4QIBA

Oxidation-mediated inhibition of the peptidyl-prolyl isomerase pin1
Total Genus 39
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
39
sequence length
157
structure length
144
Chain Sequence
LPPGWEKAMSRSSGRVYYFNHITNASQWERPSEPARVRCSHLLVKHSQSRRPSSWRQEKITRTKEEALELINGYIQKIKSGEEDFESLASQFSDSSAKARGDLGAFSRGQMQKPFEDASFALRTGEMSGPVFTDSGIHIILRTE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Peroxide-mediated oxidation and inhibition of the peptidyl-prolyl isomerase Pin1.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Isomerase
molecule keywords Peptidyl-prolyl cis-trans isomerase NIMA-interacting 1
total genus 39
structure length 144
sequence length 157
ec nomenclature ec 5.2.1.8: Peptidylprolyl isomerase.
pdb deposition date 2014-05-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00397 WW WW domain
A PF00639 Rotamase PPIC-type PPIASE domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.20.70.10 Mainly Beta Single Sheet Ubiquitin Ligase Nedd4; Chain: W; Ubiquitin Ligase Nedd4; Chain: W; 4qibA01
3.10.50.40 Alpha Beta Roll Chitinase A; domain 3 Chitinase A; domain 3 4qibA02
1U79A 4IPXA 1T11A 1KT0A 1N1AA 1C9HA 3CGNA 4TNSA 1D7HA 1KT1A 2KE0A 4DIPA 2VCDA 3O5QA 5HWBA 5HWCA 4DH0A 3LUOA 4ODNA 5HW7A 1FAPA 2JX8A 2MLZA 2JZVA 1J4HA 4U84A 3TCZA 1EG4A 2YSFA 1TCOC 1PBKA 3O5GA 2ZQSA 2PV1A 1J6YA 2PBCA 4E5RA 4REXA 3KACA 2F21A 3PA7A 3UQAA 1HXVA 2DJYA 2EZ5W 3NTPA 2IF4A 3KADA 3GPKA 4ODKA 2ZR6A 1R9HA 2N87A 2ZAJA 2ZQVA 3I6CA 2YSGA 4U86A 2L2SA 2LKNA 1WR7A 2MDIA 2LPVA 2XP4A 2YSHA 3OOBA 4LAVA 1FD9A 1Q6UA 2Q5AA 4ODQA 2ITKA 3O5RA 2FKEA 2XP5A 2XP3A 1FKJA 1K9QA 2M2AA 2MLXA 3O5KA 1Q1CA 4DRIA 2ZR5A 4DRNA 1FKGA 4DZ2A 1ZK6A 4DZ3A 1PINA 3O5JA 4ODRA 2KXQA 2RSEA 1D7IA 2DG4A 3IHZA 4JFJA 5GPGA 2RUCA 3O5MA 3KAIA 1JMQA 4J4OA 1I5HW 2MNTA 4JFKA 4NNRA 3M7NA 4ODLA 3CGMA 3O5PA 1WMVA 4DRPA 1EQ3A 2KGJA 2YSBA 1FKRA 3ODKA 2K8IA 4W9PA 4TW8A 4QT3A 4DRJA 5HKGA 3O5FA 3UQIA 3TC5A 2PV2A 5BXJA 3IK8A 1EG3A 1NSGA 2MLYA 3FAPA 3KZ7A 4G50A 1JNSA 2M3OW 1J4IA 2RQSA 2KO7A 4ITZA 1D6OA 1A7XA 4TW6A 2XP9A 3O5LA 3H9RB 2JXWA 2VN1A 3IKGA 3JYJA 1BL4A 4C02B 1ZCNA 5HTGA 1F40A 3KAHA 4DROA 1YW5A 4JFIA 4BF8A 4DRKA 1W26A 3LE4A 2RE3A 5CQ2A 1FKIA 1Y0OA 4GIVA 4GGQA 4W9QA 4DRHA 1P5QA 4DRQA 4O2TA 2KI3A 4IQ2A 3MDYB 1JVWA 2RUQA 2LAJA 2FAPA 2UZ5A 4LAYA 2XP6A 1EYMA 1D7JA 2AWGA 2OFNA 3NRKA 3L4HA 2E45A 4ODOA 1K9RA 1FKBA 2KFWA 2KR7A 5DIVA 4DRMA 5HT1A 3KABA 4MSPA 3WH0A 3UQBA 1FJDA 2Y78A 4U85A 1FKLA 1BKFA 2DMVA 3EY6A 4ODMA 3O5IA 5I98A 3NI6A 2PPNA 2DK7A 3KAFA 4LAXA 1O6WA 4TX0A 3VAWA 5B8IC 1J4RA 5D75A 2DK1A 2PPOA 2ZR4A 1F8AB 2LJ4A 2DWVA 2D9FA 3O5EA 5HUAA 2JMFA 4TW7A 2M1IA 2MPHA 3PRDA 3CNGA 4JYSA 3UF8A 2XP7A 1YATA 4G2PA 4JFMA 5AHTA 4JFLA 3RGCA 3UI6A 1L1PA 1ROTA 3O5DA 3M85A 2DG9A 4TYOA 2PV3A 3UI4A 4FN2A 3O5OA 2F2DA 3UI5A 3B7XA 1ROUA 4IQCA 3KAGA 2XPBA 3PRBA 1Q6HA 4N19A 5HW8A 1JNTA 1B6CA 5DITA 1FKFA 2RUDA 3KCEA 1FKHA 2M8JA 3JXVA 3JYMA 4QIBA 2F4EA 3TDBA 2ZQUA 1FKSA 1QPFA 2DG3A 1TK7A 1FKDA 4ODPA 5J6EA 2XP8A 2M8IA 1QPLA 1NMWA 2BA1A 2MF9A 1Q6IA 1M5YA 4FAPA 1FKTA 2ZQTA 2LGOA 4W9OA 2RURA 4DT4A 4R0XA 1NMVA 2YSIA 5HW6A 3IKDA 2JV4A 4QT2A 4LAWA 2L4JA 2PPPA 2M08A 4J4NA 1FKKA 2XPAA 4MGVA 1QZ2A 5DIUA 3RFWA
chains in the Genus database with same CATH superfamily
1T11A 4TNSA 3ARRA 2F23A 3CHEA 4Z2JA 4DH0A 3ARPA 3TCZA 2B5UB 1HKKA 1FFRA 4Z2HA 2IF4A 3GPKA 4ODKA 1R9HA 3I6CA 2ZQVA 2L2SA 1WR7A 2LPVA 2WM0A 3BXWA 4AY1A 1ZB5A 2ITKA 2DSWA 1FKJA 2DT3A 4GLXA 1FFQA 4WJXA 4ODLA 4WKHA 1H0IA 4DRPA 1E6ZA 1OGBA 4WIWA 1E6RA 1NWTA 2ETNA 5HKGA 2FDMA 1EG3A 4G50A 2DPEA 2MLYA 1UR9A 1J4IA 4ITZA 1NWUA 3OA5A 4TW6A 3O5LA 4S3KA 2VN1A 3MQHA 1BL4A 1W1PA 3KAHA 4DWSD 4DROA 1YW5A 4DRKA 5JH8A 1HKIA 2KI3A 4LAYA 2RUQA 2FAPA 1NWSA 1EYMA 1D7JA 1TFVA 4P8UA 3BMBA 5DIVA 1WNOA 5DF0A 3UQBA 3WD3A 1FKLA 1BKFA 2PN0A 2DMVA 2DSUA 3O5IA 3ARWA 2PPNA 5B8IC 3PR9A 1J4RA 3B8SA 1EDQA 5D75A 4ZPWR 4KQZA 2AOSA 1XHGA 4TW7A 2MPHA 3PRDA 3WQVA 1YATA 3PRAA 3UI6A 5AHTA 1HKJA 3ARTA 3WQWA 3O5DA 4FN2A 2F2DA 5HW8A 1ROUA 4IQCA 3KAGA 3PRBA 1ITXA 3MQGA 4XAKA 3KCEA 2OWOA 1RD6A 1FKDA 1EHNA 1HKMA 5J6EA 1FLCA 5E66A 3LKXA 2BA1A 1ZBWA 4MNLA 2MF9A 4FAPA 4P8WA 4P8XA 2RURA 3IKDA 2JV4A 4LAWA 3WIJA 1FKKA 1UR8A 1OGGA 1U79A 4QZVB 1C9HA 1X6NA 4DIPA 4MNKA 1ZBKA 2VCDA 5HWBA 4Q7NA 4URIA 2Y8NB 1FAPA 2JZVA 1J4HA 3ALGA 1TCOC 3ARSA 3O5GA 4ZPTR 3WD2A 2PV1A 2PBCA 2DJYA 3FSBA 3NTPA 5E65A 2ZR6A 1W1VA 2ZAJA 2O92A 5DEZA 3PQHA 3CHFA 3OOBA 1H0GA 4LAVA 4Z2GA 4ODQA 1XRVA 2XP5A 2XP3A 1K9QA 2M2AA 4DRIA 1HJWA 4KR0B 2G8ZA 2KXQA 4JFKA 4J4OA 4NNRA 1I5HW 3WD4A 1E44A 3CGMA 2WAEA 2YSBA 5E64A 1ZBVA 1LQ0A 3CHDA 3ODKA 3WD0A 4TW8A 3AQUA 3ARVA 4QT3A 3ARXA 4DRJA 3O5FA 3UQIA 2PV2A 1JNSA 3B9EA 4L72B 2RQSA 1D6OA 1SR0A 3IKGA 2JXWA 5DO2A 1ZBCA 1F40A 1ZCNA 1W26A 4GIVA 1JCHB 1ZU8A 4IQ2A 4A0TA 4ZPVR 3ARYA 1JVWA 2UZ5A 3GU0A 4C02B 2AWGA 2DT0A 1L1PA 3EIPA 1K9RA 1GOIA 2KR7A 1W1YA 5HT1A 3KABA 4MSPA 2Y78A 1OWQA 3QOKA 4W5UA 2ZR4A 1F8AB 2IUZA 4MTVA 1TR8A 4JYSA 3UF8A 4JFMA 1WAWA 1ROTA 3M85A 4TYOA 3UI4A 3O5OA 4P8VA 3B7XA 1J6YA 1Q6HA 1W9UA 2RUDA 3JXVA 4Z2KA 4QIBA 4ODPA 3FY1A 1NWRA 3B9DA 1Q6IA 4WK9A 1FKTA 3RM4A 2B31A 2A3EA 1NMVA 4QT2A 1W1TA 4IPXA 1KT0A 3CGNA 4ML4A 1KT1A 2KE0A 4S3JA 5E5WA 3O5QA 5HWCA 2A3AA 2MLZA 1IX5A 4U84A 3KACA 3PA7A 1HXVA 2F21A 5U47A 4U86A 3RMEA 2MDIA 2XP4A 3G6LA 1FD9A 4NZCA 1Q6UA 2Q5AA 2YBTA 2FKEA 3O5RA 4A0UA 4PTMA 2MLXA 2G41A 3O5KA 2ZR5A 4DRNA 1FKGA 4DZ2A 1ZK6A 4DZ3A 3O5JA 1JNEA 4WKAA 1D2KA 2DG4A 3IHZA 4JFJA 3O5MA 3KAIA 1JMQA 1CTNA 2MNTA 3AS0A 3M7NA 1HJVA 1WMVA 1LJYA 1EQ3A 2WK2A 2WADA 1FKRA 2K8IA 1RP5A 2A3BA 5BXJA 1E9LA 3AROA 4MAVA 1LL7A 2KO7A 1A7XA 5GQBA 2XP9A 3WL1A 3JYJA 4LGXA 5HTGA 5E62A 4HBOA 3LE4A 5CQ2A 4GGQA 1P5QA 2YAJB 4DWSA 4DRQA 1EIBA 3MDYB 1GPFA 3CHCA 2XP6A 4ODOA 3NRKA 1FKBA 2KFWA 2DSVA 4Z2IA 3EY6A 4ODMA 1E15A 3ARZA 3NI6A 3KAFA 4TX0A 3VAWA 1O6WA 1HJXA 2DT1A 3ARQA 2PPOA 1GUVA 3ARUA 4DWSB 2LJ4A 2D9FA 1LL4A 3FSCA 2M1IA 3CNGA 3AS3A 4G2PA 4JFLA 4MNJA 2A3CA 3UI5A 4HBEA 2XPBA 3MCBB 4N19A 3RM8A 1JNTA 5DITA 3GTYX 1FKFA 1SYTA 1FKHA 2M8JA 3FXYA 3JYMA 2F4EA 2ZQUA 1TK7A 1GRJA 2M8IA 1QPLA 1NMWA 1M5YA 2LGOA 4W9OA 4DT4A 2WLZA 1E6NA 2L4JA 2WLYA 5DIUA 4DWSC 3RFWA 1WB0A 1N1AA 2PI6A 1D7HA 4MNMA 3LUOA 4ODNA 5HW7A 2YBUA 2JX8A 1E6PA 1EG4A 2YSFA 1PBKA 2ZQSA 1X6LA 2QRVA 4E5RA 4REXA 3UQAA 2EZ5W 3B9AA 3KADA 2N87A 1ZL1A 2YSGA 4UDMA 1W9VA 3CZ8A 2LKNA 2YSHA 4Q22A 2P4VA 3LKXB 4Z2LA 4IT4A 1O6IA 2ESCA 1Q1CA 1PINA 2DT2A 4ODRA 2RSEA 1D7IA 5GPGA 2RUCA 4ZS6A 3WL0A 3O5PA 2KGJA 3FS8A 4W9PA 3TC5A 3IK8A 3KZ7A 1NSGA 3FAPA 2M3OW 3AS1A 4R5EA 3H9RB 4L3NA 4JFIA 4BF8A 4IT6A 4DRHA 2RE3A 1FKIA 1Y0OA 1JNDA 4W9QA 4O2TA 2LAJA 1VF8A 3CH9A 2OFNA 3G6MA 3L4HA 2E45A 1LG1A 3AS2A 4DRMA 2EULA 1FJDA 3WH0A 4U85A 3W4RA 4HARA 5I98A 1W9PA 2DK7A 1NH6A 4LAXA 1KFWA 3RM9A 5HUAA 2DK1A 3O5EA 2DWVA 2DSZA 2JMFA 4MPKA 1LL6A 2XP7A 1LG2A 3RGCA 2O9OA 2DG9A 2PV3A 4NSBA 3WD1A 5GPRA 1B6CA 5HBFA 1K9TA 3TDBA 3WKZA 1FKSA 1QPFA 2DG3A 2XP8A 4WKFA 2ZQTA 5HW6A 4R0XA 2YSIA 2QF8A 3MCBA 2PPPA 2M08A 4J4NA 2XPAA 4MGVA 1QZ2A 3ALFA 2OLHA
chains in the Genus database with same CATH topology
1T11A 4TNSA 3ARRA 3CHEA 4Z2JA 4DH0A 3ARPA 3TCZA 1HKKA 1FFRA 4Z2HA 2IF4A 3GPKA 4ODKA 1R9HA 3I6CA 2ZQVA 2L2SA 1WR7A 2LPVA 2WM0A 3BXWA 4AY1A 1ZB5A 2ITKA 2DSWA 1FKJA 2DT3A 4GLXA 1FFQA 4WJXA 4ODLA 4WKHA 1H0IA 4DRPA 1E6ZA 1OGBA 4WIWA 1E6RA 1NWTA 5HKGA 2FDMA 1EG3A 4G50A 2DPEA 2MLYA 1UR9A 1J4IA 4ITZA 1NWUA 3OA5A 4TW6A 3O5LA 4S3KA 2VN1A 3MQHA 1BL4A 1W1PA 3KAHA 4DWSD 4DROA 1YW5A 4DRKA 5JH8A 1HKIA 2KI3A 4LAYA 2RUQA 2FAPA 1NWSA 1EYMA 1D7JA 1TFVA 4P8UA 5DIVA 1WNOA 5DF0A 3UQBA 3WD3A 1FKLA 1BKFA 2DMVA 2DSUA 3O5IA 3ARWA 2PPNA 5B8IC 3PR9A 1J4RA 3B8SA 1EDQA 5D75A 4ZPWR 4KQZA 2AOSA 1XHGA 4TW7A 2MPHA 3PRDA 3WQVA 1YATA 3PRAA 3UI6A 5AHTA 1HKJA 3ARTA 3WQWA 3O5DA 4FN2A 2F2DA 5HW8A 1ROUA 4IQCA 3KAGA 3PRBA 1ITXA 3MQGA 4XAKA 3KCEA 2OWOA 1RD6A 1FKDA 1EHNA 1HKMA 5J6EA 1FLCA 5E66A 3LKXA 2BA1A 1ZBWA 4MNLA 2MF9A 4FAPA 4P8WA 4P8XA 2RURA 3IKDA 2JV4A 4LAWA 3WIJA 1FKKA 1UR8A 1OGGA 1U79A 4QZVB 1C9HA 1X6NA 4DIPA 4MNKA 1ZBKA 2VCDA 5HWBA 4Q7NA 4URIA 2Y8NB 1FAPA 2JZVA 1J4HA 3ALGA 1TCOC 3ARSA 3O5GA 4ZPTR 3WD2A 2PV1A 2PBCA 2DJYA 3FSBA 3NTPA 5E65A 2ZR6A 1W1VA 2ZAJA 2O92A 5DEZA 3PQHA 3CHFA 3OOBA 1H0GA 4LAVA 4Z2GA 4ODQA 1XRVA 2XP5A 2XP3A 1K9QA 2M2AA 4DRIA 1HJWA 4KR0B 2G8ZA 2KXQA 4JFKA 4J4OA 4NNRA 1I5HW 3WD4A 3CGMA 2WAEA 2YSBA 5E64A 1ZBVA 1LQ0A 3CHDA 3ODKA 3WD0A 4TW8A 3AQUA 3ARVA 4QT3A 3ARXA 4DRJA 3O5FA 3UQIA 2PV2A 1JNSA 3B9EA 4L72B 2RQSA 1D6OA 1SR0A 3IKGA 2JXWA 5DO2A 1ZBCA 1F40A 1ZCNA 1W26A 4GIVA 1ZU8A 4IQ2A 4A0TA 4ZPVR 3ARYA 1JVWA 2UZ5A 4C02B 2AWGA 2DT0A 1L1PA 1K9RA 1GOIA 2KR7A 1W1YA 5HT1A 3KABA 4MSPA 2Y78A 1OWQA 3QOKA 4W5UA 2ZR4A 1F8AB 2IUZA 4MTVA 1TR8A 4JYSA 3UF8A 4JFMA 1WAWA 1ROTA 3M85A 4TYOA 3UI4A 3O5OA 4P8VA 3B7XA 1J6YA 1Q6HA 1W9UA 2RUDA 3JXVA 4Z2KA 4QIBA 4ODPA 3FY1A 1NWRA 3B9DA 1Q6IA 4WK9A 1FKTA 3RM4A 2B31A 2A3EA 1NMVA 4QT2A 1W1TA 4IPXA 1KT0A 3CGNA 4ML4A 1KT1A 2KE0A 4S3JA 5E5WA 3O5QA 5HWCA 2A3AA 2MLZA 1IX5A 4U84A 3KACA 3PA7A 1HXVA 2F21A 5U47A 4U86A 3RMEA 2MDIA 2XP4A 3G6LA 1FD9A 4NZCA 1Q6UA 2Q5AA 2YBTA 2FKEA 3O5RA 4A0UA 4PTMA 2MLXA 2G41A 3O5KA 2ZR5A 4DRNA 1FKGA 4DZ2A 1ZK6A 4DZ3A 3O5JA 1JNEA 4WKAA 1D2KA 2DG4A 3IHZA 4JFJA 3O5MA 3KAIA 1JMQA 1CTNA 2MNTA 3AS0A 3M7NA 1HJVA 1WMVA 1LJYA 1EQ3A 2WK2A 2WADA 1FKRA 2K8IA 1RP5A 2A3BA 5BXJA 1E9LA 3AROA 4MAVA 1LL7A 2KO7A 1A7XA 5GQBA 2XP9A 3WL1A 3JYJA 4LGXA 5HTGA 5E62A 4HBOA 3LE4A 5CQ2A 4GGQA 1P5QA 2YAJB 4DWSA 4DRQA 1EIBA 3MDYB 1GPFA 3CHCA 2XP6A 4ODOA 3NRKA 1FKBA 2KFWA 2DSVA 4Z2IA 3EY6A 4ODMA 1E15A 3ARZA 3NI6A 3KAFA 4TX0A 3VAWA 1O6WA 1HJXA 2DT1A 3ARQA 3ARUA 1GUVA 2PPOA 4DWSB 2LJ4A 2D9FA 1LL4A 3FSCA 2M1IA 3CNGA 3AS3A 4G2PA 4JFLA 4MNJA 2A3CA 3UI5A 4HBEA 2XPBA 3MCBB 4N19A 3RM8A 1JNTA 5DITA 1FKFA 1SYTA 1FKHA 2M8JA 3FXYA 3JYMA 2F4EA 2ZQUA 1TK7A 2M8IA 1QPLA 1NMWA 1M5YA 2LGOA 4W9OA 4DT4A 2WLZA 1E6NA 2L4JA 2WLYA 5DIUA 4DWSC 3RFWA 1WB0A 1N1AA 2PI6A 1D7HA 4MNMA 3LUOA 4ODNA 5HW7A 2YBUA 2JX8A 1E6PA 1EG4A 2YSFA 1PBKA 2ZQSA 1X6LA 2QRVA 4E5RA 4REXA 3UQAA 2EZ5W 3B9AA 3KADA 2N87A 1ZL1A 2YSGA 1W9VA 3CZ8A 2LKNA 2YSHA 4Q22A 3LKXB 4Z2LA 4IT4A 1O6IA 2ESCA 1Q1CA 1PINA 2DT2A 4ODRA 2RSEA 1D7IA 5GPGA 2RUCA 4ZS6A 3WL0A 3O5PA 2KGJA 3FS8A 4W9PA 3TC5A 3IK8A 3KZ7A 1NSGA 3FAPA 2M3OW 3AS1A 4R5EA 3H9RB 4L3NA 4JFIA 4BF8A 4IT6A 4DRHA 2RE3A 1FKIA 1Y0OA 1JNDA 4W9QA 4O2TA 2LAJA 1VF8A 3CH9A 2OFNA 3G6MA 3L4HA 2E45A 1LG1A 3AS2A 4DRMA 1FJDA 3WH0A 4U85A 3W4RA 4HARA 5I98A 1W9PA 2DK7A 1NH6A 4LAXA 1KFWA 3RM9A 5HUAA 2DK1A 3O5EA 2DWVA 2DSZA 2JMFA 4MPKA 1LL6A 2XP7A 1LG2A 3RGCA 2O9OA 2DG9A 2PV3A 4NSBA 3WD1A 5GPRA 1B6CA 5HBFA 1K9TA 3TDBA 3WKZA 1FKSA 1QPFA 2DG3A 2XP8A 4WKFA 2ZQTA 5HW6A 4R0XA 2YSIA 2QF8A 3MCBA 2PPPA 2M08A 4J4NA 2XPAA 4MGVA 1QZ2A 3ALFA 2OLHA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1U79 A;  4IPX A;  1T11 A;  1KT0 A;  1N1A A;  1C9H A;  3CGN A;  4TNS A;  1D7H A;  1KT1 A;  2KE0 A;  4DIP A;  2VCD A;  3O5Q A;  5HWB A;  5HWC A;  4DH0 A;  3LUO A;  4ODN A;  5HW7 A;  1FAP A;  2JX8 A;  2MLZ A;  2JZV A;  1J4H A;  4U84 A;  3TCZ A;  1EG4 A;  2YSF A;  1TCO C;  1PBK A;  3O5G A;  2ZQS A;  2PV1 A;  1J6Y A;  2PBC A;  4E5R A;  4REX A;  3KAC A;  2F21 A;  3PA7 A;  3UQA A;  1HXV A;  2DJY A;  2EZ5 W;  3NTP A;  2IF4 A;  3KAD A;  3GPK A;  4ODK A;  2ZR6 A;  1R9H A;  2N87 A;  2ZAJ A;  2ZQV A;  3I6C A;  2YSG A;  4U86 A;  2L2S A;  2LKN A;  1WR7 A;  2MDI A;  2LPV A;  2XP4 A;  2YSH A;  3OOB A;  4LAV A;  1FD9 A;  1Q6U A;  2Q5A A;  4ODQ A;  2ITK A;  3O5R A;  2FKE A;  2XP5 A;  2XP3 A;  1FKJ A;  1K9Q A;  2M2A A;  2MLX A;  3O5K A;  1Q1C A;  4DRI A;  2ZR5 A;  4DRN A;  1FKG A;  4DZ2 A;  1ZK6 A;  4DZ3 A;  1PIN A;  3O5J A;  4ODR A;  2KXQ A;  2RSE A;  1D7I A;  2DG4 A;  3IHZ A;  4JFJ A;  5GPG A;  2RUC A;  3O5M A;  3KAI A;  1JMQ A;  4J4O A;  1I5H W;  2MNT A;  4JFK A;  4NNR A;  3M7N A;  4ODL A;  3CGM A;  3O5P A;  1WMV A;  4DRP A;  1EQ3 A;  2KGJ A;  2YSB A;  1FKR A;  3ODK A;  2K8I A;  4W9P A;  4TW8 A;  4QT3 A;  4DRJ A;  5HKG A;  3O5F A;  3UQI A;  3TC5 A;  2PV2 A;  5BXJ A;  3IK8 A;  1EG3 A;  1NSG A;  2MLY A;  3FAP A;  3KZ7 A;  4G50 A;  1JNS A;  2M3O W;  1J4I A;  2RQS A;  2KO7 A;  4ITZ A;  1D6O A;  1A7X A;  4TW6 A;  2XP9 A;  3O5L A;  3H9R B;  2JXW A;  2VN1 A;  3IKG A;  3JYJ A;  1BL4 A;  4C02 B;  1ZCN A;  5HTG A;  1F40 A;  3KAH A;  4DRO A;  1YW5 A;  4JFI A;  4BF8 A;  4DRK A;  1W26 A;  3LE4 A;  2RE3 A;  5CQ2 A;  1FKI A;  1Y0O A;  4GIV A;  4GGQ A;  4W9Q A;  4DRH A;  1P5Q A;  4DRQ A;  4O2T A;  2KI3 A;  4IQ2 A;  3MDY B;  1JVW A;  2RUQ A;  2LAJ A;  2FAP A;  2UZ5 A;  4LAY A;  2XP6 A;  1EYM A;  1D7J A;  2AWG A;  2OFN A;  3NRK A;  3L4H A;  2E45 A;  4ODO A;  1K9R A;  1FKB A;  2KFW A;  2KR7 A;  5DIV A;  4DRM A;  5HT1 A;  3KAB A;  4MSP A;  3WH0 A;  3UQB A;  1FJD A;  2Y78 A;  4U85 A;  1FKL A;  1BKF A;  2DMV A;  3EY6 A;  4ODM A;  3O5I A;  5I98 A;  3NI6 A;  2PPN A;  2DK7 A;  3KAF A;  4LAX A;  1O6W A;  4TX0 A;  3VAW A;  5B8I C;  1J4R A;  5D75 A;  2DK1 A;  2PPO A;  2ZR4 A;  1F8A B;  2LJ4 A;  2DWV A;  2D9F A;  3O5E A;  5HUA A;  2JMF A;  4TW7 A;  2M1I A;  2MPH A;  3PRD A;  3CNG A;  4JYS A;  3UF8 A;  2XP7 A;  1YAT A;  4G2P A;  4JFM A;  5AHT A;  4JFL A;  3RGC A;  3UI6 A;  1L1P A;  1ROT A;  3O5D A;  3M85 A;  2DG9 A;  4TYO A;  2PV3 A;  3UI4 A;  4FN2 A;  3O5O A;  2F2D A;  3UI5 A;  3B7X A;  1ROU A;  4IQC A;  3KAG A;  2XPB A;  3PRB A;  1Q6H A;  4N19 A;  5HW8 A;  1JNT A;  1B6C A;  5DIT A;  1FKF A;  2RUD A;  3KCE A;  1FKH A;  2M8J A;  3JXV A;  3JYM A;  4QIB A;  2F4E A;  3TDB A;  2ZQU A;  1FKS A;  1QPF A;  2DG3 A;  1TK7 A;  1FKD A;  4ODP A;  5J6E A;  2XP8 A;  2M8I A;  1QPL A;  1NMW A;  2BA1 A;  2MF9 A;  1Q6I A;  1M5Y A;  4FAP A;  1FKT A;  2ZQT A;  2LGO A;  4W9O A;  2RUR A;  4DT4 A;  4R0X A;  1NMV A;  2YSI A;  5HW6 A;  3IKD A;  2JV4 A;  4QT2 A;  4LAW A;  2L4J A;  2PPP A;  2M08 A;  4J4N A;  1FKK A;  2XPA A;  4MGV A;  1QZ2 A;  5DIU A;  3RFW A; 
#chains in the Genus database with same CATH topology
 1T11 A;  4TNS A;  3ARR A;  2F23 A;  3CHE A;  4Z2J A;  4DH0 A;  3ARP A;  3TCZ A;  2B5U B;  1HKK A;  1FFR A;  4Z2H A;  2IF4 A;  3GPK A;  4ODK A;  1R9H A;  3I6C A;  2ZQV A;  2L2S A;  1WR7 A;  2LPV A;  2WM0 A;  3BXW A;  4AY1 A;  1ZB5 A;  2ITK A;  2DSW A;  1FKJ A;  2DT3 A;  4GLX A;  1FFQ A;  4WJX A;  4ODL A;  4WKH A;  1H0I A;  4DRP A;  1E6Z A;  1OGB A;  4WIW A;  1E6R A;  1NWT A;  2ETN A;  5HKG A;  2FDM A;  1EG3 A;  4G50 A;  2DPE A;  2MLY A;  1UR9 A;  1J4I A;  4ITZ A;  1NWU A;  3OA5 A;  4TW6 A;  3O5L A;  4S3K A;  2VN1 A;  3MQH A;  1BL4 A;  1W1P A;  3KAH A;  4DWS D;  4DRO A;  1YW5 A;  4DRK A;  5JH8 A;  1HKI A;  2KI3 A;  4LAY A;  2RUQ A;  2FAP A;  1NWS A;  1EYM A;  1D7J A;  1TFV A;  4P8U A;  3BMB A;  5DIV A;  1WNO A;  5DF0 A;  3UQB A;  3WD3 A;  1FKL A;  1BKF A;  2PN0 A;  2DMV A;  2DSU A;  3O5I A;  3ARW A;  2PPN A;  5B8I C;  3PR9 A;  1J4R A;  3B8S A;  1EDQ A;  5D75 A;  4ZPW R;  4KQZ A;  2AOS A;  1XHG A;  4TW7 A;  2MPH A;  3PRD A;  3WQV A;  1YAT A;  3PRA A;  3UI6 A;  5AHT A;  1HKJ A;  3ART A;  3WQW A;  3O5D A;  4FN2 A;  2F2D A;  5HW8 A;  1ROU A;  4IQC A;  3KAG A;  3PRB A;  1ITX A;  3MQG A;  4XAK A;  3KCE A;  2OWO A;  1RD6 A;  1FKD A;  1EHN A;  1HKM A;  5J6E A;  1FLC A;  5E66 A;  3LKX A;  2BA1 A;  1ZBW A;  4MNL A;  2MF9 A;  4FAP A;  4P8W A;  4P8X A;  2RUR A;  3IKD A;  2JV4 A;  4LAW A;  3WIJ A;  1FKK A;  1UR8 A;  1OGG A;  1U79 A;  4QZV B;  1C9H A;  1X6N A;  4DIP A;  4MNK A;  1ZBK A;  2VCD A;  5HWB A;  4Q7N A;  4URI A;  2Y8N B;  1FAP A;  2JZV A;  1J4H A;  3ALG A;  1TCO C;  3ARS A;  3O5G A;  4ZPT R;  3WD2 A;  2PV1 A;  2PBC A;  2DJY A;  3FSB A;  3NTP A;  5E65 A;  2ZR6 A;  1W1V A;  2ZAJ A;  2O92 A;  5DEZ A;  3PQH A;  3CHF A;  3OOB A;  1H0G A;  4LAV A;  4Z2G A;  4ODQ A;  1XRV A;  2XP5 A;  2XP3 A;  1K9Q A;  2M2A A;  4DRI A;  1HJW A;  4KR0 B;  2G8Z A;  2KXQ A;  4JFK A;  4J4O A;  4NNR A;  1I5H W;  3WD4 A;  1E44 A;  3CGM A;  2WAE A;  2YSB A;  5E64 A;  1ZBV A;  1LQ0 A;  3CHD A;  3ODK A;  3WD0 A;  4TW8 A;  3AQU A;  3ARV A;  4QT3 A;  3ARX A;  4DRJ A;  3O5F A;  3UQI A;  2PV2 A;  1JNS A;  3B9E A;  4L72 B;  2RQS A;  1D6O A;  1SR0 A;  3IKG A;  2JXW A;  5DO2 A;  1ZBC A;  1F40 A;  1ZCN A;  1W26 A;  4GIV A;  1JCH B;  1ZU8 A;  4IQ2 A;  4A0T A;  4ZPV R;  3ARY A;  1JVW A;  2UZ5 A;  3GU0 A;  4C02 B;  2AWG A;  2DT0 A;  1L1P A;  3EIP A;  1K9R A;  1GOI A;  2KR7 A;  1W1Y A;  5HT1 A;  3KAB A;  4MSP A;  2Y78 A;  1OWQ A;  3QOK A;  4W5U A;  2ZR4 A;  1F8A B;  2IUZ A;  4MTV A;  1TR8 A;  4JYS A;  3UF8 A;  4JFM A;  1WAW A;  1ROT A;  3M85 A;  4TYO A;  3UI4 A;  3O5O A;  4P8V A;  3B7X A;  1J6Y A;  1Q6H A;  1W9U A;  2RUD A;  3JXV A;  4Z2K A;  4QIB A;  4ODP A;  3FY1 A;  1NWR A;  3B9D A;  1Q6I A;  4WK9 A;  1FKT A;  3RM4 A;  2B31 A;  2A3E A;  1NMV A;  4QT2 A;  1W1T A;  4IPX A;  1KT0 A;  3CGN A;  4ML4 A;  1KT1 A;  2KE0 A;  4S3J A;  5E5W A;  3O5Q A;  5HWC A;  2A3A A;  2MLZ A;  1IX5 A;  4U84 A;  3KAC A;  3PA7 A;  1HXV A;  2F21 A;  5U47 A;  4U86 A;  3RME A;  2MDI A;  2XP4 A;  3G6L A;  1FD9 A;  4NZC A;  1Q6U A;  2Q5A A;  2YBT A;  2FKE A;  3O5R A;  4A0U A;  4PTM A;  2MLX A;  2G41 A;  3O5K A;  2ZR5 A;  4DRN A;  1FKG A;  4DZ2 A;  1ZK6 A;  4DZ3 A;  3O5J A;  1JNE A;  4WKA A;  1D2K A;  2DG4 A;  3IHZ A;  4JFJ A;  3O5M A;  3KAI A;  1JMQ A;  1CTN A;  2MNT A;  3AS0 A;  3M7N A;  1HJV A;  1WMV A;  1LJY A;  1EQ3 A;  2WK2 A;  2WAD A;  1FKR A;  2K8I A;  1RP5 A;  2A3B A;  5BXJ A;  1E9L A;  3ARO A;  4MAV A;  1LL7 A;  2KO7 A;  1A7X A;  5GQB A;  2XP9 A;  3WL1 A;  3JYJ A;  4LGX A;  5HTG A;  5E62 A;  4HBO A;  3LE4 A;  5CQ2 A;  4GGQ A;  1P5Q A;  2YAJ B;  4DWS A;  4DRQ A;  1EIB A;  3MDY B;  1GPF A;  3CHC A;  2XP6 A;  4ODO A;  3NRK A;  1FKB A;  2KFW A;  2DSV A;  4Z2I A;  3EY6 A;  4ODM A;  1E15 A;  3ARZ A;  3NI6 A;  3KAF A;  4TX0 A;  3VAW A;  1O6W A;  1HJX A;  2DT1 A;  3ARQ A;  2PPO A;  1GUV A;  3ARU A;  4DWS B;  2LJ4 A;  2D9F A;  1LL4 A;  3FSC A;  2M1I A;  3CNG A;  3AS3 A;  4G2P A;  4JFL A;  4MNJ A;  2A3C A;  3UI5 A;  4HBE A;  2XPB A;  3MCB B;  4N19 A;  3RM8 A;  1JNT A;  5DIT A;  3GTY X;  1FKF A;  1SYT A;  1FKH A;  2M8J A;  3FXY A;  3JYM A;  2F4E A;  2ZQU A;  1TK7 A;  1GRJ A;  2M8I A;  1QPL A;  1NMW A;  1M5Y A;  2LGO A;  4W9O A;  4DT4 A;  2WLZ A;  1E6N A;  2L4J A;  2WLY A;  5DIU A;  4DWS C;  3RFW A;  1WB0 A;  1N1A A;  2PI6 A;  1D7H A;  4MNM A;  3LUO A;  4ODN A;  5HW7 A;  2YBU A;  2JX8 A;  1E6P A;  1EG4 A;  2YSF A;  1PBK A;  2ZQS A;  1X6L A;  2QRV A;  4E5R A;  4REX A;  3UQA A;  2EZ5 W;  3B9A A;  3KAD A;  2N87 A;  1ZL1 A;  2YSG A;  4UDM A;  1W9V A;  3CZ8 A;  2LKN A;  2YSH A;  4Q22 A;  2P4V A;  3LKX B;  4Z2L A;  4IT4 A;  1O6I A;  2ESC A;  1Q1C A;  1PIN A;  2DT2 A;  4ODR A;  2RSE A;  1D7I A;  5GPG A;  2RUC A;  4ZS6 A;  3WL0 A;  3O5P A;  2KGJ A;  3FS8 A;  4W9P A;  3TC5 A;  3IK8 A;  3KZ7 A;  1NSG A;  3FAP A;  2M3O W;  3AS1 A;  4R5E A;  3H9R B;  4L3N A;  4JFI A;  4BF8 A;  4IT6 A;  4DRH A;  2RE3 A;  1FKI A;  1Y0O A;  1JND A;  4W9Q A;  4O2T A;  2LAJ A;  1VF8 A;  3CH9 A;  2OFN A;  3G6M A;  3L4H A;  2E45 A;  1LG1 A;  3AS2 A;  4DRM A;  2EUL A;  1FJD A;  3WH0 A;  4U85 A;  3W4R A;  4HAR A;  5I98 A;  1W9P A;  2DK7 A;  1NH6 A;  4LAX A;  1KFW A;  3RM9 A;  5HUA A;  2DK1 A;  3O5E A;  2DWV A;  2DSZ A;  2JMF A;  4MPK A;  1LL6 A;  2XP7 A;  1LG2 A;  3RGC A;  2O9O A;  2DG9 A;  2PV3 A;  4NSB A;  3WD1 A;  5GPR A;  1B6C A;  5HBF A;  1K9T A;  3TDB A;  3WKZ A;  1FKS A;  1QPF A;  2DG3 A;  2XP8 A;  4WKF A;  2ZQT A;  5HW6 A;  4R0X A;  2YSI A;  2QF8 A;  3MCB A;  2PPP A;  2M08 A;  4J4N A;  2XPA A;  4MGV A;  1QZ2 A;  3ALF A;  2OLH A; 
#chains in the Genus database with same CATH homology
 1T11 A;  4TNS A;  3ARR A;  3CHE A;  4Z2J A;  4DH0 A;  3ARP A;  3TCZ A;  1HKK A;  1FFR A;  4Z2H A;  2IF4 A;  3GPK A;  4ODK A;  1R9H A;  3I6C A;  2ZQV A;  2L2S A;  1WR7 A;  2LPV A;  2WM0 A;  3BXW A;  4AY1 A;  1ZB5 A;  2ITK A;  2DSW A;  1FKJ A;  2DT3 A;  4GLX A;  1FFQ A;  4WJX A;  4ODL A;  4WKH A;  1H0I A;  4DRP A;  1E6Z A;  1OGB A;  4WIW A;  1E6R A;  1NWT A;  5HKG A;  2FDM A;  1EG3 A;  4G50 A;  2DPE A;  2MLY A;  1UR9 A;  1J4I A;  4ITZ A;  1NWU A;  3OA5 A;  4TW6 A;  3O5L A;  4S3K A;  2VN1 A;  3MQH A;  1BL4 A;  1W1P A;  3KAH A;  4DWS D;  4DRO A;  1YW5 A;  4DRK A;  5JH8 A;  1HKI A;  2KI3 A;  4LAY A;  2RUQ A;  2FAP A;  1NWS A;  1EYM A;  1D7J A;  1TFV A;  4P8U A;  5DIV A;  1WNO A;  5DF0 A;  3UQB A;  3WD3 A;  1FKL A;  1BKF A;  2DMV A;  2DSU A;  3O5I A;  3ARW A;  2PPN A;  5B8I C;  3PR9 A;  1J4R A;  3B8S A;  1EDQ A;  5D75 A;  4ZPW R;  4KQZ A;  2AOS A;  1XHG A;  4TW7 A;  2MPH A;  3PRD A;  3WQV A;  1YAT A;  3PRA A;  3UI6 A;  5AHT A;  1HKJ A;  3ART A;  3WQW A;  3O5D A;  4FN2 A;  2F2D A;  5HW8 A;  1ROU A;  4IQC A;  3KAG A;  3PRB A;  1ITX A;  3MQG A;  4XAK A;  3KCE A;  2OWO A;  1RD6 A;  1FKD A;  1EHN A;  1HKM A;  5J6E A;  1FLC A;  5E66 A;  3LKX A;  2BA1 A;  1ZBW A;  4MNL A;  2MF9 A;  4FAP A;  4P8W A;  4P8X A;  2RUR A;  3IKD A;  2JV4 A;  4LAW A;  3WIJ A;  1FKK A;  1UR8 A;  1OGG A;  1U79 A;  4QZV B;  1C9H A;  1X6N A;  4DIP A;  4MNK A;  1ZBK A;  2VCD A;  5HWB A;  4Q7N A;  4URI A;  2Y8N B;  1FAP A;  2JZV A;  1J4H A;  3ALG A;  1TCO C;  3ARS A;  3O5G A;  4ZPT R;  3WD2 A;  2PV1 A;  2PBC A;  2DJY A;  3FSB A;  3NTP A;  5E65 A;  2ZR6 A;  1W1V A;  2ZAJ A;  2O92 A;  5DEZ A;  3PQH A;  3CHF A;  3OOB A;  1H0G A;  4LAV A;  4Z2G A;  4ODQ A;  1XRV A;  2XP5 A;  2XP3 A;  1K9Q A;  2M2A A;  4DRI A;  1HJW A;  4KR0 B;  2G8Z A;  2KXQ A;  4JFK A;  4J4O A;  4NNR A;  1I5H W;  3WD4 A;  3CGM A;  2WAE A;  2YSB A;  5E64 A;  1ZBV A;  1LQ0 A;  3CHD A;  3ODK A;  3WD0 A;  4TW8 A;  3AQU A;  3ARV A;  4QT3 A;  3ARX A;  4DRJ A;  3O5F A;  3UQI A;  2PV2 A;  1JNS A;  3B9E A;  4L72 B;  2RQS A;  1D6O A;  1SR0 A;  3IKG A;  2JXW A;  5DO2 A;  1ZBC A;  1F40 A;  1ZCN A;  1W26 A;  4GIV A;  1ZU8 A;  4IQ2 A;  4A0T A;  4ZPV R;  3ARY A;  1JVW A;  2UZ5 A;  4C02 B;  2AWG A;  2DT0 A;  1L1P A;  1K9R A;  1GOI A;  2KR7 A;  1W1Y A;  5HT1 A;  3KAB A;  4MSP A;  2Y78 A;  1OWQ A;  3QOK A;  4W5U A;  2ZR4 A;  1F8A B;  2IUZ A;  4MTV A;  1TR8 A;  4JYS A;  3UF8 A;  4JFM A;  1WAW A;  1ROT A;  3M85 A;  4TYO A;  3UI4 A;  3O5O A;  4P8V A;  3B7X A;  1J6Y A;  1Q6H A;  1W9U A;  2RUD A;  3JXV A;  4Z2K A;  4QIB A;  4ODP A;  3FY1 A;  1NWR A;  3B9D A;  1Q6I A;  4WK9 A;  1FKT A;  3RM4 A;  2B31 A;  2A3E A;  1NMV A;  4QT2 A;  1W1T A;  4IPX A;  1KT0 A;  3CGN A;  4ML4 A;  1KT1 A;  2KE0 A;  4S3J A;  5E5W A;  3O5Q A;  5HWC A;  2A3A A;  2MLZ A;  1IX5 A;  4U84 A;  3KAC A;  3PA7 A;  1HXV A;  2F21 A;  5U47 A;  4U86 A;  3RME A;  2MDI A;  2XP4 A;  3G6L A;  1FD9 A;  4NZC A;  1Q6U A;  2Q5A A;  2YBT A;  2FKE A;  3O5R A;  4A0U A;  4PTM A;  2MLX A;  2G41 A;  3O5K A;  2ZR5 A;  4DRN A;  1FKG A;  4DZ2 A;  1ZK6 A;  4DZ3 A;  3O5J A;  1JNE A;  4WKA A;  1D2K A;  2DG4 A;  3IHZ A;  4JFJ A;  3O5M A;  3KAI A;  1JMQ A;  1CTN A;  2MNT A;  3AS0 A;  3M7N A;  1HJV A;  1WMV A;  1LJY A;  1EQ3 A;  2WK2 A;  2WAD A;  1FKR A;  2K8I A;  1RP5 A;  2A3B A;  5BXJ A;  1E9L A;  3ARO A;  4MAV A;  1LL7 A;  2KO7 A;  1A7X A;  5GQB A;  2XP9 A;  3WL1 A;  3JYJ A;  4LGX A;  5HTG A;  5E62 A;  4HBO A;  3LE4 A;  5CQ2 A;  4GGQ A;  1P5Q A;  2YAJ B;  4DWS A;  4DRQ A;  1EIB A;  3MDY B;  1GPF A;  3CHC A;  2XP6 A;  4ODO A;  3NRK A;  1FKB A;  2KFW A;  2DSV A;  4Z2I A;  3EY6 A;  4ODM A;  1E15 A;  3ARZ A;  3NI6 A;  3KAF A;  4TX0 A;  3VAW A;  1O6W A;  1HJX A;  2DT1 A;  3ARQ A;  3ARU A;  1GUV A;  2PPO A;  4DWS B;  2LJ4 A;  2D9F A;  1LL4 A;  3FSC A;  2M1I A;  3CNG A;  3AS3 A;  4G2P A;  4JFL A;  4MNJ A;  2A3C A;  3UI5 A;  4HBE A;  2XPB A;  3MCB B;  4N19 A;  3RM8 A;  1JNT A;  5DIT A;  1FKF A;  1SYT A;  1FKH A;  2M8J A;  3FXY A;  3JYM A;  2F4E A;  2ZQU A;  1TK7 A;  2M8I A;  1QPL A;  1NMW A;  1M5Y A;  2LGO A;  4W9O A;  4DT4 A;  2WLZ A;  1E6N A;  2L4J A;  2WLY A;  5DIU A;  4DWS C;  3RFW A;  1WB0 A;  1N1A A;  2PI6 A;  1D7H A;  4MNM A;  3LUO A;  4ODN A;  5HW7 A;  2YBU A;  2JX8 A;  1E6P A;  1EG4 A;  2YSF A;  1PBK A;  2ZQS A;  1X6L A;  2QRV A;  4E5R A;  4REX A;  3UQA A;  2EZ5 W;  3B9A A;  3KAD A;  2N87 A;  1ZL1 A;  2YSG A;  1W9V A;  3CZ8 A;  2LKN A;  2YSH A;  4Q22 A;  3LKX B;  4Z2L A;  4IT4 A;  1O6I A;  2ESC A;  1Q1C A;  1PIN A;  2DT2 A;  4ODR A;  2RSE A;  1D7I A;  5GPG A;  2RUC A;  4ZS6 A;  3WL0 A;  3O5P A;  2KGJ A;  3FS8 A;  4W9P A;  3TC5 A;  3IK8 A;  3KZ7 A;  1NSG A;  3FAP A;  2M3O W;  3AS1 A;  4R5E A;  3H9R B;  4L3N A;  4JFI A;  4BF8 A;  4IT6 A;  4DRH A;  2RE3 A;  1FKI A;  1Y0O A;  1JND A;  4W9Q A;  4O2T A;  2LAJ A;  1VF8 A;  3CH9 A;  2OFN A;  3G6M A;  3L4H A;  2E45 A;  1LG1 A;  3AS2 A;  4DRM A;  1FJD A;  3WH0 A;  4U85 A;  3W4R A;  4HAR A;  5I98 A;  1W9P A;  2DK7 A;  1NH6 A;  4LAX A;  1KFW A;  3RM9 A;  5HUA A;  2DK1 A;  3O5E A;  2DWV A;  2DSZ A;  2JMF A;  4MPK A;  1LL6 A;  2XP7 A;  1LG2 A;  3RGC A;  2O9O A;  2DG9 A;  2PV3 A;  4NSB A;  3WD1 A;  5GPR A;  1B6C A;  5HBF A;  1K9T A;  3TDB A;  3WKZ A;  1FKS A;  1QPF A;  2DG3 A;  2XP8 A;  4WKF A;  2ZQT A;  5HW6 A;  4R0X A;  2YSI A;  2QF8 A;  3MCB A;  2PPP A;  2M08 A;  4J4N A;  2XPA A;  4MGV A;  1QZ2 A;  3ALF A;  2OLH A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...