  1HKK A;  1P5Q A;  1I5H W;  2DG4 A;  2JV4 A;  3KAB A;  1JNT A;  2UZ5 A;  3WD1 A;  1L1P A;  1EHN A;  4KR0 B;  1YAT A;  3ARP A;  3WD2 A;  1WNO A;  3LKX A;  4JFJ A;  1XRV A;  4G50 A;  1F40 A;  4DIP A;  1Q6I A;  2A3C A;  4ODP A;  2MF9 A;  3RM8 A;  4QT3 A;  5DF0 A;  1KT0 A;  5HWC A;  4TW8 A;  3WL1 A;  2A3B A;  3UQB A;  3JYM A;  4BF8 A;  1FKK A;  2M8I A;  1D7J A;  3I6C A;  2MLZ A;  1TK7 A;  2JMF A;  2ZR5 A;  3L4H A;  3B8S A;  3KAG A;  1C9H A;  2A3A A;  2O92 A;  2KGJ A;  2ZQS A;  2RE3 A;  4MNK A;  4WKF A;  3WD3 A;  4DRQ A;  3MQH A;  1NMW A;  4LAW A;  3O5R A;  4HBE A;  3B9A A;  4DRM A;  2L4J A;  3WL0 A;  1D7H A;  4ODQ A;  1E6Z A;  3AS3 A;  4DWS A;  2DWV A;  2RQS A;  1KFW A;  1JNS A;  1NMV A;  5E62 A;  5HW7 A;  3G6M A;  4U85 A;  3FS8 A;  3UI5 A;  2OLH A;  2KR7 A;  4DRP A;  3NI6 A;  5D75 A;  1X6L A;  2L2S A;  4Z2G A;  3KAF A;  1KT1 A;  1WB0 A;  3QOK A;  1ZB5 A;  4NZC A;  2MLY A;  2A3E A;  4GLX A;  5DO2 A;  5HUA A;  4WJX A;  3LKX B;  4ODL A;  1FKJ A;  1FKG A;  3G6L A;  4FN2 A;  3TC5 A;  2IF4 A;  2DMV A;  4LAX A;  1SYT A;  2MDI A;  2WAD A;  1FKD A;  4AY1 A;  2DK7 A;  4R0X A;  3WQW A;  1ZK6 A;  1E15 A;  1ROT A;  2PPO A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...