2QRVA

Structure of dnmt3a-dnmt3l c-terminal domain complex
Total Genus 70
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
70
sequence length
286
structure length
272
Chain Sequence
PAEKRKPIRVLSLFDGIATGLLVLKDLGIQVDRYIASEVCEDSITVGMVRHQGKIMYVGDVRSVTQKHIQEWGPFDLVIGGSPCNDLSIVNPARKGLYEGTGRLFFEFYRLLHDARPKEGDDRPFFWLFENVVAMGVSDKRDISRFLESNPVMIDAKEVSAAHRARYFWGNLPGMNRPLASTVNDKLELQECLEHGRIAKFSKVRQHFPVFMNEKEDILWCTEMERVFGFPVHYTDVSNMSRLARQRLLGRSWSVPVIRHLFAPLKEYFACV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords DNA (cytosine-5)-methyltransferase 3A
publication title Structure of Dnmt3a bound to Dnmt3L suggests a model for de novo DNA methylation.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase/transferase regulator
total genus 70
structure length 272
sequence length 286
chains with identical sequence D, E, H
ec nomenclature ec 2.1.1.37: DNA (cytosine-5-)-methyltransferase.
pdb deposition date 2007-07-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00145 DNA_methylase C-5 cytosine-specific DNA methylase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.20.70.90 Mainly Beta Single Sheet Ubiquitin Ligase Nedd4; Chain: W; Ubiquitin Ligase Nedd4; Chain: W; 2qrvA02
3.40.50.150 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Vaccinia Virus protein VP39 2qrvA01
1HNNA 1L1EA 5FTWA 1F38A 2AVNA 1WXWA 4EKIA 3HCCA 1X1DA 3DOUA 3GRYA 1D2GA 4YUZA 4HRAA 1ZKDA 4M7RA 3SGLA 3ER8A 2ZW9A 2AN4A 3EMBA 3KR0A 1R00A 4YUVA 2YXLA 3Q7EA 2BR5A 1JSZA 4G56A 3LDFA 4DCMA 2PT6A 1WG8A 4UOEA 3FUTA 3HCAA 4BY9E 4YMGA 4GOLD 5CVUA 2OB2A 5GP1A 1I1NA 3B3GA 5FQNA 3B3JA 5C9ZA 1JG4A 2CMHA 2P3QA 5E8RA 3TFWA 3B5IA 3PB3A 1FP1D 4ATNA 2QYOA 2QRVB 4GF5A 5C0OE 1X1BA 1R74A 3HVJA 3GRRA 2OZVA 4X41A 3T7RA 4FSXA 4DCGA 2IBSA 3GCZA 5T64A 1L3BA 2P7HA 1VQ1A 3EVAA 4IWNA 3GRVA 4E2WA 3OZRA 4XCXA 3DTNA 3P9IA 1BHJA 1ZQ9A 3KQYA 2H11A 5D1HA 4BP3A 4YMHA 9MHTA 1YZHA 3LECA 1DCTA 1WY7A 2B78A 3KPYA 4P7FA 4RVGA 4AZTA 2PV0A 1SG9A 2FRXA 4HTFA 4RTSA 3REOA 1YB2A 2ZSUA 5EHGA 5U4XA 4C07A 3CBGA 4C08A 4ER3A 4L7VA 2GA9A 3DXXA 2JHPA 3GJYA 1VPTA 4KW7A 3LCUA 2P41A 3G7UA 3LDUA 3LCVB 2PWYA 1I9GA 2EX4A 2ONYA 2PXCA 4RV9A 5FA8A 2JG3A 4ER5A 4EQZA 2EG5A 1XDUA 3CJQA 3B89A 5FHQA 3WSTA 4QTUB 4RWZA 2AN5A 1FP2A 2IP2A 5K09A 5EOVA 2V74B 5EMLA 4QPNA 4PYKA 3C6KA 5DM2A 3DMGA 1JQ3A 3P71T 3P2IA 5CVJA 5DT2A 4F85A 2NXJA 2NP7A 2PXAA 3GIWA 4R8SA 1FBNA 3M6UA 4GOMD 4CKCA 4QDJA 4AX8A 2HV9A 1KHHA 3SVZA 2YTZA 3A26A 4PYIA 3ERCA 4M37A 4KDRA 1RI5A 5HIKA 2PX5A 4BLUA 3DMFA 5FULA 4QQNA 4C03A 2EFJA 2B3TA 3G8BA 4CXMA 3E23A 3VC2A 2P3LA 2YX1A 1U2ZA 3DULA 3JWHA 2CMGA 3KQTA 5E9QA 3FUXA 5ERGB 1P91A 3UA4A 4AUKA 4DQ0A 5K0EA 4DA4A 2ZWAA 1O9HA 2PGXA 3FPJA 3LDGA 2XVAA 2ZIFA 5LR6A 2VDVE 2AOWA 4CKBA 1XDSA 5HILA 5LQAA 5E1DA 2PKWA 5E2BA 4QPPA 2CKDA 2ESRA 3C3PA 1NT2A 2JHCA 3EVGA 1IY9A 1SUIA 2IDKA 3R3HA 3KHKA 4U7TB 5DXJA 3JWJA 3MQ2A 1NE2A 5EEHA 5KQSA 1XXLA 3P9CA 2ADMA 2I6GA 3LPMA 2VZ9A 4RTRA 4CWAA 1O54A 3UJ7A 5BP7A 1YF3A 1EJ0A 4E33A 3SSMA 2OKCA 2BM9A 3DR5A 4X61A 3OE4A 4HC4A 3NWBA 1OR8A 5EVJA 4R05A 4BLVA 2C7OA 1R8YA 3LHDA 2IBTA 4PWYA 5E1BA 3QV2A 5K8VA 1JG2A 4A6EA 2ZBQA 2P35A 2FPOA 1KIAA 2C7PA 2FCAA 2OY0A 4H0NA 3E7PA 3OCJA 4YV1A 4ER6A 3RW9A 1DL5A 1JTFA 4XUDA 2UYHA 10MHA 1RJFA 2G70A 2ZBRA 3CJTA 4F84A 2IH4A 3FUUA 2ZLBA 1TW3A 3NVKI 4PIMA 4EK9A 1G55A 1QANA 2JHAA 4DMGA 5CVDA 2P1DA 3C3YA 3H2BA 4E32A 2AOTB 2I9KA 1KP9A 3DP7A 3SR4A 5FCDA 3D2LA 3PTAA 3NJRA 3NDJA 3MAGA 3KQVA 2FK8A 3RIEA 2ZIEA 2GB4A 5E1MA 3FPEA 5HOQA 3EPPA 3MTIA 3DH0A 3G2PA 1KR5A 2P3OA 3FTEA 3C0KA 3KQPA 3EVBA 3I9FA 4R8RA 1KPHA 3DXZA 4OQEA 3CVOA 1RI4A 4MQ4A 4E31A 2JH9A 4CTKA 2XYRA 3R24A 2O07A 1FPQA 1O9GA 3PFHA 5DTRA 5FA5A 4Z2YA 1G8SA 1VP3A 2PX4A 4KIFA 4LG1A 1BKYA 2A14A 3THSA 2HR1A 2WK1A 2G1PA 2ZBPA 3OFJA 3OU6A 3I53A 3P8ZA 3UWPA 1YFJA 3VYWA 1NV9A 2BR3A 3PX3A 4MTLA 4HSGA 2FYTA 1M6EX 3LSTA 4GBED 2C7QA 4MIKA 4HGZA 3IYLW 3HVHA 3G2MA 3FYCA 2YQZA 3M6XA 1R6AA 3ELYA 3KU1A 4QDKA 3UA3A 2ONZA 2PX2A 1D2CA 2AOVA 3V8VA 5EG5A 4HG2A 2ZVJA 5DTMA 3P97A 4GC5A 3IV6A 5P8WA 2IIPA 2ERCA 3FPGA 4GOND 3KR2A 5DRYA 2JH8A 1NBHA 2Y1XA 2GH1A 2V7EA 3DLIA 1XCJA 1PJZA 3FUWA 3HA5A 4OA5A 5GIOE 5CIYA 3O7WA 3LBYA 4ER0A 4V0RA 5LQRA 2G71A 2QY6A 2PSSA 3M33A 3HP7A 5DLYA 5LQCA 4P7GA 5LQNA 3UJ6A 1EAMA 1BC5A 3GNLA 4OA8A 4FP9A 5DWQA 4PINA 2UYOA 3OZSA 4HTFB 2Y1WA 1H1DA 4DM3A 5E9WA 2EJTA 1YZ3A 4O29A 5F2OA 4PYNA 2QM3A 1B42A 2I62A 4XUEA 5GIPE 3OU7A 3SM3A 1SQGA 3OE5A 1R8XA 3KKZA 4FR0A 3T0IA 3I5UA 3E8SA 1Z3CA 2PLWA 2VDWA 4X60A 4RTPA 5K0BA 4XUCA 4YV0A 3M6WA 1D2HA 2B9EA 2XVMA 3KR1A 5DXAA 3ID6C 3SMQA 3VSEA 3IEIA 4EKGA 5EC8A 4YUWA 1NKVA 4QVGA 5KQRA 3MERA 5FADA 4IV8A 1YFLA 1X1AA 4MHTA 2YR0A 3R9XB 1QAMA 1BOOA 4PCAA 3DXYA 1G6Q1 5DSTA 5DM0A 3R6TA 4IV0A 1UIRA 2O06A 1RI3A 5FUBA 3HVKA 1NW3A 3NDIA 2ZTHA 3EGIA 5E8JA 3BWMA 5E9JA 4RTLA 5K05A 5K0FA 3GU3A 3UBTA 5F2KA 2OYRA 5LQUA 3EGEA 3KQOA 3GO4A 1SKMA 3MB5A 5HIJA 2OB1A 3G5LA 2KW5A 4GOOD 4RTNA 5EZQA 3JWIA 3OU2A 3P9KA 1JG1A 5BW4A 2Z6UA 1HMYA 1KYWA 1UWVA 2P7IA 3G88A 1VL5A 1XCLA 3CGGA 4FS8A 3EVEA 3BKWA 1XTPA 1P1CA 3F4KA 4NECA 3X0DA 4BP1A 1DUSA 2R6ZA 3LL7A 3PX2A 3G2QA 4U7PB 1VP9A 3EVCA 3FRIA 3NMUF 4QQKA 4OBXA 2Z6QA 4FSDA 4ISCA 3TPZA 2GAFA 1NBIA 2JJQA 7MHTA 1YUBA 1JQDA 3ANXA 4P58A 5DM1A 5K01A 3U81A 4PGHA 1Q0TA 5CVVA 4DZRA 1VLMA 5E2AA 5GINE 1RI1A 2BM8A 1QZZA 2WA1A 3AWIA 1IM8A 3G89A 4GQBA 5EHIA 2OPBA 1Y8CA 2QE6A 4KVZA 4RTMA 5K0LA 5EKXA 3ORHA 2ZIGA 3DUWA 3G2OA 4C05A 1X19A 3BKXA 2UZ4A 4MWZA 3CC8A 4OX9Y 1N7JA 2G8NA 3AY0A 3DLCA 3B7PA 3C6MA 3BZBA 5EKUA 4AZSA 4P7JA 2O05A 3HNRA 2VDUE 3I64A 4QTTB 2BH2A 3HEMA 4PYQA 5DTQA 1SVUA 2P8JA 2ZZKA 3FPFA 2O57A 3FZGA 3TM5A 2YXEA 5MHTA 3O4FA 3TR6A 5JR3A 2PWPA 4P7KA 2K4MA 2OXTA 4RSRA 3LKDA 2AOUA 1TW2A 4E70A 5CUQA 1VIDA 2HWKA 5FWDA 4FZVA 5EIWA 1I4WA 3BGDA 2ZWVA 5FWAA 5K0GA 2AVDA 1JTEA 3AXSA 3PS9A 3UJ9A 3KQQA 4GEKA 1V39A 3EEOA 3OFKA 3LGAA 2VS1A 2LD4A 1VBFA 3TM4A 2PVCA 1EG2A 1XDZA 4FGZA 3KPWA 3P9NA 2XYQA 4IKPA 3EVDA 3FTCA 4R6WA 4YV2A 3TQSA 4FT4A 4QVKA 4PNEA 4PYJA 1TPYA 2G72A 5IKMA 2CWWA 5GM1A 3UJAA 4M38A 2ZCJA 4LWPA 4YUYA 2IPXA 5K0JA 1F3LA 4RTOA 4OQDA 4RX1A 2IFTA 3KPUA 3LBFA 1KPGA 3NW9A 3Q87B 5CD1A 2R3SA 4PCLA 4DF3A 1G60A 4RYLA 5KVAA 2QRVA 1R18A 2AR0A 3KPVA 5C1IA 1INLA 4RTKA 5EMKA 2ZZNA 3BWYA 3HVIA 4WXHA 3BWBA 3P2KA 1KPIA 2DPMA 2FK7A 1AF7A 3MGGA 4EMSA 3BT7A 1ZGAA 5DRTA 3VC1A 3MCTA 2WA2A 3NWEA 4GUAA 3EGVA 5HIMA 2C7RA 3BXOA 2YVLA 1NW7A 2ZULA 2IGTA 1WS6A 1ORIA 3QOXA 2OO3A 1MHTA 2AS0A 3DMHA 4RVDA 3GDHA 4PYLA 5CVEA 4PIPA 4E2XA 5BXYA 5KYGA 2ZFUA 5F2NA 3B3FA 3UZUA 3K0BA 3GXOA 3UJCA 4LECA 3T7SA 2AOXA 2ORED 3SSNA 3SX0A 1L3IA 3ELUA 5HEKA 5K03A 1M6YA 3BGVA 2BZGA 4K6MA 4PYOA 5T6BA 3UJDA 3HM2A 3FTFA 3A25A 1KXZA 1NW6A 4RTJA 3ELDA 3FTDA 5GWXA 5BW5A 3AJDA 5DSXA 1ZHFA 5DX0A 3K6RA 4C4AA 4M36A 3G8AA 5H02A 4RVFA 8MHTA 3EMDA 3P2EA 4KIGA 1G8AA 1JR4A 2N47A 3GRUA 1JSXA 1IXKA 2PX8A 3LKZA 3BGIA 1JG3A 3TOSA 1L3CA 2O0LA 3TMAA 1NW5A 5M5BA 1RJEA 2E5WA 2NXEA 4C06A 2GPYA 4FT2A 5K0CA 4E2YA 3ER9A 3SXJA 3M4XA 3HCEA 3GGDA 1G38A 2NYUA 4ZTBA 2NNWB 5B1SA 4WVLA 1EIZA 2PY6A 4A6DA 5ICEA 5JUWA 1QAOA 5G02A 2B25A 5EMMA 5EMJA 5GM2A 3UJ8A 4HH4A 1ORHA 1L9KA 2GS9A 2IDJA 1RI2A 1AV6A 4E2ZA 3S68A 3JWGA 2H1RA 5ICCA 2PBFA 3A7DA 5HZMA 5CCXA 1XVAA 2YUIA 3TKYA 2UYCA 4RTQA 3T7TA 4ER7A 1EQAA 5KS2A 3EVFA 1N7IA 2HNKA 3A27A 3R0QA 3HTXA 1VE3A 3TRKA 3GRZA 4R6XA 3RODA 2P40A 5EGSA 2H00A 5GOZA 3HA7A 1UFKA 5EIFA 3TLJA 3PVCA 2Z6AA 3AXTA 4DKJA 3BUSA 3FPHA 1Q0SA 2CL5A 3FRHA 3LX6A 1EJ6A 4V0QA 3FUVA 3I58A 4AZWA 4CKEA 3BWCA 1N2XA 1M0EA 3UJBA 2Q41A 3IHTA 4RVHA 2VP3A 3LCCA 3NVMB 2PJDA 1NW8A 4X63A 5DPMA 3THRA 2FHPA 5LQJA 1X1CA 2YXDA 3PFGA 5EQJB 3ELWA 5DX1A 4POOA 5IH3A 4F86A 1ZGJA 1P1BA 4KDCA 2NP6A 3PLAE 2B2CA 3CKKA 5DM4A 4GC9A 3TKAA 2GLUA 1MJFA 4B17A 1AQIA 2XYVA 3MTEA 4X1OA 5DX8A 5E1OA 5EPEA 2ZZMA 3KR9A 5EEGA 4PYMA 3KQWA 1QYRA 4EVIA 4HGYA 1KYZA 3QOWA 1T43A 4CTJA 4KWCA 4E30A 1AQJA 5HFJA 3KQSA 3HCBA 1WXXA 3ME5A 2XBMA 5CM2Z 4AZVA 2AN3A 3SSOA 5CCBA 2PT9A 2PXXA 3GWZA 3HCDA 4JXJA 3M70A 5FHRA 4BLWA 1RJDA 5ICGA 3A4TA 4YUXA 1SQFA 3A7EA 3KPJA 4PONA 3UFBA 1XJ5A 2EJUA 3M6VA 1RJGA 2OBFA 2AOTA 1P39A 3PT9A 3EVZA 1PRYA 1FJXA 3G5TA 5FQOA 5ICFA 3HA3A 3OPNA 4PGGA 2HMYB 3CCFA 3FYDA 3L8DA 3CJRA 2IH2A 1QAQA 5HIIA 2HTEA 3E05A 2AOUB 5EZSA 2F8LA 5K0NA 5T67A 3V97A 3KQMA 2NXCA 3OZTA 4LWOA 4Y2HA 3HCFA 2NXNA 3O31A 2AZTA 3MCZA 4Y30A 4KRGA 5D1NA 1NV8A 1WZNA 3NTVA 2BR4A 5LQKA 2DULA 1SUSA 2I7CA 2UYQA 5LSAA 1ZG3A 2IH5A 4OBWA 1JQEA 3MHTA 4C04A 3EEYA
chains in the Genus database with same CATH superfamily
2IBMA 2I7XA 1XU7A 3H42B 3OJOA 5EHXA 1AKMA 4WESA 4C7OA 1N6LA 1WXWA 1ZL0A 5D3KA 4DLYA 4L15A 4CDMA 4R40A 4DS3A 1OPRA 3LD9A 1MAWA 3Q3GE 2GN8A 3GUUA 1Y5NA 5C81A 1PG0A 1ENOA 3DFUA 4KLAA 4EL5A 4Z54A 5C1OA 1G4AE 1I1NA 2WIJA 2NVOA 2B7LA 4HAXA 3PENA 5JV5A 4I1PA 1CY1A 1SXHA 1USIA 4NHEA 1XTUA 2GM5A 4RKFA 1QVWA 2WG0A 4MYCA 3C85A 1L7OA 4BNMA 1M3SA 4Y2UA 4I3GA 1K7YA 3GCZA 1Q1EA 3FVQA 4J0FA 1PSWA 1QKIA 2G40A 1BXGB 1JR3E 3DEIA 3QFTA 2C2WA 5A0FA 2G1AA 1ETUA 1BW9B 1LKZA 2E2WA 2XOXA 2ZDHA 1ODLA 3KCNA 3RGGA 4BP3A 1K27A 2Y4NA 1PVDA 1C80A 1AHIA 1ZH2A 3E22A 2UV8A 2ECOA 3ZWPA 1MQ8B 5ALVA 2EJBA 2DK1A 4L6IA 5I4BA 3CXUA 2J0UB 2BHLA 1GY8A 1X14A 1DXHA 2XQIA 1XTTA 3ISTA 1XZBA 5AJTA 1JWLA 1CUYA 4N5NA 3FWZA 2X23A 3CBGA 3Q5DA 4JENA 5AKZA 3DF7A 4FGJA 3FSBA 3RUAA 4X66B 4HBZA 3VH4A 3ZV6A 1HY3A 2HK7A 4RHFA 1G20A 3PRHA 2DMVA 4L2IA 5KVVA 3KRTA 1NHGA 1EUCA 3Q7SA 2EX4A 4JB2A 4HYTA 3ZHSA 5DM70 3F98A 1J06A 1NNUA 1IN4A 2EG5A 3NHJA 2ZXUA 3T7DA 2OPHA 4GOJA 2ZJFA 1W1UA 5HWSA 2EFYA 2FSVA 3GUZA 3I9V1 2QX9A 4YP6A 1QM5A 3NNSA 1CBUA 5BN3B 2NLOA 4WADA 1KSFX 4TZ6A 3EDCA 2ZJOA 3KYCA 4GOMD 4H7PA 2HDNB 4CKCA 5HW0A 3HJRA 3QLUC 3KWLA 3Q9NA 2PRYA 2RHDA 2YSGA 2VYVA 4TLEA 1OVMA 1HE3A 2UUAB 2YW2A 4OHOA 1EMDA 1PEDA 4KDRA 2ZBEA 4TTJA 3E9CA 3WGZA 2CE2X 1SB8A 2NU7A 4M3NA 4ZDKA 1U94A 1U0GA 3QLVA 4LHWA 3SIWA 1O6FA 3VU0A 1UJ4A 2Y1GA 3G8BA 4KNVA 5L4LA 1EWRA 2QG4A 3OCYA 3Q7PA 1HDGO 1J8QA 4R9VA 4YI3A 1HE2A 2YX1A 2A8YA 2C3MA 4MWGA 4X62B 1NVGA 3DF9A 4RY8A 3VR5H 2A9RA 1W36D 1LW7A 4TV9A 1O9HA 3UTCA 3IPLA 3ZHYA 2IPMA 4MKRA 4HQFA 5L7TA 2ZVPX 1XZFA 5LA6A 5HILA 1IDN1 4A10A 4EA9A 5AOVA 3U7GA 2AEFA 3UK7A 1KGSA 3MHTA 4MHOA 4UARA 2OC9A 4FLMA 2VNKA 4IDEA 1W581 5ITZA 4XE5A 1KO5A 2P9GA 4H7KA 1ISIA 2H7XA 4CW7A 5IDXA 4AJLA 4BTEA 3OO0A 2WWWA 5HKBA 3GPLA 3OOYA 2BGKA 2A35A 2PNFA 4CMJA 3O94A 1C3EA 4JUIA 4LVOA 4DSZA 5B2EA 2CKMA 4E5MA 3TTVA 5LDHA 3WIDA 3AFOA 4OHWA 2DWUA 4CCYA 4DC9A 3FG9A 2YCBA 1SC1A 4OQ4A 5ELXA 3MJHA 2BGTA 3DR5A 4QQFA 4XGQA 5DNWA 1SC6A 3NWBA 2PH7A 1S2OA 1VRWA 4KU4A 1OBVA 1TAQA 3K2EA 1I3LA 4XPIA 4ZARA 3L0BA 3ZGXA 3OCZA 3WFZA 1BVRA 1N6PA 5CCEA 5JDCA 2OVFA 2ZBQA 2CLIB 3JALB 3KKOA 3MWEB 4REQB 5EHQA 4ZOQI 4RETA 2Y66A 3TX6A 4C2UA 4ICIA 2ZJ5A 1P5HA 5M7EA 5HF8A 4HLCA 4OOEA 5MF6A 1P4SA 2ZRBA 3CJTA 1P3JA 3OLXA 4XJSA 1K0FA 3BB1A 2AX4A 4MRNA 2A0UA 1A9XB 1WXHA 1A4RA 3DBHA 4UBNA 1LJUA 2WOOA 4LSZA 2I4IA 4R2XA 1JDVA 1HYQA 3IUNA 3PUJA 5BO5A 3D2LA 4WIAA 5BOVA 1Z2PX 2V6MA 3G17A 3MAGA 2FK8A 4UDOA 2YNMC 4OD0A 5T3UA 3TIXB 1Q57A 4L4ZA 3ZLBA 4DIOA 1WMBA 1YL6A 2GKGA 4G36A 1FY2A 1JG6A 3H97A 4II2A 3LQKA 4LPKA 4LHSA 5AW0A 4XQEA 2HUPA 2Q7XA 2V03A 3J7TA 1FFXA 3WJ1A 3CVOA 1W7AA 2X6QA 3HV2A 2XX3A 4DQKA 5AM5A 3MT9A 3H2ZA 5DTRA 2V9ZA 5C35A 1WULS 4GNKA 1E2GA 4JCCA 1PDOA 1RQNA 4J9VA 4R31A 4BKQA 3BHIA 2NO5A 4C7KA 4C87A 3HI4A 5SZHB 3VYWA 4B75A 2VK4A 4PC6A 1QUEA 1IDOA 1E3DA 4IW3B 4PXAA 3KJNA 3PEFA 3R0IA 3TAUA 4BWFB 1IN5A 3ZWNA 4QU0A 4O8ZA 1NYTA 1R0YA 2PZMA 1X9IA 2ZYHA 2B92A 4NI5A 4X3PA 5DEIA 4ZD6A 1ACLA 3RVSA 1RQLA 2ONZA 2PS9A 4H1TA 1FVOA 3V8VA 3OM9A 1W52X 2DH5A 3JASB 1N6OA 3M83A 1W4CA 5DNYB 1Z22A 1GCUA 1D04A 5B4UA 3GVHA 4IYJA 4K28A 5F3RA 4UREA 4QICA 3OFSA 2JXWA 1KJNA 1UPAA 4M46A 1EE9A 1VCNA 3E1KA 4GI5A 2D8MA 1G8MA 4LGYA 3VZCA 1Z5OA 3L79A 4IYRA 3LRTA 4O4IB 2CXRA 1EFKA 1JB9A 3I4LA 4RDCA 5CM9C 5ICMA 3U56A 1T4GA 3HYCA 4CT0A 1X7ZB 4X00A 4KREA 4B2PA 2O6HA 3I0ZA 4Q9KA 1U5AA 3ZQ6A 5JCPA 3RIXA 2AL7A 4S35A 4O29A 1HDEA 4IIXA 5G4KB 1AGXA 1XLVA 1NVEA 2QDXA 3O9MA 5E2IA 1EFPA 2ST1A 2VBFA 1J21A 1U1FA 2VPQA 3H05A 4Q18A 3SM3A 2WJHA 4AAYA 1JDNA 1S96A 4PSDA 1Z3CA 4RTPA 1DUIA 3GRFA 2IHYA 1E2UA 2QF7A 2VUUA 2XHEA 2EL9A 3HCPA 3INNA 4NBUA 4NFLA 2FUG1 3K0SA 3IEIA 3OOWA 3UMSA 1ETHA 1GGHA 3IV7A 3M5PA 2L4JA 1BE0A 3MERA 3SZLA 4MHTA 1MB0A 1M2JA 4XWYA 4D4MA 5DM0A 4GOKA 3LWZA 5FUBA 1I94B 3R5TA 3PVSA 2XYPA 1NFRA 3SYNA 3NDIA 4RD2A 3W3AH 1XDGA 3EF1A 5A9SB 5KTPA 2ZM5A 4X45A 4CR7A 2UVPB 1WNFA 1VCIA 1LPMA 4J6FA 5LQMA 2OYRA 1KAQA 2JI8A 1RFLA 2WFLA 4KR3A 5JNRA 4QBTA 2KW5A 4C21A 2DTDA 1AV7A 1KS2A 4YAWA 5AKKA 3H5LA 1HMYA 1V7ZA 1V5EA 3G85A 1YK0A 4UHFA 2GVDC 2VSFA 5UKDA 3TJRA 4R2HA 1G1MA 4QXPA 1YONA 4D74A 5DYTA 1JIUA 5JZBA 2R6ZA 2WM9B 1KRXA 2QV0A 4MUJA 4KPEC 4QC2A 2J30A 4AMVA 4IVRA 1UIMA 2P2CA 3FRIA 4DV2B 2IYZA 3RRJA 5BRNA 2B1RA 1ZU5A 2AQHA 1HLFA 2A0XA 2JJQA 3U3DA 3WC4A 3AR2A 4UDXX 2OM2A 2P6OA 4RCVA 2PEZA 1HEIA 4URXR 3B8HA 4GXTA 4RV5A 3ADCA 2YSFA 2UVDA 1NZFA 2WVAA 1QZZA 3AWIA 4YGXB 5MGNA 3CF2A 1K3FA 3CZMA 1FDIA 1RWPA 1DAHA 4OI0A 4P0PB 2FPRA 4WA8A 3FYHA 2B5OA 3V7UA 1N25A 2J3JA 4B5KA 4DN6A 5A5GA 2UZ4A 2Y76A 1CUCA 2WWTA 3RS8A 3D1JA 1JSRA 1VB5A 3D6JA 4K9KA 1TXGA 5FL7A 2WNHA 1N7HA 4LX0A 4ZOBA 3L0CA 3ESDA 4MYTA 2CE7A 3B3AA 1ZJ6A 1JPJA 3A1DA 1O97C 3TRJA 1USKA 3ZJYA 1L7EA 5E0KB 1LK0A 3A9VA 2ZJZA 4M2LA 2ZQYA 1TW2A 5ECDA 4B3FX 3KCQA 4CM4A 3EPJA 4B7AA 4PO8A 4CN9A 1X7XA 5LD2B 3B1KA 4HK4A 5FWAA 3R7WB 1XDDA 2DZDA 4DC0A 4IIJF 4LDQA 3JQCA 1M1ZA 3FHLA 4FYVA 3UJ9A 2GJAA 1QHIA 4X85A 4MICA 4R1PA 4Y1FA 3KTOA 4YJFB 3NJ4A 3G6KA 3Q8MA 4BZXA 1TU4A 3IUPA 3OQVA 1QIJA 2GCPA 2R6CA 4XVHA 5I48A 1M66A 1NOJA 2QN2A 5H82A 2DR3A 4R6WA 5EJIA 4QVKA 1ADBA 1POWA 2QENA 4ONEA 5CB6A 4KJZA 5ABPA 4M38A 3KDPA 1R6TA 4G0WA 2IF0A 2OCKA 1F3LA 1UBJS 1Z37A 2HIAA 4X92A 2FUEA 4CR6A 2RHJA 4WQMA 1P72A 3IEVA 4D3FA 5K4GA 4YRTA 3AFGA 1IQ0A 1ZJ4A 3NT5A 3KJQA 3LC2O 4X9XA 4CN8A 2NO4A 3KXDA 4P8RA 2PUCA 3WIBA 3WIVA 2V1XA 1A8QA 3EH1A 2I8CA 2AR0A 3DOHA 3ZKAA 3IEPA 4IJ5A 4V03A 3SQDA 2P5SA 4DEVA 5BNIA 3U9LA 4FNMA 4P5PA 4D7AA 2DECA 4LI0A 4NDZA 1Y8AA 1FK8A 1YVUA 2Q1WA 4RZXA 3LQ4A 4Y6PA 3O4RA 1E3WA 3BGSA 1IM2A 1MG0A 1S2IA 1FQWA 1V95A 2ZREA 3ESZA 1IY0A 5A4JA 3ESRA 2CVOA 3HB5X 1EP9A 4QUDA 1MHTA 3NM5A 4MUKA 4QO7A 5ALZA 4ID9A 5KDLA 4E2XA 3AYXB 5KWEA 5LOVA 1FVXA 1W0KA 3UMCA 1XOIA 2PLNA 3BRCA 1H0KA 3GXOA 1JHAA 1HT0A 3FLEA 2OHHA 1C3OB 4M9CA 1RRGA 3SSNA 4D43A 1RRVA 4O4LB 4RHTA 5JAUA 3DGFC 2HGZA 3AETB 3ESCA 2PH5A 1QYVA 1KA9H 1LNSA 5G41A 4K0KB 4HAYA 3WG9A 1KBOA 3HM2A 5JNLA 4QUBA 4EUHA 1CJSA 4IH4A 3TQQA 5IDWA 2R1UA 5TLSA 2I4RA 4CG1A 2ONJA 3BJMA 3EC1A 4O8CA 1QOPB 3GEGA 4J2HA 4M36A 3KOXA 1RRFA 3QWBA 4GECA 3W2GA 1Y4DE 5LJLA 3HR4A 4HGNA 2O1EA 1Y7PA 3A3OA 4BX8A 2A59A 2X0DA 2ADFA 3RSZA 1GL6A 2GK6A 1GUFA 2NXEA 4YWJA 3OIVA 3QVLA 1PZMA 2LWIA 3KHSA 1MB2A 1SIOA 2CFOA 2HMAA 2NUPB 2RB4A 2ZI5A 4OB8A 5HCIA 5MFPA 4KAXA 2DUJA 1NQVA 5B37A 4REMA 2HXGA 2YWGA 3IXMA 3QY9A 4KR6A 1LPAB 1CPYA 2J08A 2ZT7A 4MMYB 4EVRA 3L7CA 1J0AA 4NMHA 2J6HA 1C9KA 5CCXA 2DQZA 5CPBA 4JXZA 4HH3C 4Z7OB 5K9ZA 3C8HA 1EJ2A 2CMDA 4QOHA 4LC0A 3K0FB 3LV8A 3SIXA 3T3IA 2D62A 4Z2AA 3CH4B 2BCEA 5JCJA 4TTQA 4BBZA 3KTFA 2E55A 1HQKA 3AU9A 1Q0SA 3BUSA 3LX6A 4J29A 1PFUA 1XTBA 3Q0IA 4V0QA 2HA7A 3I58A 4RF4A 5CT8A 5D3MA 3WHLA 4EA6A 1HXHA 4GVLA 2E5LB 2P77A 4PRLA 1IHPA 1MW9X 4A1OA 2AXNA 2O2EA 3T7AA 2AFIE 4C2BA 4POOA 3NH9A 2HQ1A 1MRNA 1VIMA 2OP0A 3P9PA 1AXRA 3I4CA 3TAHA 1CIJA 1GLVA 3OOJA 1G5RA 4DBZA 3TKAA 1T15A 5IMBA 4X1OA 1NUQA 1ECBA 1GSAA 3GT7A 4X84A 1PWXA 2C88A 3DBVO 1AQ6A 4HVTA 2M2IA 3IOBA 1PJAA 3ZI4A 1E59A 1W1WA 3K8YA 5COBA 5AVRA 5KCMA 1A3CA 3VR0A 1SC4A 1OJLA 4CI0B 1YR8A 3DCIA 2DC1A 2JIZD 1OXTA 4TTPA 4N48A 1C0PA 2HQSA 5FI0B 2WAXA 3PFWO 1CS0B 3I30X 4NBVA 4TUYB 1Y3CE 1YMUA 3MUEA 3SF8B 1L7XA 5D87A 3AUAA 3DDUA 4YS6A 1SBCA 5JTUA 4WXYB 2Q5AA 1SOWA 2OBFA 3ZHBA 5ER9A 1UT6A 1MRZA 4HAIA 4IJ6A 3ZYCA 3G5TA 1GKLA 1ZH8A 1XZNA 3C4VA 5KNCD 1FJXA 4A73A 1VIYA 5JO9A 4FBMA 4EARA 5CEEA 1H8EA 2YZMA 3WLNA 2AZ4A 3OZTA 4I50F 3R0XA 3O2NA 1T5SA 1OYYA 5F35A 1JR2A 1ZIOA 1Z5VA 3NTVA 1HL7A 2VT3A 3WB2A 1EA5A 1ZWLA 3WQHA 5L6LB 1I6MA 1SQSA 2C59A 1YD7A 2I2FA 3E1GA 5LSAA 1NVDA 1BMFD 1XAGA 1XZHA 3TI7A 4XVQA 3WRVA 4B87A 2YFYA 5ALSA 4DABA 2EARA 4PLPA 4MITA 1S5PA 3E15A 1ZIYA 3VSDA 1DRUA 4JB8A 1X1DA 2QJOA 3CW2A 2GBFA 2BF7A 2WP8J 4WI1A 4CKXA 5LKRA 4D9NA 3LP5A 3ISVA 5EZ6B 1KI2A 2VK2A 2WMNB 2B20A 2ZB7A 3HCNA 3NVDA 1D6JA 4ZQGA 1DDIA 1JDTA 1ZI9A 1E61A 4AUMA 2LPMA 3LZDA 4L4RA 1AXEA 4XTRA 4F7DA 2WKQA 1A8HA 3GG9A 5CNIA 2M6LA 4JYZA 1BHSA 3B2EA 4DQDA 2ZYUX 4OLHA 4L5YA 2VT2A 5A4AA 3HO1A 1KMIY 2AJDA 3EZGA 4BASA 3AVQA 3RROA 2Y1FA 2H5LA 3JVDA 4XX0B 2YXNA 4CQJA 3QE2A 5DN9A 1JEQA 1O6CA 3GRVA 3UJPA 4E2WA 1ILEA 1C9YA 4MVJH 1RWMA 1VI5A 1W5FA 3HDVA 3L3BA 1KEEA 3ZE8A 1SVMA 1XGKA 3ED1A 3Q8XB 5CFPA 2OYCA 5D5HA 2DMRA 2JB9A 4RTSA 3H1AA 4XKJA 1YB2A 3SKYA 5FYDA 1NXPA 1ZP6A 3B2NA 3Q15C 4KBGA 3TVDA 1HT3A 1O03A 2IZ0A 3VPCA 4RNCA 4LRYA 1JU9A 2F3SA 2OMEA 1RYBA 1ZZEA 2B4AA 3D8UA 5HQJA 2I65A 2XRYA 1XD9A 1YL7A 4FHZA 4DUZB 1KQ3A 4U7WA 3M9XA 4ZODA 4D8UA 2CBXA 3QLEA 1A8SA 4G5XA 4H7JA 3I0MA 4FOOA 3ETDA 3L4SO 3NORA 4OH7A 4KLNA 4PX2A 3ZE9A 1XA0A 3F73A 4Z4EA 3O93A 3UUEA 2RAVA 5T6MA 4BRUA 1XMPA 1NRWA 1ID8A 3OLCX 2WG2A 3S55A 3TOZA 2P62A 5TNXA 1QGYA 4NJMA 1MIOB 3ZJ4A 1BZYA 1HEUA 2I7TA 1CVLA 3SQLA 3GIWA 1RXUA 1T8TA 2NU8B 1JDBB 1IHDA 1ABEA 2QX8A 3ZDZB 1QH8A 2VF7A 1JSLA 2M98A 1XZ8A 2WLTA 3CUUA 3LY7A 4CTNA 5KZMB 3HJNA 3A1NA 2B35A 3O91A 5B36A 1NVMB 4RPCA 4NK4A 1TZBA 1A2KC 2ATEA 1I7QB 1TFRA 3ZJTA 4LE1A 5I7SA 2JLQA 2ZYSA 1J33A 4A15A 1Q22A 4U6QA 3QPDA 4MUHA 4JI3B 3WGLA 2ZUDA 3EH2A 2H6EA 3FUXA 4EYSA 1I0IA 5IKXA 3LDGA 3WICA 4D9EA 4IIEA 5LP6F 2J9ZB 3GFQA 2ZSFA 1WCWA 1N5JA 1T5OA 4PRYA 1MAAA 3IHLA 3EQ9A 4XIFA 3ZWWA 4K9SA 4H35A 5IAEA 1B8UA 1NMYA 2X8LA 1E1MA 4CQMB 3LI2A 1DB3A 2ES4A 4M21A 5LFAA 1MQSA 1DC7A 3M6LA 3SC2A 5A3JA 1AMOA 4S1OA 2V3VA 5F5XA 2WI8A 5DXJA 3ZDYB 4F9EA 3VJRA 4CKEB 5TE9A 4CM6A 1FCJA 1D8TA 1T4CB 4KYIB 1DWQA 1VBNA 4BUZA 2OFFA 3RAGA 4J0IA 1QWOA 1Q11A 1IRXA 1KK3A 1ZD4A 1ZOSA 3HNPA 4GP9A 4Z9BA 3TOXA 3HDYA 4G81A 5AVXA 3KDAA 2GKSA 1UDWA 4NU8X 4HUTA 2BWJA 5JAIA 3HXQA 1EJ0A 1OAKA 2AB0A 3COWA 3OY2A 4GLFA 1CY7A 2OKCA 3GR6A 3MC1A 4MVJM 4ENVA 5BV2P 3KQNA 4PN3A 4BVBA 1AVTA 2XT0A 4R05A 1F5SA 3DBIA 5EE0A 1IBMB 4OP2A 4F0JA 4RFLA 3SZUA 4GLOA 1EFUA 1NJ2A 2AYZA 4G4IA 4YUXA 2VOEA 3N07A 3QY0A 4I0WB 4GFDA 1QO0D 1J0EA 4L0MA 3W5BA 1DTEA 4UCWA 1E7SA 1YGYA 2ZBRA 2Q3FA 3F5SA 1U28C 1HC7A 2JH3A 2Z2XA 1WABA 1G7CA 3KSZO 4MCJA 4D6XA 5KYKA 2ZI3A 3NVKI 1KDTA 4MDHA 4BO3A 4ZRNA 2OM6A 5GJWC 1Q0QA 2CVPA 4R0MA 4M6WB 1OE0A 2AOTB 3TCKA 4HZGA 1Z33A 1E3JA 3K72B 4HX9A 1Q1GA 1OLUB 4Q9NA 2D3TA 3VYVA 2P90A 5CXUA 3KFXA 4DLUA 3NHUA 5EHZA 1PGNA 1L8LA 2E4YA 3QVXA 3GCGA 1G66A 3MTIA 3L77A 4I5GA 1F17A 3AJRA 4P0QB 3K0CC 4R1TA 2QHXA 2IYVA 1H3EA 3R7AA 1QQ6A 3K4PA 1KPHA 1C4KA 1SXJA 2PJZA 3A4IA 3DXZA 1OLSB 4M76B 3SJ7A 1R0ZA 1CJTC 3U3RA 4QPDA 1NUSA 3PFHA 2IYOA 3RB8A 4A4DA 5AJYA 4BNDA 3GBSA 3MQHA 4LRTB 4GLBA 3ZU6A 2J9XB 3TE7A 2CFTA 3ADPA 1R9GA 2HLDD 2IYNA 5CQ2A 3A8TA 3I53A 1FU8A 1XXHE 1AG9A 4YAEA 5EXSA 3T5MA 1CETA 1U3VA 1V8FA 2C3YA 2G4VA 2V9CA 2O1SA 4MCIA 4NBRA 1PK7A 3IGFA 1J2TA 3L9XA 3E58A 3GARA 1KYVA 4DR1B 3ILYA 4B73A 5JG7A 2FF7A 3RAPR 4UNIA 1C7JA 2GGSA 3V8BA 3THXB 4DB2A 3PUZA 4ZI5A 4O63O 1GPUA 1DRVA 1N1DA 2IIPA 2ERCA 4MRPA 4XQ0A 1XZLA 4RELA 5JRDS 1L7DA 3CZRA 2W6JA 4OA5A 5KO2A 4RBNA 2BSAA 3TLMA 4AO7A 1RRPA 3H8WA 3DE4X 3S2EA 3VQTA 2G1UA 2A1TR 1X9GA 1OFUA 1ZEMA 3AL3A 3PC6A 3ZE7A 2XHZA 5DCUA 3AR7A 2F2TA 4PAQA 2DX7A 3G0OA 2ZQSA 1AGPA 1T25A 3BTVA 5LCXA 1R5JA 1XZQA 1ZH6A 3F0TA 1ULBA 1W34A 2VTVA 3I8OA 4J1SA 4TYMA 1H9BA 2CJWB 3NG1A 2DFTA 3PSAA 4TLAA 5JW6A 4J16A 1QB7A 4HQLA 3H16A 1IN7A 1KZHA 3OE5A 4YJ3B 3SDZA 4CMAA 4CM5A 7REQB 1CSEE 2SCUA 4GQAA 2JNWA 4FGWA 2P68A 2PLWA 2NTEA 2Q2NA 2WSMA 4BKUA 5G1NA 4RIFA 1GSIA 2ZJ7A 2J3DA 2XVMA 3K09C 1O58A 5I9SA 2CHUA 4B9AA 4QE3A 4KXMA 1E32A 1T5LA 1VCHA 1GT6A 3U7RA 4Y9SA 4IVQA 4U9IS 1YJBA 1B2LA 3QHQA 3FCSB 4HWSA 5TX7A 2VL7A 4LOJA 1RABA 2NSLA 1T9DA 2WWRA 4ME6A 3EGIA 3JD2A 2NW6A 3W5VA 2Z9CA 1C5KA 3OQHA 4CHGA 3ZVRA 3TPFA 2XB9A 4K7JA 1U3GA 3LW7A 2F1OA 5F4BA 5BN4B 2IA5A 1VXRA 1OFUX 4S12A 1GCGA 3GJ6A 3OE1A 4EY6A 4NMMA 3UPUA 4ND2A 1P1CA 2HMWA 4GZ6A 4XB2A 5EXDA 4LXQA 2ZPTX 2N0SA 1FXUA 4LMBA 3KCEA 3M82A 4BFLA 2F00A 1AKQA 2B1QA 2XY4A 3R3UA 1UPXA 4HNSA 4J3NA 1VMDA 5AFSA 1DAIA 3VPSA 5HVNA 2NZVG 1N1MA 2DHRA 4PGHA 2P2ZA 1Q0TA 2IUFA 3GGCA 3LHIA 4M8SA 3SOZA 4BNZA 2AQIA 2VTBB 5JRZA 1YHYA 1JLSA 2O20A 1RS0A 3DTYA 4Z9FA 3MMNA 4JJ4A 5AKLA 2R25B 3NHBA 2IL1A 2LDXA 1NBMA 2JEZA 1BJTA 2BHSA 2XKBA 4OLFA 4YT8A 1CWUA 3JV7A 2XTMA 1L5VA 1T3ZA 2G7MC 4IXMA 4PQGA 4UXJA 1L7QA 1O2DA 2QD5A 1N7JA 2HSEA 3AERA 3HY3A 3JX9A 1G2OA 1O8CA 3FETA 4J0EA 2QLMA 4QRHA 4ZXFA 3ICOA 4AN1A 2WIGA 3DPSA 4UNSA 2JLYA 3HNRA 2VDUE 3I64A 1AM4D 2EF1A 5DTQA 5EXXA 3TDKA 4KPFC 1DVRA 1BWPA 4CLRB 3FOCA 2YN4A 3DD5A 4HS9A 4WFIA 3ONWA 4M53A 2Y67A 1Z7YA 1R6XA 4GS5A 5ES4B 3RU2A 3CLRD 1JFTA 3ZYZA 5IN4A 3STWA 5AI0A 3N0WA 3O8BA 3IVAA 2ZRGA 1I4WA 4F5YA 1PNTA 3OEHA 4OJNA 1FNMA 1TKRA 2GEBA 2PT7A 2YOGA 1X7YB 3LBIA 4KI0A 5JDCC 3PNPA 3SIPA 1BTOA 1V39A 1JHRA 1MDFA 4PLHA 4FKZA 5IVIA 3UAZA 2E5FA 1GCOA 1H05A 1V8DA 4YCDA 4YRIA 2HPHA 1PS0A 2IY9A 2NQTA 4GXQA 3UQZA 2GCOA 1Z0FA 2O48X 4K9LA 1IL0A 1U6IA 4F8EA 2Q27A 4JUFA 4QEKA 3OLZA 1GM5A 3BTUA 1U2GA 2YQ5A 2H4ZA 2BEVB 3AHFA 4URHA 1YR7A 2O4CA 5PGMA 4F6CA 1LX6A 5F9HA 1ZSNA 5KB3A 2IPXA 3R1IA 3W2IA 2E85A 1U0HC 4BUJA 1K9VF 1F8UA 1YC2A 1VCOA 4FD2A 5ANRB 1SA0B 1RHKA 3VO9A 3N86A 1COWA 1TC1A 1VECA 3ZZTA 3MINB 2O5CA 1AHHA 1B0PA 2WHPB 1NBEA 1VL8A 3DOEA 1VE1A 5ALKA 3P2KA 2C4HA 4UQLA 3MGGA 2ACWA 2NN3C 3QXJA 3KD2A 4S1VA 3W9UA 2ZQ5A 2G9QA 3IX7A 4OQQA 4UU0A 1GPKA 3MCTA 5ALXA 5F1PA 1KZ6A 4KE8A 1LGYA 2QNIA 3TBFA 3WNVA 1BE8A 4ZQHA 3SBOA 5KWSA 4FI3C 4Q4HA 5TVGA 1BFKA 1XU4A 3ICQB 1NUPA 2QN3A 1UF9A 5CDHA 4WCFA 2NV2B 2ZFUA 3T3MB 1IRIA 2VH5R 2VSQA 4KO4S 3B3FA 1OI3A 3RF7A 1L7PA 3W9BA 5IKPA 1FLCA 1UAAA 1D5WA 1CUEA 4M8NE 3JYPA 1TGYA 3G1TA 6PFKA 4PC7A 4G1MB 2FN4A 2JK1A 3WRXC 2YIVX 4K3VA 4MS3B 3GEDA 2C4KA 1IZ9A 3GJ0A 3Q6IA 2IODA 4OXKA 1U2DA 1FBTA 2VNJA 3A25A 4TKZA 2Q4RA 5CDFE 5B2ZA 3RWOA 2IX9A 1SCQA 3K6RA 5F3WB 1K8ZB 5HMMA 3HKEB 4HATA 1BWRA 1RQPA 3ET5A 2XWQA 3KAHA 1G8AA 3GT3A 2JFBA 5AI6A 2PA0A 3NKVA 9ATCA 2PRSA 4KZKA 1IB0A 1ISGA 1JU3A 1W93A 3L1KA 2IP1A 4MS1B 1GHTA 1MX3A 4LDRA 2JGDB 2YSIA 3BE5A 2GPYA 5SZJA 1UXHA 2EQBA 3L0ZA 1GA6A 4GX0A 3JQ7A 1L1FA 6REQA 5JUWA 4ARUA 2XA9A 3CVWA 1IH8A 1XTKA 3M8KA 1NDQA 1ZNQO 3KELA 4I8XA 1FP6A 4PZ0A 4R8LA 5JBIA 1OWOA 5JYBA 2JLZA 1XG5A 1RI2A 3NH6A 4RPGA 3RV4A 4F2DA 4AJJA 3IE1A 1YRHA 2D0DA 1EXVA 4OHKA 2GX6A 4L74A 4RTQA 2GQ0A 4DLWA 4GIBA 4BP9A 1BRTA 2ZANA 4HGQA 3SLGA 2EP5A 1OROA 2J9FB 2F67A 3QXSA 1KOJA 4L1KA 3T95A 2H1SA 4B8ZA 2FDXA 2BTQB 5F23A 4GPBA 2WJJA 2HSWA 4LBVA 3GRCA 1UODA 4UASA 2FZ4A 1YFKA 2EWMA 3GWGA 3I76A 5AW7A 2UUBB 1E8NA 5JNSA 1ZINA 1NOIA 3GYGA 4Z8YA 2Q9AA 4DDKA 2C4MA 2VP3A 1UMBB 5LLDA 1T13A 4ND7A 2JFFA 5DBOA 4JB3A 5M29A 2B30A 3GDOA 2QM7A 4DIUA 3VVCA 3ZCQA 1ZOOA 3O4HA 3P9XA 5AJUA 1PQUA 1N5MA 5K8UA 1NKTA 2BELA 2IHBA 4N3CA 4FCCA 4ND4A 5AK0A 1VJ1A 1B0AA 3LY5A 4XASA 2EDAA 5A3VA 4A03A 4Z49A 4YRNA 1SOAA 4UKDA 4HD8A 1E5QA 3M5DA 4U8GA 4E30A 1AZLA 3KYIB 4QJ4A 5EFZA 4XYMA 4QFBA 3AT1A 2XH8A 4JB0A 3LUFA 2YXPX 3ZQ4A 1MV8A 3ZN2A 1VGQA 3ZXSA 2G9ZA 1B3RA 3JQPA 1NMVA 4W1RA 4C4OA 3KPJA 3S1AB 4DE5A 4MKIA 1MEJA 4G97A 5C8YA 5IJ0A 1OI7A 2QL7A 2BP7A 1IVSA 4XIIA 3ONDA 3Q10A 3TD2A 1OTXA 3RDPA 4X95A 3L7JA 2GYVA 3L8YA 4C0JA 3RTAA 1X92A 3WGIA 2UZ1B 5FBKA 4IKOA 4PGGA 4NMXB 3CXRA 4B09A 4RE5A 3VKFA 3T9CA 1UKVY 5T67A 1VSTA 5C31A 3ZD8A 1ULAA 1Y80A 1DEXA 2H2HA 2WYOA 3CSDA 1N8SA 4Y30A 1LK7A 4QUAA 5FTJA 1PGPA 3KTDA 4FU0A 1J8DA 3N6RA 2GILA 2WZBA 4PFJA 1RZRD 5TQ2A 2PL5A 4LJ9A 1E4EB 1SHUX 3FDZA 3UWOA 4PGAA 4CT4B 4MI1A 3B1XA 5K8JB 2XSZD 4LVCA 4S0XA 5A71A 4MO9A 2WKPA 4JX9A 3D7MA 2PYDA 1OT5A 1TZCA 4M22A 4N0QA 4N9WA 1U7UA 3CLUD 2W4MA 3CISA 3SQOA 4B6QA 4G26A 3ZDEA 1K9QA 3F7OA 3FUTA 1VC2A 3AGQA 3BJIC 3RUHA 4Q4CA 1ZMOA 4DPKA 2P6RA 1P31A 1Z38A 1CB7A 2PGLA 3VTKA 1IZ7A 1PEKE 2KX7A 1YBAA 3EVTA 2QRVB 3O8DA 4UFOA 1X1BA 3PUHA 3HVJA 4P31A 4PXSA 3RIHA 4BCCA 1IEQA 1XZJA 1TVCA 2ETVA 2JI4A 2OZVA 1SG6A 3D3KA 4WUVA 5T64A 3IULA 2IBSA 1PYOA 1QX3A 2HJVA 2FR1A 3EVAA 5K6AA 3AR5A 1FSPA 1Z8NA 1JLRA 3DTNA 5EYPB 5G40A 2ZR0A 4X1YA 1Y8ZA 1V6AA 4KPGA 1X0VA 1Y4SA 1YIAA 2HPZA 2XYGA 2OGWA 2YIDA 3D4NA 1DEAA 2RHBA 3L8ZA 1MC4A 4HTFA 3GMIA 4OHUA 3REOA 2I1QA 1LBHA 1M9NA 3SE0A 2X7HA 5JANA 3OE7D 3OZXA 1CJMA 2VQ3A 4OHRA 1KDRA 1ELOA 3K20A 4KW7A 2B6NA 1KI4A 2P41A 3Q8WA 3C3AA 1HUQA 4RF2A 1SBNE 2PWYA 3CN9A 3CZQA 4TS4A 2PXCA 1QIEA 4YQFA 2W00A 2C2BA 4MWOA 4OHMA 1HK7A 4I9UA 3AHGA 2AK2A 3A3KA 2DHEA 3B1FA 2EBUA 4YP5A 2V5VA 3OP4A 3PSHA 4G3XA 4W82A 3EIFA 3SHFA 2VSYA 4AWBA 1XNHA 5DM2A 3AIOA 3DMGA 3QJGA 8AT1A 4GI2A 2QMYA 5LM3A 3E1SA 1SWWA 5C34B 1OI2A 3RNOA 3UCFA 3QZUA 4TTTS 3NNDA 2RE3A 3OIYA 4RS4A 1XTJA 3K53A 4GPTA 4PYIA 4X20A 3VHLB 5HKOA 3DFFA 2OV4A 1GFWA 4DYDA 4EUNA 2QPLA 4H1VA 2VSXA 4C03A 4QA9A 3TTYA 1PIWA 3WP1B 3AUJB 2FUKA 2CLOB 1N2CB 1R9NA 3CR8A 3FOBA 2B82A 2W8BA 4YP1A 5BV1A 2Y0PA 1GADO 2F43B 1K5HA 5K0EA 4WLNA 2YZKA 4ZV7A 5F2EA 5J59A 1N34B 2C8KA 3ULKA 1VPWA 1VIVA 1ZYUA 2FZWA 2PBLA 4P32A 3ENNA 2HHHB 4P08A 2IVZA 2WSLA 3PDWA 4RAQA 5ILQA 1XIVA 3ZGVA 4BVHA 5B7GA 5A6SB 3CINA 3I6YA 2X76A 2H1IA 3T3PB 3FFWA 1NJSA 1E7YA 4PQFA 2QTRA 3KJGA 4F4IA 2ORVA 4MINA 1CNEA 3NHPA 3JD1A 3G79A 3OM0A 2H9IA 4HLUA 4JD5A 4NFSA 4EG6A 5AQEA 3F71A 2IYSA 4GRIA 2N46A 4IKEA 3WZLA 3ELBA 5C3MA 2HHAA 1W4AA 2W6ID 3GLGA 3EZ9A 4D4HA 1AN9A 3E18A 4X8OA 2Q45A 3AI3A 4MA0A 3O4JA 3GAAA 5LZ8A 1PJQA 2CMFA 2QUHA 1CT9A 4H9GA 3WSVA 2P3SA 4W5QA 2C5AA 2R1TB 2D4AA 5IKEA 1M6NA 3DAYA 3EXHA 3KUXA 1XTVA 2ARKA 1CIVA 4PV7A 3KM0A 1KS9A 1UUFA 2IUUA 2J48A 3K32A 4FVTA 2KMLA 1MG5A 3OJXA 4DUGD 1P29A 4JEUA 3GCXA 1SRQA 2AFHA 2QTCA 4AULA 2H65A 3D5QA 3EXG2 3RS4A 1PZGA 4H3VA 4FINA 4IGAA 4GE3A 5HFNA 5B55A 4ER6A 1H4QA 3S99A 1PNVA 3LY8A 10MHA 2G76A 4RCYA 3MF4A 3PIRA 3QKIA 1KHTA 2XNDD 1RE0A 3I2FA 5J5AA 2FR8A 3MCAA 4Y8VA 3WK8A 4URUR 1H6CA 4F7WA 2Y27A 5L40A 2BZSA 3ZLJA 5TVKA 1ZIXA 5CLQA 5KC8A 2FF5A 2I3AA 2H08A 2QTTA 4MKFA 4QGFA 4XRRA 5A3SA 1SVOA 4NYMR 2J45A 3IAS6 3OSUA 4UUNA 3OD5A 2AXEA 5IJWA 2IYYA 5G1OA 3FOWA 5FLYA 3ECSA 3G2PA 2WHRA 3L5OA 3UAYA 3IR7A 2XCUA 1QUFA 4NZNA 1QE3A 1RQ7A 2GEDA 4LJSA 1YZKA 5LJIA 4OOFA 4AP5A 2O5RA 4JNCA 4URYR 4ZI2A 4ZA2A 3SDSA 1YB7A 2JH9A 5DZSA 3MBKA 4PYRA 1CZKA 1NLYA 3HJTA 1FPQA 1DOHA 2IOQA 1D3AA 2XYHA 3A11A 3IEUA 1MP0A 1CHDA 3O2JA 1S3GA 2W6ZA 4WE3A 5AVKA 3TMKA 1YFJA 2VTDA 3B9QA 3QOYA 3Q9LA 1FLDA 2ZAYA 3R4CA 4FXPA 1M6EX 4YP7A 3W34A 3O9ZA 4R9SA 3HVHA 3WDLA 3TLEA 2AJBA 1FMCA 3BQNB 2QTMA 5LYJB 3SDBA 4DLRA 2D2FA 4L51A 4IG9A 1WMFA 3UGTA 2L0XA 1QRDA 3N87A 3VVBA 3L1IA 4LN1A 4P38A 5REQB 3NATA 3UB4A 4WJKB 5KYNA 3THYB 1LK5A 2ZG6A 2VHTA 2ACEA 4TYPA 4OY3A 4ER0A 2E1RA 1NJ1A 3IEXA 2IS1A 3DZFA 3ITNA 3H5AA 3O38A 1G8HA 1GDHA 1YZYA 4A8JC 2BFFB 3BWDD 4LF5B 1UEJA 5A4MS 4DBVO 2KPOA 4FN5A 1BC5A 1HORA 2BHTA 3HBLA 4ZZ1A 4J2OA 4INAA 3A58B 3FHTA 2A3NA 4XIJA 1H1DA 1NVVQ 2B99A 2O2CA 4GX2A 3K6SA 2O54A 3U39A 2NSDA 3KJZA 2I1VB 16PKA 3GEPA 1W9HA 1QX4A 2I80A 2VJYA 3DOIA 4PYNA 5J5CA 3WL5A 4ZO8A 4EO7A 4WNIA 3W5UA 3N7AA 5FWYA 3OIDA 3NKLA 1QZUA 1J97A 1I2CA 2KE5A 3IOCA 2YHIA 4G65A 1QGUA 1MF7A 1LBIA 3QUCA 4RABA 5KJCA 2NT4A 3D5TA 3UHOA 1OX4B 1I3CA 1CFZA 2DU8A 1O4VA 2O3SA 2ORYA 3KFVA 3M6WA 4OKIA 4QYIB 5EIBC 3SVLA 2FW8A 2UAGA 2OGTA 1VPDA 1PJLA 1YDGA 4MO2A 1B8VA 1NF9A 1MLDA 4AMZA 2B8WA 1QAMA 5KBYA 4OF4A 1ZK2A 1G6Q1 1U7HA 4LJRA 3PRJA 1UXJA 2ZYIA 3GMDA 1CYEA 1WKBA 2FEAA 1NW3A 2YRXA 5BVHB 1U7WA 4V2IA 4Z4IA 2RAFA 4BVGA 1JTVA 4KWEA 4D9CA 4NSNA 2BA1A 3M4ZA 2YYAA 4CCWA 2EFGA 1KI9A 3GDFA 2P75A 4J0GA 2HA3A 1HYEA 1YZTA 2ZJ3A 3D3QA 2V9PA 2WHYA 2I99A 3JQAD 4PQRA 3UK1A 4PZEA 4CFSA 3K5PA 1KJZA 1RM5A 4HL6A 3QPVA 1J7KA 3OU2A 1ISSA 2RHOA 2P7IA 3GBVA 3I8SA 5JNWA 3OTWA 4ZYVA 3RYCB 1AUQA 1FW8A 5M2QA 2WAMA 2JCGA 3KUKA 4LRXA 2Q99A 3P0RA 2YZ7A 1DKQA 3PX2A 1N9KA 2D2EA 1VP9A 2JIQA 4FWIB 4G8CA 5TQ0B 4OHVA 4BNKA 2X1MA 2JAHA 4PC2A 3K0AA 5KOIA 4DG5A 4BMYA 2Z6QA 1XBTA 3DLTA 1I13A 4B35A 2NACA 3TN7A 2K2WA 3M1YA 3LC0A 3UATA 2NSYA 1FTQA 1M1YB 3GGGA 3I3SR 4ILEA 4EIWA 4DZRA 1Y6RA 2E37A 5JRJA 4XRGA 5FLXA 1CR1A 1EEHA 3OMWA 1IBLB 3IMKA 2WWVD 4K6KA 3UK0A 2DUMA 2RG7A 3S70A 4DJFC 5C80A 1QLWA 4BCDA 2QD2A 1YH3A 3QQPA 3QUSA 1FTGA 3QGMA 2ZWPA 1PCXA 3N7TA 4U4AA 3U1TA 4AXXA 4ZI7A 2GWHA 3K7EA 3PGLA 4RIIA 1E8MA 3EWSA 1G5TA 2A2ZA 3VVMA 2JI6A 3AL2A 1L8QA 1OWLA 3DGEC 4PYQA 3REQB 1TKAA 1UINA 3FPFA 4TRMA 3KSUA 1WVIA 2Q5JA 1GU7A 4LCEA 2EIHA 3V33A 3A4MA 1TR8A 4BNYA 3GJ3A 1RZVA 5LQDA 5HRAA 1A8IA 1ZGGA 4J0CA 3V48A 3I39X 3W5AA 1FXWA 2HO5A 1Q50A 4IX1A 1QFJA 4BO0A 4HB2A 5FBWB 4B3BA 5K3FB 3VDQA 4XIGS 2GBLA 1UMDA 4XD7A 1OFIA 3ZNPA 2O7RA 1S2NA 4XCQA 2W6PA 1I2BA 1BXKA 2O4UX 4D9GA 4RD4A 1G3QA 1LVHA 1HTWA 3CVJA 4BO7A 1LSJA 3HY6A 3IVGA 4PAOA 1C30A 2G5PA 4RJTA 2WF7A 3UHAA 3R6LA 4F4CA 2CB0A 1W87A 4Y6RA 4EGJA 4O4IF 2AWNA 3UQYS 3W5SA 1E5LA 2CL7X 5EY5B 3RV3A 4GLLA 4LYAA 4RYLA 4MDFA 3STXA 3OZFA 3TL2A 2PS1A 4O1IA 4YWHA 2AN1A 1T8PA 3DTTA 5ERYA 3ZWVA 4UVGA 5ALLA 3U62A 4HNUA 1IHUA 1MA3A 2VYQA 4U2FA 4BTVA 1INLA 3B5EA 1XSEA 3HVIA 5LL6P 2XA2A 2OD9A 3BBPA 3FSGA 1GGVA 3VPFA 1OMOA 3OIUA 4YT5A 4ZT3A 3X1ZA 4YXFA 5L45A 1ZGAA 1JFFB 2JVJA 3ABZA 4GSKA 3JYNA 4IQ4A 3QKUA 3KALA 3RRXA 3WX0A 5DIZA 3LUAA 2P4EA 1KBQA 2IGTA 3C3DA 4NTZA 3BDVA 2CXNA 3L6RA 5A9RA 2QM8A 2OHFA 5BN1A 3KKKA 2PZFA 4C3OB 1EVQA 1K68A 1A4UA 1RAEA 3QTLA 1U3FA 1W4LA 2WYWA 5A0VA 2XTZA 3E2PA 5JCOA 4MQ6A 4MUEA 1B93A 1SHKA 1VJRA 1X39A 3AGPA 3C4QA 4LECA 3T7SA 4B8YA 3D5EA 3T34A 1E92A 4B40A 2J4FA 2ORED 3EY9A 5JJLA 5FOXA 4ENWA 5IASA 1I14A 1ZPDA 3FHJA 4RZIA 2J3QA 2WC1A 2JARA 4I1VA 1AD2A 3RRFA 5A2GA 1NPDA 4LTNA 4V38A 4XM1A 1VHQA 5CP8A 4A9AA 4BQOA 4PAMA 5DSXA 1R5NA 3UAWA 3KJFA 4ZXPA 3G8AA 2FRDA 3IAXA 3AHJA 3KOUA 3ZPXA 2GF2A 3KOMA 2IT1A 4FYWA 1IXKA 4MGZR 1CZNA 3C7AA 4W1PA 1B26A 1BCSB 5JS6A 4C06A 1BDJA 2BT4A 3FROA 1DKOA 3UT5B 2XVXA 2NU6B 3VXKA 3ER9A 4QIBA 1I4OA 4QODA 2RH4A 4V2UA 5B1SA 3I2GA 1EXDA 5C4GB 1F0KA 5CFNA 5J9FA 1DTWB 1O89A 2EWWA 3USZA 3MJVA 3UANA 4MLDA 4WAUA 4G5SA 3SMVA 3ASUA 5DN6D 5ALMA 5JZMA 1E3LA 3RLIA 4ND8A 1BGWA 2ORIA 1EVJA 2ZSAA 5H9VA 2XXAB 2R6AA 3H1PA 3JQGB 4FOLA 4IGKA 3HA7A 4ADSG 3HXLA 2NUAA 3KE9A 4FMCB 3DKPA 3R0VA 1B8OA 2CL5A 4R7GA 2HK8A 6AT1A 4FGUA 3I1IA 1V43A 4I7EA 3A1FA 1VI2A 3OTIA 4GI3A 1VBKA 3OA2A 4OQZA 1Z34A 3K2IA 4QRDA 1MVOA 1X80B 2F48A 2UUCB 2FEMA 1NSFA 2JIZA 1AS3A 1UBNA 2J3EA 2A78A 1G2PA 2YY5A 4BNGA 5E65A 2C5GA 4JWKA 1R0WA 3AUUA 3ON5A 3OQIB 2YUTA 1UMCB 3UEOA 5C5CA 2M3OW 2QTAA 2XYVA 3DQQA 1CQJB 1FYEA 4RK4A 3C16C 2C9CA 4RVNA 3SLKA 1NP6A 1F51E 3BMCA 3KQWA 2V8BA 4EVIA 3T1TA 2XKKA 3EQ2A 4FXOA 4GKAA 1PAUA 1RLUA 4M98A 3QOWA 2FDCA 3DMNA 4NFYA 2E6UX 1CJUC 3AFIA 3LLVA 1L1QA 5HFJA 3SEAA 4FOSA 1ULUA 3PDCA 4MUYA 3UCXA 3FYUA 4GD3Q 4B4VA 1L4EA 4KE9A 3NTOA 4MSUA 3GWZA 1CR4A 1T1JA 4XR4A 5JVDB 2AUMA 2H9YA 4INPA 4XD2A 4IDCA 3SKVA 5IHPA 4OLAA 2JCSA 1II9A 4EJ0A 1FU4A 3EVZA 4FGKA 1J6UA 1M2VA 4PZ9A 5LB4A 2WB4A 2JFXA 4KSCA 4BZQA 4F04A 3PFCA 1RXWA 1O0SA 2WUFA 3Q40A 2I22A 4C0SA 3T15A 2PUFA 1WSBA 3QVGB 5K0NA 4AU1A 4ETIA 5C7IO 3GHYA 4LWOA 4Y1RB 4YFVA 2D3WA 4UMDA 4XDZA 3JYQA 8LDHA 4IJUA 2QGNA 1BQ3A 3TJMA 1N0HA 1HRDA 4XLLA 2Q7OE 5AVYA 1DCMA 2I7CA 3VSCA 3QUAA 4L3WA 3ZCXA 2OC4A 1PKXA 1EXMA 2XP9A 1US8A 5TMEA 4H0CA 4MP6A 4WJLA 4TRJA 5EE5B 4LGMA 1KVUA 1ST2A 5A7FA 5LUBA 3RWMB 721PA 3U3XA 4A26A 4OHPA 2JJ8A 4MS4A 1SCJA 3CW9A 1JXOA 4HXFB 1GZ4A 1G8FA 2YWXA 4P4GA 2BMFA 4KNWA 2XCTB 4Y2QA 2CB9A 4CVNA 4ABTA 3BZUA 4TL6A 4I5EA 2L18A 4LXHA 3M85A 4AD8A 2AN4A 3GH3A 3HADA 4O4LF 1FUKA 4Q39A 4TL8A 1IJKA 3ZZUA 3AV0B 2ZK7A 4CKWA 1XC7A 4HGOA 1CTQA 3VU9B 4ARAA 1T9GR 5I7VA 1BE1A 5EMHA 1DADA 3UOWA 3QXGA 2E18A 4GX5A 3HJUA 3B5IA 1IPHA 4NXNB 4QBGB 5BSHA 1FP1D 4IF4A 5CVTA 4FUQA 5FDFA 1TU3A 2PMEA 4ROSA 4QL3A 2HA2A 4C0HA 3F7NA 5J58A 4QVIA 3ZWYA 4F56A 1L3BA 1KU6A 3MOIA 3WIOA 2IU4A 1WOMA 1GNTA 1Q1QA 3OZRA 1N9GB 4N6OA 3ZNQA 3P9IA 1MABB 1BHJA 3JZDA 3UXMA 4AJPA 3CWCA 4PX9A 3V1KA 1ICIA 3R3VA 2I2BA 4Z51A 2AC2A 3KPYA 4P7FA 4YPOA 3MIZA 2PV0A 4IX9A 1DGQA 1NASA 2O1WA 4YIKA 1P4RA 1U8TA 3DLBA 4TLBA 5EINA 1GKIA 4JJ7A 4ER3A 2VPTA 1GN9A 4HGRA 3G2JA 3BREA 4HFNA 4A82A 1JHVA 4QO8A 4Z7QB 4BUCA 4Q7QA 5LIPA 3NHZA 1IEWA 1ZNZA 2Z8ZA 1CJCA 1RTTA 4CMIA 1R4AA 4BMCA 4IMIB 4JDPA 4L8FA 4QFDA 2GZRA 2EOAA 3BXXA 3DAOA 3LBAA 1SU6A 3GNTA 3BHJA 3G8CA 1NPYA 1B3BA 2EGUA 4KO2S 4OSOA 3I73A 3GGJA 1BWSA 1IWPB 4GM4A 1Y6QA 4HEA6 4MGKR 1M7BA 3S28A 5B6JA 1EWKA 2HDOA 2HMTA 1ODIA 1GZHB 3KYBA 1REQB 1KYQA 4G1EB 2P6NA 4DQVA 4DIBA 2F8MA 2BGGA 5ALGA 3IJRA 4ITVA 3KLNA 4N0DA 1D2MA 4RHXA 3ZZMA 4NCAA 2PQ2A 2CJXA 3PE6A 2DFVA 4E4YA 2GPJA 3CB4A 4MP8A 2QN8A 1NN0A 3MGCA 4LF7B 1CLUA 1YE8A 3EEFA 3MAJA 1ZUHA 2RK3A 2Q2VA 3IESA 4RXUA 1G5PA 2WM2A 5CYOA 5I7EA 1LZKA 1ONPA 2PGXA 2DKFA 3RBAA 1CUVA 3BIJA 2Q5HA 2V7GA 1IZYA 1WXGA 1MTOA 2A1IA 4NDNE 1ZR4A 3MGBA 1DO0A 1F0NA 5BYJA 3O2QB 1KKMA 4TUYF 1GGNA 5JSZA 4C88A 1NUAA 4AF6A 1LFDB 2GUWA 3GXBA 3JARA 4LNUB 2C95A 5I7AA 3WL3A 3C3PA 4BE9A 4DMMA 4JI6B 1CCWA 1WMDA 5B2FA 2QMHA 4JVOA 4E14A 3A6GA 3LVQE 4YHHB 2XGSA 3OWHA 3B6EA 1G7TA 3IT1A 1AK1A 1XXLA 3C2QA 3EZNA 4J7CA 1HPLA 3NHAA 4N0MA 2NZXA 3V1MA 1RC8A 1QO0A 3GZJA 2OECA 2Q6KA 3NO4A 1P2UA 4MLCA 2X15A 4OH1A 4Y2TA 2FXVA 1JU4A 2H5JA 4WSOA 1E0AA 2HJ9A 5DLDA 5KHAA 4AM8A 1Y1TA 1LBTA 4ZTZB 1SCIA 5EUBA 4B79A 5HGXA 4W1SA 1C9MA 5DSZA 2W2LD 2J7PA 3FNFA 2FJPA 3TW0A 4CF6A 2E4WA 3MTGA 3O2SB 3QV2A 1JG2A 1UC9A 4JHXA 3BMQB 4AWXA 4DNFA 5HDQA 4FWTA 3CCCA 4QGAA 3KB2A 3CUSA 2Q8NA 3IQEA 4C0WA 3VUFA 5ULLA 3BJZA 4Y0VA 4H60A 5KKCA 3RVPA 4MTCA 3KDSE 3PLRA 4XUDA 4KN6A 3E5HA 4TMXA 3PHBE 4R0VA 3I61A 5KTTA 2BFBA 1TW3A 3L1JA 4HNGA 4UVHA 1E2EA 2I7VA 2WJ4A 2UXCB 1LI7A 3AI7A 2FWAA 1KKLA 1P0PA 4DMGA 4DRZA 4LJKA 3GRKA 4UMEA 1ZHHA 3JAWB 4MPJA 4JT2A 4B3SB 1GPMA 1HRKA 4JQOA 1DBWA 1GQSA 4I9FA 3K6KA 3RIEA 3TQOA 2AUTA 3VR4D 4QJ3A 1NG9A 4OQPA 4JI2B 1YRLA 5AW9A 4ZPXA 1Z16A 4PVDA 4CZ2A 4MUNA 2ISQA 1HEYA 1WXEA 1SXJE 2OUKA 2PBZA 5JYDA 3KVYA 4M9SA 4FZ3A 3QF4A 4B6RA 5AXDA 3PNYA 4OXXA 3U7EB 1NVFA 2FWMX 2LCIA 4J9UE 1Q21A 1SH7A 2EYQA 4TT3D 2DJ5A 5FP0A 1OH5A 1WEHA 1K86A 4G9BA 2G1PA 3AVVA 4K6GA 3J80A 4X3OA 2IEBA 1WCIA 1L4BA 2TMKA 4L8GA 2J3IA 2DVMA 3LZCA 4B7CA 2AHOA 1YZVA 2G36A 5JQGA 4DYHA 1T8WA 4YMSA 3R4VA 1U8EA 5J5VA 1Y37A 2A1UA 1IQUA 5EWLB 3RTDA 1MRSA 2DR0A 3R3YA 1G7SA 2GYYA 1ESMA 5P8WA 1OGIA 3KYJB 2PTHA 3IIMA 4RSGA 2L2QA 2VUIB 1XYYA 5FOVA 1WO8A 1FNSA 3R3WA 4L9AA 1JMKC 4KGXA 1UPUA 4JDUA 4Q9DA 5A06A 3RFUA 4JQZA 3U4QB 3TEJA 3ZWCA 5D6NA 5ARCA 1YVRA 4BWVA 5AW4A 2JAQA 1WW8A 4HRXA 5HKKD 3M1IA 4B83A 3AKYA 1E3MA 3OMLA 4ITRC 2O9JA 3NIWA 3RM3A 4C0AC 2OWEA 5KQPA 1JJVA 4Y7DA 4AO8A 2Z3WA 5DASA 1QC5A 2BFAA 3U7IA 3N2GA 5K6AC 1F8FA 1DJPA 1T4MA 5F2OA 5EAIA 3VOBA 4MEBA 4LHYA 3FHCB 2YS6A 4CETA 1OLXA 4G41A 1QFZA 4NC9A 3C6XA 3GUYA 3V42A 1R8JA 4DMKA 3NDPA 4PSAA 2F62A 1AQUA 3KUDA 1WB9A 2A5DA 1YB5A 2ZS7A 2D2XA 2ZJAA 2X0FA 1A88A 2PUWA 1V4BA 3WMRA 1RAGA 1VGVA 1WBJB 2OR3A 3ID6C 4DV6B 4RFSA 1ZUIA 3M5WA 1KRHA 1GGEA 2NO1A 3OZBA 5G0VA 1G291 1DS6A 2A9KA 2X4IA 2AG6A 2ZIZA 3L7NA 3MRVA 4WXEA 5JO0A 4X7MA 3MS4A 1W5BA 2ZR6A 1XVVA 1P9WA 5ALHA 2H54A 5GONB 2O3UA 2J4CA 3EGEA 1Q1BA 1SKMA 5LU9A 3OZWA 4LF8B 1X8KA 1KIFA 2V58A 2VHYA 1O5IA 4JP3A 1W36C 5FNZA 3RSOA 2A0YA 2Z08A 2A92A 3N8DA 4LY6A 5E5WA 4C1NA 3T3OA 2GPAA 2ZRHA 3KHUA 4CM8B 3PJRA 3C4JA 3LL7A 5IBRA 3FAKA 1RYFA 3AM4A 4DJJA 1EFHA 2PZAA 2HU7A 4BQPA 2FEWB 4JA0A 3IKMB 1XV5A 3WL8A 1Q0HA 2EG9A 1NBIA 1TUBB 1P5RA 2PCLA 1JSCA 2QU8A 2W6CX 2YICA 3ANXA 4QYWA 4ZOAA 1C7ZA 4EFKA 3UMYA 1R6VA 1RQXA 4J7UA 3TIIA 3ORRA 4GMFA 4B6FA 1ECFA 3QM1A 4JC5A 3TXXA 1U7ZA 1PLJA 2HADA 2JK0A 2NT3A 5EKXA 1XZGA 3NONA 3DUWA 1T2VA 5C37A 2G7ZA 2R7AA 5IZCA 4KZPA 4AROA 3DT6A 4KAAA 1J5EB 4BB9A 4DREA 4D0GA 4FFNA 2CNNA 3T8YA 1LEHA 1E0DA 3C97A 1E2HA 3W04A 1I6KA 1N5LA 5I7RA 3A1CA 1H2FA 2QRJA 4RIHA 3T4EA 4CNQA 3AVTA 4UJ3A 3O84A 1C4XA 3GLFB 4IEIA 1JHOA 2CHVA 3ZGZA 3EZYA 2A30A 2MSLA 3OURA 4MUMA 3TYXA 1DHTA 2BPOA 1Z2NX 1CW2B 2QLFA 3W0LB 3RUEA 2A9VA 3AQIA 5HUJA 5KJ6A 5DKFA 1EFCA 3GPCA 3DVAA 1WMSA 4NH4A 4R2MA 5JALA 2OV1A 2GRAA 3VHQA 3TM4A 1LNQA 3PQ7A 4J76A 1EG2A 5EMNA 1T9HA 3JQEA 1NTRA 1QO7A 2QT9A 3KX2A 2NUBA 2YNMD 4IKPA 1J1UA 3H5TA 2HH9A 1E3IA 3ROXA 4YJKA 4MAAA 1D6SA 3E5NA 2E82A 4KIUA 3ND9A 1XTRA 1NRIA 4D92A 1GZDA 1JF8A 2CV1A 3CRVA 2JZOA 4LWPA 2R87A 4RULA 1MJHA 3DG9A 1C1HA 4QXQA 2IFTA 4HUQB 2NUTB 4TKUB 3QTBA 4C4TA 3S8YA 4L72A 4F9TA 1CP2A 4FIZA 4GRDA 5FA5A 3SYKA 5T4HA 4ZMSA 1QVZA 3L49A 3LPCA 1RQ2A 4DTIA 1YHZA 3H9UA 2GDJA 3CH7A 1HNWB 1XELA 3COVA 3K6JA 3LUCA 2ZZNA 4HKTA 1R5OA 1KPIA 1V1RA 4AIIA 1P1IA 3CA8A 3ZZNA 4BFVA 3LA6A 2C3PA 2JEYA 2H4JA 4Q4JB 1Y89A 4YJ3F 2UXBB 1WRBA 4LV6A 3R7DA 4KVFA 1Z45A 3VKHA 1UP7A 2FUCA 1PJ8A 1NW7A 2QQ0A 4GMDA 1YNSA 3IMEA 3VJKA 2XZLA 1Z4NA 1LDYA 2JBWA 1WZCA 2YJNA 1M1NB 3A6EA 4PO1A 1E96A 1JEJA 4WTOA 4Y1GA 4J43A 4RC9A 4F72A 2I76A 4FFRA 1QCYA 2UU9B 1YQWA 2AKAB 1Y33E 2W2PA 1PLLA 3HWRA 2HJWA 2IVFA 4RGVA 5I9LA 2BVNA 3DVSX 1U2RA 3OFND 5JAMA 2NM0A 3MWFA 1S0UA 1BU5A 1UAYA 3KEMA 3RC7A 4Y6OA 4UTZA 1WZEA 5THKA 2I71A 1QFXA 1R9JA 5JZVA 1OH7A 4FYHA 2WPDD 5TDHA 3KEGA 2GD1O 4MUBA 4Y2JA 1YULA 1HYGA 5F52A 1KMNA 2E7ZA 3WI7A 1Y1QA 2LCQA 1DCKA 2GZHA 2QB5A 3EMDA 2QUJA 4NF2A 3RBXA 3U7QA 4ARZA 4UAVA 1THMA 3IBYA 4DSUA 4I4TF 3OCVA 4R2KA 5JLJA 2VCYA 3I9OA 1BE6A 1YJXA 5AVJA 4BKMA 4EX7A 4MMXB 1G5IA 5CH3A 3U1BA 1F1JA 1SU7A 1QBKC 1Z4PX 3NFRA 1ZO8A 3KG2A 2R62A 1HBJA 1SM4A 4GWLA 4U3JA 1A82A 1MO2A 3V7YA 1ZLXA 4ZZ2A 3N28A 5BWCA 3L0SA 1WCYA 3M6IA 4LXYA 3SZ3A 4ZKDA 4AS1A 3DUFA 5AW6A 5B30A 1AV6A 4E2ZA 1SCBA 2Y0EA 2C82A 4KIWA 5JC1A 5IULC 2NO7A 3I9LA 1J42A 4NS1A 2OGSA 5B58T 2NTYC 2REOA 5A04A 2CYAA 2LP4Y 2C3UA 2PKEA 4BWGA 4AT1A 4X0EA 1WMVA 1GSHA 5EKSA 1V47A 4J7AA 5K1ZA 4AYXA 5FWXA 2Q5OA 3CW8X 2IUSA 4ND6A 4EHKA 1O94D 1BX3A 1MORA 2QPAA 3DDZX 3N2IA 3O1IC 1G8PA 3HL0A 4X24A 1KO7A 1M0EA 5A02A 3VISA 1H23A 3PXEA 2Q0QA 4HBGA 4A0HA 3JAMA 3U7FB 1QPGA 1TQ8A 2FHPA 4YR7A 3FH0A 3NOXA 1P0FA 5E4TA 4GM0A 1V16A 4GH5A 2EBHX 4XWAA 1AX9A 3CEPB 3EMVA 5KTKA 4D42A 2JAXA 4M0FA 3C5HA 3SR0A 3DBLA 3PQ8A 4GC9A 5ENZA 3IQDB 4FCWA 4EENA 4ZZ3A 5KQMA 4B17A 1MJFA 1OZFA 3MPOA 3OFVA 3WQQA 3GLSA 1B1AA 2ANCA 3VNQA 4WZBB 5FTMA 2OHOA 2CHFA 2ZUSA 4NBSA 3HH8A 1M6WA 1T26A 3EA4A 1Y1RA 1PTKA 3SQWA 4EGSA 3R0ZA 4I81A 4N01A 3ME5A 4LZLA 4C30A 3V4SA 2QSUA 1OFVA 1YO6A 5EJGA 5CCBA 4JXJA 3STUA 1IUOA 2H0AA 4R16A 1VHTA 4YMUA 1EDDA 1M0SA 3FB4A 4AJIA 4WBSA 1O97D 4AMGA 1E66A 3BJEA 1K9SA 1Z0KA 4WZ6A 5AW2A 3ADBA 1XVTA 4RIEA 4DA0A 5K4HA 4IHJB 1JHYA 2PMDA 4BMDA 1MAUA 3TDBA 5ESDA 3FCOA 5AYVA 2W37A 1QF9A 4I4IA 2VHCA 3LX8A 1YTLA 2VHXA 1K3UB 1IG3A 1WZNA 3HRHA 3GLIB 3OLYA 2VP0A 1NXXA 3RFVA 2DULA 2VDLB 4Z3KA 3HJBA 1P7VA 4BKPA 5HJ5A 3PC8C 2PUVA 1MV5A 2IH5A 4IDAA 4L4YA 5HUQA 1YWGO 1I2DA 4P5EA 3X1MA 2XADA 2HJRA 2VJOA 4KQIA 3A1VA 4WPGA 1KERA 3KNZA 5DBIA 3A2LA 3AR8A 2CSXA 5LBUA 2LNDA 2VDJA 4GHWA 1EX9A 2PL9A 4DG8A 1NATA 2OD7A 3DT9A 4HNHA 4B3GA 2AG5A 1FEZA 2I3DA 2JJ1A 1GPWB 2GN1A 3BCSA 4L8LA 4M7RA 4N3NA 4ZVQA 3WR5A 1JSZA 1QWSA 1XZMA 2QKYA 1WG8A 4PSCA 5CGZA 3DMTA 3WGHA 3TXAA 5CVUA 1U2SA 5HQ3B 5EE9A 2B36A 1JG4A 2OCPA 1JEAA 1X94A 2VDQB 4V0NA 2B7BA 1ZM3A 5GV7A 1TU0A 2IEIA 1GUBA 3OE7A 4BGUA 4IDPA 3R09A 1YS2X 3C7CB 4X41A 3D4BA 4LRUA 4D96A 5IAKA 2BFDB 1ZSVA 2O2JA 3A6FA 1FFDA 2DG2A 3LMKA 3Q11A 3VZRA 3ZV4A 1P5FA 2IU3A 2VP9A 2LE0A 2WD9A 3HU5A 5JPIA 3LECA 3E03A 3ZWAA 3EG9A 4PFKA 1JKMA 1WY7A 1XMXA 4RVGA 1MGOA 4HB0A 2E9SA 4TN1A 5TJ9A 3WB0A 3OECA 5B1EA 4TV8B 3PFBA 4IOKA 1ZD9A 3DBRA 1KI6A 4MGYR 4URZR 4ECEA 4F4JA 1R4NA 3DE0X 1KH1A 4BEJA 621PA 3S2GA 5DI3B 1Z15A 3RTEA 2WAEA 1V1MB 1NVKA 5ITSA 1JI0A 2CV0A 3A6KA 2QNBA 3PHJA 3QWHA 4CV2A 4U84A 2F3QA 1QH1A 5FA8A 3GLHA 2WZCA 3NEPX 2NVUB 4C0KA 1E0SA 2X0RA 3CWZA 4BIIA 2CT8A 2I3GA 1HX7A 3ITKA 2AN5A 5FKJA 1T36B 4E5PA 1KJ9A 3FSRA 1TIKA 4NBKA 4L7QA 1NZJA 3A6JA 1NNLA 3N8IA 4DEYA 2QBYA 1SCUB 4JOCA 1NBWB 2IUEA 5DT2A 3AF3A 3P0FA 3H84A 4NJOA 1CEXA 4G09A 5DBGA 3L7DA 4JI0B 3CPJB 3PNKA 3COYA 3SBDA 1XZDA 1YZUA 2FUG6 4E5DA 1E2MA 4DCSA 3I01A 1GAXA 3GLUA 1YS4A 2ZVDA 3T9BA 2A94A 1NRJB 1LLUA 1TKBA 2G83A 2OSVA 3E2MA 4JCOA 4S1WA 4YRQA 4ZREA 4D99A 3BOSA 4NEGA 2Q6LA 1TVKB 4BZPA 4EHDA 1YHNA 4BDSA 2KHZA 2PSHA 4HX5A 5H7XA 1GPJA 2IGBA 2X2EA 1Q2XA 3VOSA 5F7OA 4H77A 4I08A 1PW5A 2EXXA 2QZ4A 3N59A 4LXIA 3GEEA 4RYDA 3R75A 3VPDA 4CKBA 3VDMA 5LZ9A 1XDSA 2P1RA 2W6IA 4KQGA 3HCOA 521PA 4LUCA 4B1FA 1EDOA 4J2TA 8GPBA 1PJ3A 2VAPA 3ZDFA 1NN3A 2UZAA 3HABA 4IDDA 2B6HA 2FMFA 2JFQA 3I2YX 3WGMA 2ESRA 5CJ2A 4AJHA 4AB1A 3HCWA 4E09A 1UWKA 1B1CA 2X3YA 4Z0HO 4NX2A 1NSTA 3CUEF 4FE3A 1K4KA 2KJQA 3I04A 4DUPA 2WOJA 1NE2A 4Y0AA 3B1WA 3VKVA 4DUGA 2XUAA 3MK31 5KQSA 3QV1A 1L7BA 3B38A 1K9RA 4IXWA 4P4LA 4K88A 4BGDA 4CWAA 3ILSA 2WF6A 3ZTWA 3TG8A 1B6RA 4M54A 2HYDA 4NXMB 1AH2A 2XNDA 4PTZA 4CJXA 1N0VC 3A2NA 3GELA 1OR8A 2ZBDA 1YR1A 1UADA 5FPSA 5TGZA 3GA0A 2W58A 5DBFA 3GV0A 5F7XA 2AFHE 1UOQA 2FCAA 1W47A 5IM4F 4W6ZA 1JA1A 5LP6C 4TQ9A 5LZ2A 5L3SB 3BRWA 4OSPA 5JBQA 4O4JA 1P2SA 4F71A 1O6BA 5TF4A 3KEFA 5B7QA 1FSGA 2EKBA 2PUTA 2ZS9A 2OHJA 3K0KA 3WL4A 2Q4EA 2P9YA 4KQXA 3V1YA 1LS6A 5JI3E 2C96A 4RH3A 5AKGA 1JZSA 3PCXA 2IZ7A 3SFZA 1K0UA 1NFFA 2ANBA 2HD4A 4C0LA 2Z95A 1PR3A 1XQWA 2IYTA 2BC9A 3DZDA 1O5OA 1T29A 1OASA 2HPVA 4V0LA 4HDMB 4N5LA 4QLOA 2O8CB 3DBOB 3HDJA 3GQBB 1ZK1A 1H6AA 2OCYC 3FFBA 3EPPA 4B3XA 2RARA 5HOQA 5IJ9B 1APBA 2IHTA 1EU1A 2VUHB 1TJPB 3OX4A 4OJTA 4EJSB 3ZHRA 1IXSB 3D0OA 3QJYA 4BJ3A 4MQ4A 3VOAA 1DC8A 2WVGA 3OQJA 3P96A 2ZAIA 3HFJA 4F96A 4NBNA 5C4MA 2DFLA 4LYDA 3RUIA 1F0YA 3K9FC 4CM7A 4N40A 3CLSC 2X4DA 5BYKA 1LSSA 1YR6A 1UXIA 4KIFA 3K9QO 2FI1A 3A4LA 4FPXA 4BAGA 1H1LA