2JV4A

Structure characterisation of pina ww domain and comparison with other group iv ww domains, pin1 and ess1
Total Genus 3
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
3
sequence length
53
structure length
53
Chain Sequence
SMVNTGLPAGWEVRHSNSKNLPYYFNPATRESRWEPPADTDMETLKMYMATYH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Isomerase
molecule keywords Peptidyl-prolyl cis/trans isomerase
publication title Structural characterisation of PinA WW domain and a comparison with other Group IV WW domains, Pin1 and Ess1
pubmed doi rcsb
source organism Emericella nidulans
total genus 3
structure length 53
sequence length 53
ec nomenclature ec 5.2.1.8: Peptidylprolyl isomerase.
pdb deposition date 2007-09-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00397 WW WW domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.20.70.10 Mainly Beta Single Sheet Ubiquitin Ligase Nedd4; Chain: W; Ubiquitin Ligase Nedd4; Chain: W; 2jv4A00
2XPAA 2ZAJA 2JMFA 2YSIA 2DK7A 2YSFA 2ZQSA 2LAJA 1K9RA 2XP8A 5AHTA 2L4JA 3KABA 2XP9A 2EZ5W 1I5HW 2XPBA 2XP3A 3CNGA 2Q5AA 3KAFA 1NMVA 1F8AB 4E5RA 2KXQA 2XP6A 3TC5A 2RE3A 2JX8A 3KAIA 2XP5A 2DMVA 2M3OW 2ZQUA 2ZQVA 3KAGA 4REXA 2BA1A 3TCZA 1EG4A 3KADA 1PINA 2ITKA 3NTPA 1WMVA 3WH0A 1TK7A 2ZR5A 3ODKA 4U84A 3M7NA 3KAHA 2ZR6A 2MDIA 2ZR4A 1K9QA 2F21A 1YW5A 1WR7A 3M85A 2ZQTA 2JXWA 4U86A 2YSGA 2M8IA 3TDBA 2DJYA 2JV4A 2YSBA 2YSHA 1JMQA 1ZCNA 4U85A 2XP7A 5CQ2A 3L4HA 1EG3A 3OOBA 1O6WA 2E45A 2DWVA 2M8JA 2XP4A 2DK1A 3KCEA 3LE4A 4QIBA
chains in the Genus database with same CATH superfamily
2XPAA 2ZAJA 2JMFA 2YSIA 2DK7A 1TR8A 2YSFA 2ZQSA 2LAJA 1K9RA 2XP8A 5E66A 4GLXA 5AHTA 2L4JA 3KABA 2XP9A 3LKXB 2EZ5W 1I5HW 2XPBA 2XP3A 3CNGA 2Q5AA 3KAFA 1NMVA 1F8AB 4E5RA 2WADA 2KXQA 3MCBB 2XP6A 3TC5A 2RE3A 2JX8A 3KAIA 3FSBA 2XP5A 2DMVA 2M3OW 3FS8A 2ZQUA 5E62A 2ZQVA 2YAJB 3MQHA 3KAGA 4REXA 2BA1A 3TCZA 1EG4A 3KADA 1PINA 5E5WA 2WAEA 2ITKA 3NTPA 1WMVA 1FLCA 3WH0A 2OWOA 1TK7A 2ZR5A 3ODKA 4U84A 3M7NA 3KAHA 2ZR6A 2MDIA 2ZR4A 1K9QA 2F21A 5U47A 1YW5A 1WR7A 2QRVA 3M85A 2ZQTA 1RP5A 2JXWA 4U86A 2YSGA 2M8IA 3TDBA 2DJYA 2JV4A 3MQGA 2YSBA 2YSHA 1JMQA 1ZCNA 4U85A 2XP7A 3FSCA 5CQ2A 3L4HA 1EG3A 3OOBA 1O6WA 4A0TA 2E45A 2DWVA 5E65A 2M8JA 2XP4A 3LKXA 4A0UA 2DK1A 3KCEA 5E64A 3LE4A 4QIBA 3PQHA 2Y8NB 3MCBA
chains in the Genus database with same CATH topology
2XPAA 2ZAJA 2JMFA 2YSIA 2DK7A 1TR8A 2YSFA 2ZQSA 2LAJA 1K9RA 2XP8A 5E66A 4GLXA 5AHTA 2L4JA 3KABA 2XP9A 3LKXB 2EZ5W 1I5HW 2XPBA 2XP3A 3CNGA 2Q5AA 3KAFA 1NMVA 1F8AB 4E5RA 2WADA 2KXQA 3MCBB 2XP6A 3TC5A 2RE3A 2JX8A 3KAIA 3FSBA 2XP5A 2DMVA 2M3OW 3FS8A 2ZQUA 5E62A 2ZQVA 2YAJB 3MQHA 3KAGA 4REXA 2BA1A 3TCZA 1EG4A 3KADA 1PINA 5E5WA 2WAEA 2ITKA 3NTPA 1WMVA 1FLCA 3WH0A 2OWOA 1TK7A 2ZR5A 3ODKA 4U84A 3M7NA 3KAHA 2ZR6A 2MDIA 2ZR4A 1K9QA 2F21A 5U47A 1YW5A 1WR7A 2QRVA 3M85A 2ZQTA 1RP5A 2JXWA 4U86A 2YSGA 2M8IA 3TDBA 2DJYA 2JV4A 3MQGA 2YSBA 2YSHA 1JMQA 1ZCNA 4U85A 2XP7A 3FSCA 5CQ2A 3L4HA 1EG3A 3OOBA 1O6WA 4A0TA 2E45A 2DWVA 5E65A 2M8JA 2XP4A 3LKXA 4A0UA 2DK1A 3KCEA 5E64A 3LE4A 4QIBA 3PQHA 2Y8NB 3MCBA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2XPA A;  2ZAJ A;  2JMF A;  2YSI A;  2DK7 A;  2YSF A;  2ZQS A;  2LAJ A;  1K9R A;  2XP8 A;  5AHT A;  2L4J A;  3KAB A;  2XP9 A;  2EZ5 W;  1I5H W;  2XPB A;  2XP3 A;  3CNG A;  2Q5A A;  3KAF A;  1NMV A;  1F8A B;  4E5R A;  2KXQ A;  2XP6 A;  3TC5 A;  2RE3 A;  2JX8 A;  3KAI A;  2XP5 A;  2DMV A;  2M3O W;  2ZQU A;  2ZQV A;  3KAG A;  4REX A;  2BA1 A;  3TCZ A;  1EG4 A;  3KAD A;  1PIN A;  2ITK A;  3NTP A;  1WMV A;  3WH0 A;  1TK7 A;  2ZR5 A;  3ODK A;  4U84 A;  3M7N A;  3KAH A;  2ZR6 A;  2MDI A;  2ZR4 A;  1K9Q A;  2F21 A;  1YW5 A;  1WR7 A;  3M85 A;  2ZQT A;  2JXW A;  4U86 A;  2YSG A;  2M8I A;  3TDB A;  2DJY A;  2JV4 A;  2YSB A;  2YSH A;  1JMQ A;  1ZCN A;  4U85 A;  2XP7 A;  5CQ2 A;  3L4H A;  1EG3 A;  3OOB A;  1O6W A;  2E45 A;  2DWV A;  2M8J A;  2XP4 A;  2DK1 A;  3KCE A;  3LE4 A;  4QIB A; 
#chains in the Genus database with same CATH topology
 2XPA A;  2ZAJ A;  2JMF A;  2YSI A;  2DK7 A;  1TR8 A;  2YSF A;  2ZQS A;  2LAJ A;  1K9R A;  2XP8 A;  5E66 A;  4GLX A;  5AHT A;  2L4J A;  3KAB A;  2XP9 A;  3LKX B;  2EZ5 W;  1I5H W;  2XPB A;  2XP3 A;  3CNG A;  2Q5A A;  3KAF A;  1NMV A;  1F8A B;  4E5R A;  2WAD A;  2KXQ A;  3MCB B;  2XP6 A;  3TC5 A;  2RE3 A;  2JX8 A;  3KAI A;  3FSB A;  2XP5 A;  2DMV A;  2M3O W;  3FS8 A;  2ZQU A;  5E62 A;  2ZQV A;  2YAJ B;  3MQH A;  3KAG A;  4REX A;  2BA1 A;  3TCZ A;  1EG4 A;  3KAD A;  1PIN A;  5E5W A;  2WAE A;  2ITK A;  3NTP A;  1WMV A;  1FLC A;  3WH0 A;  2OWO A;  1TK7 A;  2ZR5 A;  3ODK A;  4U84 A;  3M7N A;  3KAH A;  2ZR6 A;  2MDI A;  2ZR4 A;  1K9Q A;  2F21 A;  5U47 A;  1YW5 A;  1WR7 A;  2QRV A;  3M85 A;  2ZQT A;  1RP5 A;  2JXW A;  4U86 A;  2YSG A;  2M8I A;  3TDB A;  2DJY A;  2JV4 A;  3MQG A;  2YSB A;  2YSH A;  1JMQ A;  1ZCN A;  4U85 A;  2XP7 A;  3FSC A;  5CQ2 A;  3L4H A;  1EG3 A;  3OOB A;  1O6W A;  4A0T A;  2E45 A;  2DWV A;  5E65 A;  2M8J A;  2XP4 A;  3LKX A;  4A0U A;  2DK1 A;  3KCE A;  5E64 A;  3LE4 A;  4QIB A;  3PQH A;  2Y8N B;  3MCB A; 
#chains in the Genus database with same CATH homology
 2XPA A;  2ZAJ A;  2JMF A;  2YSI A;  2DK7 A;  1TR8 A;  2YSF A;  2ZQS A;  2LAJ A;  1K9R A;  2XP8 A;  5E66 A;  4GLX A;  5AHT A;  2L4J A;  3KAB A;  2XP9 A;  3LKX B;  2EZ5 W;  1I5H W;  2XPB A;  2XP3 A;  3CNG A;  2Q5A A;  3KAF A;  1NMV A;  1F8A B;  4E5R A;  2WAD A;  2KXQ A;  3MCB B;  2XP6 A;  3TC5 A;  2RE3 A;  2JX8 A;  3KAI A;  3FSB A;  2XP5 A;  2DMV A;  2M3O W;  3FS8 A;  2ZQU A;  5E62 A;  2ZQV A;  2YAJ B;  3MQH A;  3KAG A;  4REX A;  2BA1 A;  3TCZ A;  1EG4 A;  3KAD A;  1PIN A;  5E5W A;  2WAE A;  2ITK A;  3NTP A;  1WMV A;  1FLC A;  3WH0 A;  2OWO A;  1TK7 A;  2ZR5 A;  3ODK A;  4U84 A;  3M7N A;  3KAH A;  2ZR6 A;  2MDI A;  2ZR4 A;  1K9Q A;  2F21 A;  5U47 A;  1YW5 A;  1WR7 A;  2QRV A;  3M85 A;  2ZQT A;  1RP5 A;  2JXW A;  4U86 A;  2YSG A;  2M8I A;  3TDB A;  2DJY A;  2JV4 A;  3MQG A;  2YSB A;  2YSH A;  1JMQ A;  1ZCN A;  4U85 A;  2XP7 A;  3FSC A;  5CQ2 A;  3L4H A;  1EG3 A;  3OOB A;  1O6W A;  4A0T A;  2E45 A;  2DWV A;  5E65 A;  2M8J A;  2XP4 A;  3LKX A;  4A0U A;  2DK1 A;  3KCE A;  5E64 A;  3LE4 A;  4QIB A;  3PQH A;  2Y8N B;  3MCB A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...