4QIBA

Oxidation-mediated inhibition of the peptidyl-prolyl isomerase pin1
Total Genus 39
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
39
sequence length
157
structure length
144
Chain Sequence
LPPGWEKAMSRSSGRVYYFNHITNASQWERPSEPARVRCSHLLVKHSQSRRPSSWRQEKITRTKEEALELINGYIQKIKSGEEDFESLASQFSDSSAKARGDLGAFSRGQMQKPFEDASFALRTGEMSGPVFTDSGIHIILRTE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Peptidyl-prolyl cis-trans isomerase NIMA-interacting 1
publication title Peroxide-mediated oxidation and inhibition of the peptidyl-prolyl isomerase Pin1.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Isomerase
total genus 39
structure length 144
sequence length 157
ec nomenclature ec 5.2.1.8: Peptidylprolyl isomerase.
pdb deposition date 2014-05-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00397 WW WW domain
A PF00639 Rotamase PPIC-type PPIASE domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.20.70.10 Mainly Beta Single Sheet Ubiquitin Ligase Nedd4; Chain: W; Ubiquitin Ligase Nedd4; Chain: W; 4qibA01
3.10.50.40 Alpha Beta Roll Chitinase A; domain 3 Chitinase A; domain 3 4qibA02
5HW8A 2JXWA 4QIBA 4DRNA 3O5EA 2RUCA 1L1PA 1QPLA 1YATA 2PPPA 4REXA 1Q6UA 4ODPA 5HUAA 2LAJA 1BKFA 2PV1A 3GPKA 3O5KA 2Q5AA 2XP9A 5HT1A 3UQAA 3UI6A 2M8JA 1Y0OA 3H9RB 3KAFA 1TK7A 5HWCA 3KACA 4TYOA 2DG4A 1NMVA 3UQIA 4N19A 1FJDA 1D7HA 1QPFA 2LJ4A 4TW8A 3WH0A 2ZR6A 2UZ5A 2YSGA 1Q6IA 4GIVA 4W9OA 3O5DA 3NI6A 5CQ2A 3UQBA 2L4JA 2DWVA 2M8IA 3NRKA 2K8IA 2KI3A 4C02B 2KXQA 4J4OA 1PBKA 2F2DA 2M1IA 3RFWA 2JV4A 1WR7A 2PPOA 5GPGA 2XP7A 2XP5A 3IK8A 1PINA 2JMFA 2ZQTA 2RSEA 3NTPA 5B8IC 3B7XA 3MDYB 4LAXA 3ODKA 4J4NA 1JVWA 1B6CA 3KCEA 5DIVA 3UF8A 3TCZA 1JMQA 2PV3A 4ODKA 2RURA 1TCOC 4E5RA 3O5IA 2ZR4A 2DJYA 1JNSA 2DMVA 5DITA 2DG9A 4DRJA 4DRPA 2D9FA 2ZQUA 2MLYA 1F40A 3CNGA 1FD9A 3KADA 2F4EA 4DROA 4JFLA 4TX0A 2YSBA 3IKDA 1EG3A 1F8AB 2ZAJA 2ZQVA 3OOBA 4TW7A 4LAWA 4ODLA 1FKBA 2XPAA 1FKFA 3KAHA 2JX8A 2DK1A 1ROTA 4DT4A 1FKIA 1K9RA 3VAWA 2MDIA 4DRMA 3TDBA 1R9HA 4DZ2A 5D75A 3LE4A 2LGOA 1BL4A 2LPVA 1EYMA 2OFNA 2ITKA 1NMWA 2N87A 4LAYA 2XPBA 4BF8A 1C9HA 1ZCNA 2F21A 3RGCA 4ODOA 3O5PA 4FAPA 4JYSA 2XP3A 5J6EA 1FKLA 3I6CA 4ODQA 4ITZA 3PA7A 2KGJA 4JFKA 4ODMA 1FKTA 4DIPA 2FKEA 3O5OA 1D7JA 4ODNA 4G50A 4ODRA 2ZQSA 1NSGA 1P5QA 3O5GA 3CGMA 1QZ2A 2JZVA 2FAPA 1FKJA 4G2PA 2XP6A 2XP8A 1Q1CA 4JFIA 3PRBA 2DG3A 4JFMA 2YSFA 5I98A 1D6OA 2VCDA 4QT2A 4DRKA 1FKSA 3M7NA 5HW7A 1J4IA 2VN1A 3LUOA 3IHZA 4MSPA 1YW5A 1W26A 4U85A 4DRIA 4IPXA 5HWBA 2EZ5W 2MF9A 4W9PA 4IQCA 4O2TA 1ROUA 1N1AA 5BXJA 2L2SA 1FKDA 4FN2A 1K9QA 3CGNA 2RUQA 3KABA 3O5RA 3O5MA 2PV2A 5HTGA 1Q6HA 1I5HW 1FKKA 2IF4A 1T11A 3TC5A 1FAPA 4IQ2A 3L4HA 4NNRA 1JNTA 2MLXA 2XP4A 2RUDA 3IKGA 3PRDA 4DRHA 1ZK6A 3O5FA 4GGQA 1J4RA 1EG4A 5HKGA 1J4HA 2KFWA 2YSHA 2PBCA 3JYJA 2KR7A 2DK7A 3O5JA 3FAPA 2M08A 1M5YA 4TNSA 4DZ3A 2AWGA 5AHTA 4TW6A 4JFJA 3O5QA 2MLZA 4DH0A 2ZR5A 2MPHA 2PPNA 1HXVA 4MGVA 2Y78A 1A7XA 3UI5A 2YSIA 4W9QA 1D7IA 1WMVA 2M3OW 1J6YA 3KAIA 2M2AA 3O5LA 3KZ7A 5HW6A 4R0XA 3JXVA 1U79A 2RE3A 4LAVA 4U86A 1EQ3A 1FKGA 2MNTA 1KT0A 3EY6A 5DIUA 1KT1A 3JYMA 1O6WA 2LKNA 4QT3A 2E45A 3UI4A 2KO7A 1FKRA 3KAGA 4DRQA 2KE0A 4U84A 3M85A 2BA1A 1FKHA 2RQSA
chains in the Genus database with same CATH superfamily
2OWOA 5HW8A 2JXWA 1FFQA 4QIBA 4DRNA 3CHFA 1HKKA 3O5EA 4MNMA 1GUVA 2RUCA 3ARQA 1L1PA 1QPLA 3ARRA 1YATA 1LL7A 2PPPA 1ZB5A 4QZVB 4REXA 4HARA 1Q6UA 3ARSA 4ODPA 2A3AA 2WLYA 3ALGA 1E6ZA 4MTVA 4DWSC 5HUAA 2LAJA 1BKFA 3LKXB 2PV1A 3GPKA 1X6LA 3AS1A 3O5KA 4NZCA 2Q5AA 2XP9A 5HT1A 3UQAA 3UI6A 2M8JA 1Y0OA 3H9RB 3KAFA 1TK7A 4L3NA 5HWCA 3KACA 4TYOA 2DG4A 1LJYA 1NMVA 3UQIA 4N19A 1FJDA 4L72B 3ARTA 1D7HA 1QPFA 3FY1A 4DWSA 2LJ4A 2IUZA 1HJWA 3WD2A 4TW8A 5DF0A 3WH0A 1LG2A 3ALFA 2ZR6A 2UZ5A 2YSGA 3RMEA 1Q6IA 4GIVA 2Y8NB 1OGGA 4MNJA 4W5UA 4W9OA 3WL0A 3O5DA 4R5EA 3NI6A 2DSZA 5CQ2A 3ARZA 3UQBA 2L4JA 2DWVA 3ARXA 4Z2KA 1SYTA 3WKZA 4Z2GA 2M8IA 3NRKA 3FS8A 5E5WA 5DEZA 2K8IA 2KI3A 4C02B 2KXQA 4J4OA 1HKIA 1RP5A 1PBKA 2F2DA 2M1IA 1NWSA 4GLXA 3RFWA 2OLHA 2JV4A 1JCHB 1WR7A 3PRAA 2PPOA 1ZBVA 1W1YA 5GPGA 3LKXA 1WNOA 2XP7A 2FDMA 1KFWA 2XP5A 3IK8A 3OA5A 1PINA 2JMFA 2ZQTA 2P4VA 2RSEA 2ETNA 1FLCA 2DT0A 3NTPA 5B8IC 1W1PA 3B7XA 3MDYB 1CTNA 2DT3A 4LAXA 3ODKA 4J4NA 1JVWA 2B31A 1E44A 3AS2A 1B6CA 2O9OA 3KCEA 1W1VA 5DIVA 3UF8A 3TCZA 1JMQA 2PV3A 4ODKA 2RURA 1VF8A 2EULA 1TCOC 1OWQA 1FFRA 4E5RA 5E65A 3O5IA 2ZR4A 2DJYA 3AS3A 1JNSA 1LG1A 2DMVA 3CHDA 3WQWA 5DITA 2DG9A 4DRJA 2G8ZA 4ZS6A 4DRPA 2D9FA 2ZQUA 2MLYA 1F40A 2PI6A 3RM9A 3CNGA 1FD9A 3KADA 1HKJA 2F4EA 4DROA 4JFLA 1UR8A 1ZU8A 4TX0A 2YSBA 3IKDA 1EG3A 1F8AB 2ZAJA 2ZQVA 1ZL1A 4HBOA 4URIA 1TFVA 3OOBA 3CH9A 4TW7A 4WIWA 5E64A 4LAWA 4ODLA 1FKBA 2XPAA 1FKFA 3KAHA 2JX8A 1JNDA 1OGBA 2DK1A 4MPKA 1TR8A 1ROTA 4DT4A 1FKIA 1K9RA 3VAWA 1NWRA 1ZBWA 2MDIA 4DRMA 3TDBA 1R9HA 1NWTA 1RD6A 4DZ2A 5D75A 3ARWA 3LE4A 2WM0A 2LGOA 1BL4A 5U47A 2LPVA 1EYMA 2OFNA 3MQGA 3MCBA 2ITKA 1ITXA 1NMWA 5DO2A 3WL1A 2N87A 4LAYA 2XPBA 3WQVA 4BF8A 1HKMA 1C9HA 3B8SA 1ZCNA 2F21A 2QF8A 3RGCA 1E6PA 4ODOA 3O5PA 2F23A 4FAPA 2DSUA 4JYSA 2XP3A 1K9TA 5J6EA 4AY1A 1FKLA 3I6CA 4ODQA 4ITZA 2YBUA 2YBTA 4WKFA 3PA7A 2KGJA 4JFKA 2G41A 1UR9A 4ODMA 4P8WA 1FKTA 4DIPA 2FKEA 3O5OA 1LL6A 3BMBA 1D7JA 4IT6A 1W9UA 1W9VA 4ODNA 5E62A 4G50A 4ODRA 3RM4A 2ZQSA 1NSGA 3CZ8A 1P5QA 3O5GA 3B9AA 3CGMA 1QZ2A 2JZVA 2FAPA 1FKJA 4G2PA 1GOIA 3FXYA 4ZPWR 4Q7NA 3MQHA 2XP6A 2XP8A 2DSVA 1JNEA 3CHEA 1Q1CA 1E6RA 4JFIA 3PRBA 2DG3A 4JFMA 2YSFA 4Q22A 1WAWA 5I98A 2DT2A 1D6OA 2VCDA 3MCBB 1EIBA 4Z2LA 4QT2A 4DRKA 1LQ0A 1FKSA 4LGXA 3M7NA 5HW7A 1J4IA 2VN1A 3LUOA 3PQHA 2B5UB 3IHZA 4MSPA 1YW5A 1EDQA 2DPEA 1W26A 4U85A 1E6NA 3WD1A 4DRIA 4MNKA 4IPXA 5HWBA 2EZ5W 2MF9A 4W9PA 2O92A 4IQCA 4O2TA 3QOKA 1ROUA 5GQBA 2YAJB 1XRVA 1N1AA 1HJXA 5BXJA 2L2SA 1X6NA 1FKDA 1SR0A 1W1TA 4FN2A 1K9QA 3CGNA 4S3KA 4DWSD 2RUQA 5GPRA 3KABA 3O5RA 3O5MA 2WK2A 4MAVA 4MNLA 2PV2A 5HTGA 5JH8A 1Q6HA 3AQUA 1I5HW 1W9PA 1FKKA 2WADA 1WB0A 4WK9A 2IF4A 1T11A 3WIJA 3TC5A 1FAPA 3G6MA 2WLZA 1HJVA 4IQ2A 3L4HA 1GPFA 4NNRA 1JNTA 2MLXA 3GU0A 3EIPA 2XP4A 2RUDA 3IKGA 3RM8A 3AROA 2PN0A 3PRDA 4DRHA 1ZK6A 3O5FA 4GGQA 1J4RA 4Z2HA 1EG4A 3WD3A 4UDMA 3W4RA 1J4HA 3B9DA 5HKGA 2QRVA 2KFWA 2YSHA 1XHGA 4ML4A 4ZPVR 2PBCA 2AOSA 3BXWA 2KR7A 3JYJA 2DK7A 5E66A 3AS0A 3O5JA 3FAPA 2M08A 4WKAA 1NWUA 1M5YA 3WD0A 4XAKA 4TNSA 4DZ3A 2AWGA 5AHTA 4S3JA 1H0GA 4TW6A 5HBFA 4JFJA 3O5QA 2MLZA 4Z2JA 2A3BA 3PR9A 1ZBKA 4DH0A 2ZR5A 2MPHA 4WKHA 2DT1A 2PPNA 4KR0B 4Z2IA 1HXVA 4MGVA 2Y78A 4A0TA 2WAEA 1A7XA 3UI5A 4IT4A 4P8XA 2YSIA 4W9QA 1D7IA 1WMVA 2M3OW 3GTYX 4ZPTR 1J6YA 3KAIA 2M2AA 3O5LA 1EHNA 3KZ7A 1D2KA 1O6IA 5HW6A 1ZBCA 4A0UA 1E9LA 1E15A 3CHCA 4R0XA 4PTMA 3JXVA 3FSBA 1U79A 2RE3A 4LAVA 4U86A 3ARPA 1EQ3A 1FKGA 3FSCA 2MNTA 4KQZA 1LL4A 1KT0A 3EY6A 5DIUA 3WD4A 1H0IA 1KT1A 4NSBA 4P8VA 3JYMA 3G6LA 4DWSB 1O6WA 2ESCA 2LKNA 4QT3A 2E45A 2A3EA 3UI4A 4P8UA 1NH6A 2DSWA 2KO7A 4HBEA 3ARUA 4WJXA 2A3CA 3ARVA 3B9EA 1FKRA 3KAGA 3ARYA 4DRQA 1GRJA 2KE0A 4U84A 3M85A 2BA1A 1IX5A 1FKHA 2RQSA
chains in the Genus database with same CATH topology
2OWOA 5HW8A 2JXWA 1FFQA 4QIBA 4DRNA 3CHFA 1HKKA 3O5EA 4MNMA 1GUVA 2RUCA 3ARQA 1L1PA 1QPLA 3ARRA 1YATA 1LL7A 2PPPA 1ZB5A 4QZVB 4REXA 4HARA 1Q6UA 3ARSA 4ODPA 2A3AA 2WLYA 3ALGA 1E6ZA 4MTVA 4DWSC 5HUAA 2LAJA 1BKFA 3LKXB 2PV1A 3GPKA 1X6LA 3AS1A 3O5KA 4NZCA 2Q5AA 2XP9A 5HT1A 3UQAA 3UI6A 2M8JA 1Y0OA 3H9RB 3KAFA 1TK7A 4L3NA 5HWCA 3KACA 4TYOA 2DG4A 1LJYA 1NMVA 3UQIA 4N19A 1FJDA 4L72B 3ARTA 1D7HA 1QPFA 3FY1A 4DWSA 2LJ4A 2IUZA 1HJWA 3WD2A 4TW8A 5DF0A 3WH0A 1LG2A 3ALFA 2ZR6A 2UZ5A 2YSGA 3RMEA 1Q6IA 4GIVA 2Y8NB 1OGGA 4MNJA 4W5UA 4W9OA 3WL0A 3O5DA 4R5EA 3NI6A 2DSZA 5CQ2A 3ARZA 3UQBA 2L4JA 2DWVA 3ARXA 4Z2KA 1SYTA 3WKZA 4Z2GA 2M8IA 3NRKA 3FS8A 5E5WA 5DEZA 2K8IA 2KI3A 4C02B 2KXQA 4J4OA 1HKIA 1RP5A 1PBKA 2F2DA 2M1IA 1NWSA 4GLXA 3RFWA 2OLHA 2JV4A 1WR7A 3PRAA 2PPOA 1ZBVA 1W1YA 5GPGA 3LKXA 1WNOA 2XP7A 2FDMA 1KFWA 2XP5A 3IK8A 3OA5A 1PINA 2JMFA 2ZQTA 2RSEA 1FLCA 2DT0A 3NTPA 5B8IC 1W1PA 3B7XA 3MDYB 1CTNA 2DT3A 4LAXA 3ODKA 4J4NA 1JVWA 2B31A 3AS2A 1B6CA 2O9OA 3KCEA 1W1VA 5DIVA 3UF8A 3TCZA 1JMQA 2PV3A 4ODKA 2RURA 1VF8A 1TCOC 1OWQA 1FFRA 4E5RA 5E65A 3O5IA 2ZR4A 2DJYA 3AS3A 1JNSA 1LG1A 2DMVA 3CHDA 3WQWA 5DITA 2DG9A 4DRJA 2G8ZA 4ZS6A 4DRPA 2D9FA 2ZQUA 2MLYA 1F40A 2PI6A 3RM9A 3CNGA 1FD9A 3KADA 1HKJA 2F4EA 4DROA 4JFLA 1UR8A 1ZU8A 4TX0A 2YSBA 3IKDA 1EG3A 1F8AB 2ZAJA 2ZQVA 1ZL1A 4HBOA 4URIA 1TFVA 3OOBA 3CH9A 4TW7A 4WIWA 5E64A 4LAWA 4ODLA 1FKBA 2XPAA 1FKFA 3KAHA 2JX8A 1JNDA 1OGBA 2DK1A 4MPKA 1TR8A 1ROTA 4DT4A 1FKIA 1K9RA 3VAWA 1NWRA 1ZBWA 2MDIA 4DRMA 3TDBA 1R9HA 1NWTA 1RD6A 4DZ2A 5D75A 3ARWA 3LE4A 2WM0A 2LGOA 1BL4A 5U47A 2LPVA 1EYMA 2OFNA 3MQGA 3MCBA 2ITKA 1ITXA 1NMWA 5DO2A 3WL1A 2N87A 4LAYA 2XPBA 3WQVA 4BF8A 1HKMA 1C9HA 3B8SA 1ZCNA 2F21A 2QF8A 3RGCA 1E6PA 4ODOA 3O5PA 4FAPA 2DSUA 4JYSA 2XP3A 1K9TA 5J6EA 4AY1A 1FKLA 3I6CA 4ODQA 4ITZA 2YBUA 2YBTA 4WKFA 3PA7A 2KGJA 4JFKA 2G41A 1UR9A 4ODMA 4P8WA 1FKTA 4DIPA 2FKEA 3O5OA 1LL6A 1D7JA 4IT6A 1W9UA 1W9VA 4ODNA 5E62A 4G50A 4ODRA 3RM4A 2ZQSA 1NSGA 3CZ8A 1P5QA 3O5GA 3B9AA 3CGMA 1QZ2A 2JZVA 2FAPA 1FKJA 4G2PA 1GOIA 3FXYA 4ZPWR 4Q7NA 3MQHA 2XP6A 2XP8A 2DSVA 1JNEA 3CHEA 1Q1CA 1E6RA 4JFIA 3PRBA 2DG3A 4JFMA 2YSFA 4Q22A 1WAWA 5I98A 2DT2A 1D6OA 2VCDA 3MCBB 1EIBA 4Z2LA 4QT2A 4DRKA 1LQ0A 1FKSA 4LGXA 3M7NA 5HW7A 1J4IA 2VN1A 3LUOA 3PQHA 3IHZA 4MSPA 1YW5A 1EDQA 2DPEA 1W26A 4U85A 1E6NA 3WD1A 4DRIA 4MNKA 4IPXA 5HWBA 2EZ5W 2MF9A 4W9PA 2O92A 4IQCA 4O2TA 3QOKA 1ROUA 5GQBA 2YAJB 1XRVA 1N1AA 1HJXA 5BXJA 2L2SA 1X6NA 1FKDA 1SR0A 1W1TA 4FN2A 1K9QA 3CGNA 4S3KA 4DWSD 2RUQA 5GPRA 3KABA 3O5RA 3O5MA 2WK2A 4MAVA 4MNLA 2PV2A 5HTGA 5JH8A 1Q6HA 3AQUA 1I5HW 1W9PA 1FKKA 2WADA 1WB0A 4WK9A 2IF4A 1T11A 3WIJA 3TC5A 1FAPA 3G6MA 2WLZA 1HJVA 4IQ2A 3L4HA 1GPFA 4NNRA 1JNTA 2MLXA 2XP4A 2RUDA 3IKGA 3RM8A 3AROA 3PRDA 4DRHA 1ZK6A 3O5FA 4GGQA 1J4RA 4Z2HA 1EG4A 3WD3A 5HKGA 3W4RA 1J4HA 3B9DA 2QRVA 2KFWA 2YSHA 1XHGA 4ML4A 4ZPVR 2PBCA 2AOSA 3BXWA 2KR7A 3JYJA 2DK7A 5E66A 3AS0A 3O5JA 3FAPA 2M08A 4WKAA 1NWUA 1M5YA 3WD0A 4XAKA 4TNSA 4DZ3A 2AWGA 5AHTA 4S3JA 1H0GA 4TW6A 5HBFA 4JFJA 3O5QA 2MLZA 4Z2JA 2A3BA 3PR9A 1ZBKA 4DH0A 2ZR5A 2MPHA 4WKHA 2DT1A 2PPNA 4KR0B 4Z2IA 1HXVA 4MGVA 2Y78A 4A0TA 2WAEA 1A7XA 3UI5A 4IT4A 4P8XA 2YSIA 4W9QA 1D7IA 1WMVA 2M3OW 4ZPTR 1J6YA 3KAIA 2M2AA 3O5LA 1EHNA 3KZ7A 1D2KA 1O6IA 5HW6A 1ZBCA 4A0UA 1E9LA 1E15A 3CHCA 4R0XA 4PTMA 3JXVA 3FSBA 1U79A 2RE3A 4LAVA 4U86A 3ARPA 1EQ3A 1FKGA 3FSCA 2MNTA 4KQZA 1LL4A 1KT0A 3EY6A 5DIUA 3WD4A 1H0IA 1KT1A 4NSBA 4P8VA 3JYMA 3G6LA 4DWSB 1O6WA 2ESCA 2LKNA 4QT3A 2E45A 2A3EA 3UI4A 4P8UA 1NH6A 2DSWA 2KO7A 4HBEA 3ARUA 4WJXA 2A3CA 3ARVA 3B9EA 1FKRA 3KAGA 3ARYA 4DRQA 2KE0A 4U84A 3M85A 2BA1A 1IX5A 1FKHA 2RQSA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5HW8 A;  2JXW A;  4QIB A;  4DRN A;  3O5E A;  2RUC A;  1L1P A;  1QPL A;  1YAT A;  2PPP A;  4REX A;  1Q6U A;  4ODP A;  5HUA A;  2LAJ A;  1BKF A;  2PV1 A;  3GPK A;  3O5K A;  2Q5A A;  2XP9 A;  5HT1 A;  3UQA A;  3UI6 A;  2M8J A;  1Y0O A;  3H9R B;  3KAF A;  1TK7 A;  5HWC A;  3KAC A;  4TYO A;  2DG4 A;  1NMV A;  3UQI A;  4N19 A;  1FJD A;  1D7H A;  1QPF A;  2LJ4 A;  4TW8 A;  3WH0 A;  2ZR6 A;  2UZ5 A;  2YSG A;  1Q6I A;  4GIV A;  4W9O A;  3O5D A;  3NI6 A;  5CQ2 A;  3UQB A;  2L4J A;  2DWV A;  2M8I A;  3NRK A;  2K8I A;  2KI3 A;  4C02 B;  2KXQ A;  4J4O A;  1PBK A;  2F2D A;  2M1I A;  3RFW A;  2JV4 A;  1WR7 A;  2PPO A;  5GPG A;  2XP7 A;  2XP5 A;  3IK8 A;  1PIN A;  2JMF A;  2ZQT A;  2RSE A;  3NTP A;  5B8I C;  3B7X A;  3MDY B;  4LAX A;  3ODK A;  4J4N A;  1JVW A;  1B6C A;  3KCE A;  5DIV A;  3UF8 A;  3TCZ A;  1JMQ A;  2PV3 A;  4ODK A;  2RUR A;  1TCO C;  4E5R A;  3O5I A;  2ZR4 A;  2DJY A;  1JNS A;  2DMV A;  5DIT A;  2DG9 A;  4DRJ A;  4DRP A;  2D9F A;  2ZQU A;  2MLY A;  1F40 A;  3CNG A;  1FD9 A;  3KAD A;  2F4E A;  4DRO A;  4JFL A;  4TX0 A;  2YSB A;  3IKD A;  1EG3 A;  1F8A B;  2ZAJ A;  2ZQV A;  3OOB A;  4TW7 A;  4LAW A;  4ODL A;  1FKB A;  2XPA A;  1FKF A;  3KAH A;  2JX8 A;  2DK1 A;  1ROT A;  4DT4 A;  1FKI A;  1K9R A;  3VAW A;  2MDI A;  4DRM A;  3TDB A;  1R9H A;  4DZ2 A;  5D75 A;  3LE4 A;  2LGO A;  1BL4 A;  2LPV A;  1EYM A;  2OFN A;  2ITK A;  1NMW A;  2N87 A;  4LAY A;  2XPB A;  4BF8 A;  1C9H A;  1ZCN A;  2F21 A;  3RGC A;  4ODO A;  3O5P A;  4FAP A;  4JYS A;  2XP3 A;  5J6E A;  1FKL A;  3I6C A;  4ODQ A;  4ITZ A;  3PA7 A;  2KGJ A;  4JFK A;  4ODM A;  1FKT A;  4DIP A;  2FKE A;  3O5O A;  1D7J A;  4ODN A;  4G50 A;  4ODR A;  2ZQS A;  1NSG A;  1P5Q A;  3O5G A;  3CGM A;  1QZ2 A;  2JZV A;  2FAP A;  1FKJ A;  4G2P A;  2XP6 A;  2XP8 A;  1Q1C A;  4JFI A;  3PRB A;  2DG3 A;  4JFM A;  2YSF A;  5I98 A;  1D6O A;  2VCD A;  4QT2 A;  4DRK A;  1FKS A;  3M7N A;  5HW7 A;  1J4I A;  2VN1 A;  3LUO A;  3IHZ A;  4MSP A;  1YW5 A;  1W26 A;  4U85 A;  4DRI A;  4IPX A;  5HWB A;  2EZ5 W;  2MF9 A;  4W9P A;  4IQC A;  4O2T A;  1ROU A;  1N1A A;  5BXJ A;  2L2S A;  1FKD A;  4FN2 A;  1K9Q A;  3CGN A;  2RUQ A;  3KAB A;  3O5R A;  3O5M A;  2PV2 A;  5HTG A;  1Q6H A;  1I5H W;  1FKK A;  2IF4 A;  1T11 A;  3TC5 A;  1FAP A;  4IQ2 A;  3L4H A;  4NNR A;  1JNT A;  2MLX A;  2XP4 A;  2RUD A;  3IKG A;  3PRD A;  4DRH A;  1ZK6 A;  3O5F A;  4GGQ A;  1J4R A;  1EG4 A;  5HKG A;  1J4H A;  2KFW A;  2YSH A;  2PBC A;  3JYJ A;  2KR7 A;  2DK7 A;  3O5J A;  3FAP A;  2M08 A;  1M5Y A;  4TNS A;  4DZ3 A;  2AWG A;  5AHT A;  4TW6 A;  4JFJ A;  3O5Q A;  2MLZ A;  4DH0 A;  2ZR5 A;  2MPH A;  2PPN A;  1HXV A;  4MGV A;  2Y78 A;  1A7X A;  3UI5 A;  2YSI A;  4W9Q A;  1D7I A;  1WMV A;  2M3O W;  1J6Y A;  3KAI A;  2M2A A;  3O5L A;  3KZ7 A;  5HW6 A;  4R0X A;  3JXV A;  1U79 A;  2RE3 A;  4LAV A;  4U86 A;  1EQ3 A;  1FKG A;  2MNT A;  1KT0 A;  3EY6 A;  5DIU A;  1KT1 A;  3JYM A;  1O6W A;  2LKN A;  4QT3 A;  2E45 A;  3UI4 A;  2KO7 A;  1FKR A;  3KAG A;  4DRQ A;  2KE0 A;  4U84 A;  3M85 A;  2BA1 A;  1FKH A;  2RQS A; 
#chains in the Genus database with same CATH topology
 2OWO A;  5HW8 A;  2JXW A;  1FFQ A;  4QIB A;  4DRN A;  3CHF A;  1HKK A;  3O5E A;  4MNM A;  1GUV A;  2RUC A;  3ARQ A;  1L1P A;  1QPL A;  3ARR A;  1YAT A;  1LL7 A;  2PPP A;  1ZB5 A;  4QZV B;  4REX A;  4HAR A;  1Q6U A;  3ARS A;  4ODP A;  2A3A A;  2WLY A;  3ALG A;  1E6Z A;  4MTV A;  4DWS C;  5HUA A;  2LAJ A;  1BKF A;  3LKX B;  2PV1 A;  3GPK A;  1X6L A;  3AS1 A;  3O5K A;  4NZC A;  2Q5A A;  2XP9 A;  5HT1 A;  3UQA A;  3UI6 A;  2M8J A;  1Y0O A;  3H9R B;  3KAF A;  1TK7 A;  4L3N A;  5HWC A;  3KAC A;  4TYO A;  2DG4 A;  1LJY A;  1NMV A;  3UQI A;  4N19 A;  1FJD A;  4L72 B;  3ART A;  1D7H A;  1QPF A;  3FY1 A;  4DWS A;  2LJ4 A;  2IUZ A;  1HJW A;  3WD2 A;  4TW8 A;  5DF0 A;  3WH0 A;  1LG2 A;  3ALF A;  2ZR6 A;  2UZ5 A;  2YSG A;  3RME A;  1Q6I A;  4GIV A;  2Y8N B;  1OGG A;  4MNJ A;  4W5U A;  4W9O A;  3WL0 A;  3O5D A;  4R5E A;  3NI6 A;  2DSZ A;  5CQ2 A;  3ARZ A;  3UQB A;  2L4J A;  2DWV A;  3ARX A;  4Z2K A;  1SYT A;  3WKZ A;  4Z2G A;  2M8I A;  3NRK A;  3FS8 A;  5E5W A;  5DEZ A;  2K8I A;  2KI3 A;  4C02 B;  2KXQ A;  4J4O A;  1HKI A;  1RP5 A;  1PBK A;  2F2D A;  2M1I A;  1NWS A;  4GLX A;  3RFW A;  2OLH A;  2JV4 A;  1JCH B;  1WR7 A;  3PRA A;  2PPO A;  1ZBV A;  1W1Y A;  5GPG A;  3LKX A;  1WNO A;  2XP7 A;  2FDM A;  1KFW A;  2XP5 A;  3IK8 A;  3OA5 A;  1PIN A;  2JMF A;  2ZQT A;  2P4V A;  2RSE A;  2ETN A;  1FLC A;  2DT0 A;  3NTP A;  5B8I C;  1W1P A;  3B7X A;  3MDY B;  1CTN A;  2DT3 A;  4LAX A;  3ODK A;  4J4N A;  1JVW A;  2B31 A;  1E44 A;  3AS2 A;  1B6C A;  2O9O A;  3KCE A;  1W1V A;  5DIV A;  3UF8 A;  3TCZ A;  1JMQ A;  2PV3 A;  4ODK A;  2RUR A;  1VF8 A;  2EUL A;  1TCO C;  1OWQ A;  1FFR A;  4E5R A;  5E65 A;  3O5I A;  2ZR4 A;  2DJY A;  3AS3 A;  1JNS A;  1LG1 A;  2DMV A;  3CHD A;  3WQW A;  5DIT A;  2DG9 A;  4DRJ A;  2G8Z A;  4ZS6 A;  4DRP A;  2D9F A;  2ZQU A;  2MLY A;  1F40 A;  2PI6 A;  3RM9 A;  3CNG A;  1FD9 A;  3KAD A;  1HKJ A;  2F4E A;  4DRO A;  4JFL A;  1UR8 A;  1ZU8 A;  4TX0 A;  2YSB A;  3IKD A;  1EG3 A;  1F8A B;  2ZAJ A;  2ZQV A;  1ZL1 A;  4HBO A;  4URI A;  1TFV A;  3OOB A;  3CH9 A;  4TW7 A;  4WIW A;  5E64 A;  4LAW A;  4ODL A;  1FKB A;  2XPA A;  1FKF A;  3KAH A;  2JX8 A;  1JND A;  1OGB A;  2DK1 A;  4MPK A;  1TR8 A;  1ROT A;  4DT4 A;  1FKI A;  1K9R A;  3VAW A;  1NWR A;  1ZBW A;  2MDI A;  4DRM A;  3TDB A;  1R9H A;  1NWT A;  1RD6 A;  4DZ2 A;  5D75 A;  3ARW A;  3LE4 A;  2WM0 A;  2LGO A;  1BL4 A;  5U47 A;  2LPV A;  1EYM A;  2OFN A;  3MQG A;  3MCB A;  2ITK A;  1ITX A;  1NMW A;  5DO2 A;  3WL1 A;  2N87 A;  4LAY A;  2XPB A;  3WQV A;  4BF8 A;  1HKM A;  1C9H A;  3B8S A;  1ZCN A;  2F21 A;  2QF8 A;  3RGC A;  1E6P A;  4ODO A;  3O5P A;  2F23 A;  4FAP A;  2DSU A;  4JYS A;  2XP3 A;  1K9T A;  5J6E A;  4AY1 A;  1FKL A;  3I6C A;  4ODQ A;  4ITZ A;  2YBU A;  2YBT A;  4WKF A;  3PA7 A;  2KGJ A;  4JFK A;  2G41 A;  1UR9 A;  4ODM A;  4P8W A;  1FKT A;  4DIP A;  2FKE A;  3O5O A;  1LL6 A;  3BMB A;  1D7J A;  4IT6 A;  1W9U A;  1W9V A;  4ODN A;  5E62 A;  4G50 A;  4ODR A;  3RM4 A;  2ZQS A;  1NSG A;  3CZ8 A;  1P5Q A;  3O5G A;  3B9A A;  3CGM A;  1QZ2 A;  2JZV A;  2FAP A;  1FKJ A;  4G2P A;  1GOI A;  3FXY A;  4ZPW R;  4Q7N A;  3MQH A;  2XP6 A;  2XP8 A;  2DSV A;  1JNE A;  3CHE A;  1Q1C A;  1E6R A;  4JFI A;  3PRB A;  2DG3 A;  4JFM A;  2YSF A;  4Q22 A;  1WAW A;  5I98 A;  2DT2 A;  1D6O A;  2VCD A;  3MCB B;  1EIB A;  4Z2L A;  4QT2 A;  4DRK A;  1LQ0 A;  1FKS A;  4LGX A;  3M7N A;  5HW7 A;  1J4I A;  2VN1 A;  3LUO A;  3PQH A;  2B5U B;  3IHZ A;  4MSP A;  1YW5 A;  1EDQ A;  2DPE A;  1W26 A;  4U85 A;  1E6N A;  3WD1 A;  4DRI A;  4MNK A;  4IPX A;  5HWB A;  2EZ5 W;  2MF9 A;  4W9P A;  2O92 A;  4IQC A;  4O2T A;  3QOK A;  1ROU A;  5GQB A;  2YAJ B;  1XRV A;  1N1A A;  1HJX A;  5BXJ A;  2L2S A;  1X6N A;  1FKD A;  1SR0 A;  1W1T A;  4FN2 A;  1K9Q A;  3CGN A;  4S3K A;  4DWS D;  2RUQ A;  5GPR A;  3KAB A;  3O5R A;  3O5M A;  2WK2 A;  4MAV A;  4MNL A;  2PV2 A;  5HTG A;  5JH8 A;  1Q6H A;  3AQU A;  1I5H W;  1W9P A;  1FKK A;  2WAD A;  1WB0 A;  4WK9 A;  2IF4 A;  1T11 A;  3WIJ A;  3TC5 A;  1FAP A;  3G6M A;  2WLZ A;  1HJV A;  4IQ2 A;  3L4H A;  1GPF A;  4NNR A;  1JNT A;  2MLX A;  3GU0 A;  3EIP A;  2XP4 A;  2RUD A;  3IKG A;  3RM8 A;  3ARO A;  2PN0 A;  3PRD A;  4DRH A;  1ZK6 A;  3O5F A;  4GGQ A;  1J4R A;  4Z2H A;  1EG4 A;  3WD3 A;  4UDM A;  3W4R A;  1J4H A;  3B9D A;  5HKG A;  2QRV A;  2KFW A;  2YSH A;  1XHG A;  4ML4 A;  4ZPV R;  2PBC A;  2AOS A;  3BXW A;  2KR7 A;  3JYJ A;  2DK7 A;  5E66 A;  3AS0 A;  3O5J A;  3FAP A;  2M08 A;  4WKA A;  1NWU A;  1M5Y A;  3WD0 A;  4XAK A;  4TNS A;  4DZ3 A;  2AWG A;  5AHT A;  4S3J A;  1H0G A;  4TW6 A;  5HBF A;  4JFJ A;  3O5Q A;  2MLZ A;  4Z2J A;  2A3B A;  3PR9 A;  1ZBK A;  4DH0 A;  2ZR5 A;  2MPH A;  4WKH A;  2DT1 A;  2PPN A;  4KR0 B;  4Z2I A;  1HXV A;  4MGV A;  2Y78 A;  4A0T A;  2WAE A;  1A7X A;  3UI5 A;  4IT4 A;  4P8X A;  2YSI A;  4W9Q A;  1D7I A;  1WMV A;  2M3O W;  3GTY X;  4ZPT R;  1J6Y A;  3KAI A;  2M2A A;  3O5L A;  1EHN A;  3KZ7 A;  1D2K A;  1O6I A;  5HW6 A;  1ZBC A;  4A0U A;  1E9L A;  1E15 A;  3CHC A;  4R0X A;  4PTM A;  3JXV A;  3FSB A;  1U79 A;  2RE3 A;  4LAV A;  4U86 A;  3ARP A;  1EQ3 A;  1FKG A;  3FSC A;  2MNT A;  4KQZ A;  1LL4 A;  1KT0 A;  3EY6 A;  5DIU A;  3WD4 A;  1H0I A;  1KT1 A;  4NSB A;  4P8V A;  3JYM A;  3G6L A;  4DWS B;  1O6W A;  2ESC A;  2LKN A;  4QT3 A;  2E45 A;  2A3E A;  3UI4 A;  4P8U A;  1NH6 A;  2DSW A;  2KO7 A;  4HBE A;  3ARU A;  4WJX A;  2A3C A;  3ARV A;  3B9E A;  1FKR A;  3KAG A;  3ARY A;  4DRQ A;  1GRJ A;  2KE0 A;  4U84 A;  3M85 A;  2BA1 A;  1IX5 A;  1FKH A;  2RQS A; 
#chains in the Genus database with same CATH homology
 2OWO A;  5HW8 A;  2JXW A;  1FFQ A;  4QIB A;  4DRN A;  3CHF A;  1HKK A;  3O5E A;  4MNM A;  1GUV A;  2RUC A;  3ARQ A;  1L1P A;  1QPL A;  3ARR A;  1YAT A;  1LL7 A;  2PPP A;  1ZB5 A;  4QZV B;  4REX A;  4HAR A;  1Q6U A;  3ARS A;  4ODP A;  2A3A A;  2WLY A;  3ALG A;  1E6Z A;  4MTV A;  4DWS C;  5HUA A;  2LAJ A;  1BKF A;  3LKX B;  2PV1 A;  3GPK A;  1X6L A;  3AS1 A;  3O5K A;  4NZC A;  2Q5A A;  2XP9 A;  5HT1 A;  3UQA A;  3UI6 A;  2M8J A;  1Y0O A;  3H9R B;  3KAF A;  1TK7 A;  4L3N A;  5HWC A;  3KAC A;  4TYO A;  2DG4 A;  1LJY A;  1NMV A;  3UQI A;  4N19 A;  1FJD A;  4L72 B;  3ART A;  1D7H A;  1QPF A;  3FY1 A;  4DWS A;  2LJ4 A;  2IUZ A;  1HJW A;  3WD2 A;  4TW8 A;  5DF0 A;  3WH0 A;  1LG2 A;  3ALF A;  2ZR6 A;  2UZ5 A;  2YSG A;  3RME A;  1Q6I A;  4GIV A;  2Y8N B;  1OGG A;  4MNJ A;  4W5U A;  4W9O A;  3WL0 A;  3O5D A;  4R5E A;  3NI6 A;  2DSZ A;  5CQ2 A;  3ARZ A;  3UQB A;  2L4J A;  2DWV A;  3ARX A;  4Z2K A;  1SYT A;  3WKZ A;  4Z2G A;  2M8I A;  3NRK A;  3FS8 A;  5E5W A;  5DEZ A;  2K8I A;  2KI3 A;  4C02 B;  2KXQ A;  4J4O A;  1HKI A;  1RP5 A;  1PBK A;  2F2D A;  2M1I A;  1NWS A;  4GLX A;  3RFW A;  2OLH A;  2JV4 A;  1WR7 A;  3PRA A;  2PPO A;  1ZBV A;  1W1Y A;  5GPG A;  3LKX A;  1WNO A;  2XP7 A;  2FDM A;  1KFW A;  2XP5 A;  3IK8 A;  3OA5 A;  1PIN A;  2JMF A;  2ZQT A;  2RSE A;  1FLC A;  2DT0 A;  3NTP A;  5B8I C;  1W1P A;  3B7X A;  3MDY B;  1CTN A;  2DT3 A;  4LAX A;  3ODK A;  4J4N A;  1JVW A;  2B31 A;  3AS2 A;  1B6C A;  2O9O A;  3KCE A;  1W1V A;  5DIV A;  3UF8 A;  3TCZ A;  1JMQ A;  2PV3 A;  4ODK A;  2RUR A;  1VF8 A;  1TCO C;  1OWQ A;  1FFR A;  4E5R A;  5E65 A;  3O5I A;  2ZR4 A;  2DJY A;  3AS3 A;  1JNS A;  1LG1 A;  2DMV A;  3CHD A;  3WQW A;  5DIT A;  2DG9 A;  4DRJ A;  2G8Z A;  4ZS6 A;  4DRP A;  2D9F A;  2ZQU A;  2MLY A;  1F40 A;  2PI6 A;  3RM9 A;  3CNG A;  1FD9 A;  3KAD A;  1HKJ A;  2F4E A;  4DRO A;  4JFL A;  1UR8 A;  1ZU8 A;  4TX0 A;  2YSB A;  3IKD A;  1EG3 A;  1F8A B;  2ZAJ A;  2ZQV A;  1ZL1 A;  4HBO A;  4URI A;  1TFV A;  3OOB A;  3CH9 A;  4TW7 A;  4WIW A;  5E64 A;  4LAW A;  4ODL A;  1FKB A;  2XPA A;  1FKF A;  3KAH A;  2JX8 A;  1JND A;  1OGB A;  2DK1 A;  4MPK A;  1TR8 A;  1ROT A;  4DT4 A;  1FKI A;  1K9R A;  3VAW A;  1NWR A;  1ZBW A;  2MDI A;  4DRM A;  3TDB A;  1R9H A;  1NWT A;  1RD6 A;  4DZ2 A;  5D75 A;  3ARW A;  3LE4 A;  2WM0 A;  2LGO A;  1BL4 A;  5U47 A;  2LPV A;  1EYM A;  2OFN A;  3MQG A;  3MCB A;  2ITK A;  1ITX A;  1NMW A;  5DO2 A;  3WL1 A;  2N87 A;  4LAY A;  2XPB A;  3WQV A;  4BF8 A;  1HKM A;  1C9H A;  3B8S A;  1ZCN A;  2F21 A;  2QF8 A;  3RGC A;  1E6P A;  4ODO A;  3O5P A;  4FAP A;  2DSU A;  4JYS A;  2XP3 A;  1K9T A;  5J6E A;  4AY1 A;  1FKL A;  3I6C A;  4ODQ A;  4ITZ A;  2YBU A;  2YBT A;  4WKF A;  3PA7 A;  2KGJ A;  4JFK A;  2G41 A;  1UR9 A;  4ODM A;  4P8W A;  1FKT A;  4DIP A;  2FKE A;  3O5O A;  1LL6 A;  1D7J A;  4IT6 A;  1W9U A;  1W9V A;  4ODN A;  5E62 A;  4G50 A;  4ODR A;  3RM4 A;  2ZQS A;  1NSG A;  3CZ8 A;  1P5Q A;  3O5G A;  3B9A A;  3CGM A;  1QZ2 A;  2JZV A;  2FAP A;  1FKJ A;  4G2P A;  1GOI A;  3FXY A;  4ZPW R;  4Q7N A;  3MQH A;  2XP6 A;  2XP8 A;  2DSV A;  1JNE A;  3CHE A;  1Q1C A;  1E6R A;  4JFI A;  3PRB A;  2DG3 A;  4JFM A;  2YSF A;  4Q22 A;  1WAW A;  5I98 A;  2DT2 A;  1D6O A;  2VCD A;  3MCB B;  1EIB A;  4Z2L A;  4QT2 A;  4DRK A;  1LQ0 A;  1FKS A;  4LGX A;  3M7N A;  5HW7 A;  1J4I A;  2VN1 A;  3LUO A;  3PQH A;  3IHZ A;  4MSP A;  1YW5 A;  1EDQ A;  2DPE A;  1W26 A;  4U85 A;  1E6N A;  3WD1 A;  4DRI A;  4MNK A;  4IPX A;  5HWB A;  2EZ5 W;  2MF9 A;  4W9P A;  2O92 A;  4IQC A;  4O2T A;  3QOK A;  1ROU A;  5GQB A;  2YAJ B;  1XRV A;  1N1A A;  1HJX A;  5BXJ A;  2L2S A;  1X6N A;  1FKD A;  1SR0 A;  1W1T A;  4FN2 A;  1K9Q A;  3CGN A;  4S3K A;  4DWS D;  2RUQ A;  5GPR A;  3KAB A;  3O5R A;  3O5M A;  2WK2 A;  4MAV A;  4MNL A;  2PV2 A;  5HTG A;  5JH8 A;  1Q6H A;  3AQU A;  1I5H W;  1W9P A;  1FKK A;  2WAD A;  1WB0 A;  4WK9 A;  2IF4 A;  1T11 A;  3WIJ A;  3TC5 A;  1FAP A;  3G6M A;  2WLZ A;  1HJV A;  4IQ2 A;  3L4H A;  1GPF A;  4NNR A;  1JNT A;  2MLX A;  2XP4 A;  2RUD A;  3IKG A;  3RM8 A;  3ARO A;  3PRD A;  4DRH A;  1ZK6 A;  3O5F A;  4GGQ A;  1J4R A;  4Z2H A;  1EG4 A;  3WD3 A;  5HKG A;  3W4R A;  1J4H A;  3B9D A;  2QRV A;  2KFW A;  2YSH A;  1XHG A;  4ML4 A;  4ZPV R;  2PBC A;  2AOS A;  3BXW A;  2KR7 A;  3JYJ A;  2DK7 A;  5E66 A;  3AS0 A;  3O5J A;  3FAP A;  2M08 A;  4WKA A;  1NWU A;  1M5Y A;  3WD0 A;  4XAK A;  4TNS A;  4DZ3 A;  2AWG A;  5AHT A;  4S3J A;  1H0G A;  4TW6 A;  5HBF A;  4JFJ A;  3O5Q A;  2MLZ A;  4Z2J A;  2A3B A;  3PR9 A;  1ZBK A;  4DH0 A;  2ZR5 A;  2MPH A;  4WKH A;  2DT1 A;  2PPN A;  4KR0 B;  4Z2I A;  1HXV A;  4MGV A;  2Y78 A;  4A0T A;  2WAE A;  1A7X A;  3UI5 A;  4IT4 A;  4P8X A;  2YSI A;  4W9Q A;  1D7I A;  1WMV A;  2M3O W;  4ZPT R;  1J6Y A;  3KAI A;  2M2A A;  3O5L A;  1EHN A;  3KZ7 A;  1D2K A;  1O6I A;  5HW6 A;  1ZBC A;  4A0U A;  1E9L A;  1E15 A;  3CHC A;  4R0X A;  4PTM A;  3JXV A;  3FSB A;  1U79 A;  2RE3 A;  4LAV A;  4U86 A;  3ARP A;  1EQ3 A;  1FKG A;  3FSC A;  2MNT A;  4KQZ A;  1LL4 A;  1KT0 A;  3EY6 A;  5DIU A;  3WD4 A;  1H0I A;  1KT1 A;  4NSB A;  4P8V A;  3JYM A;  3G6L A;  4DWS B;  1O6W A;  2ESC A;  2LKN A;  4QT3 A;  2E45 A;  2A3E A;  3UI4 A;  4P8U A;  1NH6 A;  2DSW A;  2KO7 A;  4HBE A;  3ARU A;  4WJX A;  2A3C A;  3ARV A;  3B9E A;  1FKR A;  3KAG A;  3ARY A;  4DRQ A;  2KE0 A;  4U84 A;  3M85 A;  2BA1 A;  1IX5 A;  1FKH A;  2RQS A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...