4QIBA

Oxidation-mediated inhibition of the peptidyl-prolyl isomerase pin1
Total Genus 39
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
39
sequence length
157
structure length
144
Chain Sequence
LPPGWEKAMSRSSGRVYYFNHITNASQWERPSEPARVRCSHLLVKHSQSRRPSSWRQEKITRTKEEALELINGYIQKIKSGEEDFESLASQFSDSSAKARGDLGAFSRGQMQKPFEDASFALRTGEMSGPVFTDSGIHIILRTE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Isomerase
molecule keywords Peptidyl-prolyl cis-trans isomerase NIMA-interacting 1
publication title Peroxide-mediated oxidation and inhibition of the peptidyl-prolyl isomerase Pin1.
pubmed doi rcsb
source organism Homo sapiens
total genus 39
structure length 144
sequence length 157
ec nomenclature ec 5.2.1.8: Peptidylprolyl isomerase.
pdb deposition date 2014-05-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00397 WW WW domain
A PF00639 Rotamase PPIC-type PPIASE domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.20.70.10 Mainly Beta Single Sheet Ubiquitin Ligase Nedd4; Chain: W; Ubiquitin Ligase Nedd4; Chain: W; 4qibA01
3.10.50.40 Alpha Beta Roll Chitinase A; domain 3 Chitinase A; domain 3 4qibA02
2YSBA 2YSGA 2F4EA 2RSEA 5GPGA 2LGOA 3TCZA 1FKIA 2Q5AA 1ROUA 3B7XA 1EG3A 3UQIA 3O5JA 4W9PA 4IQCA 4MSPA 3CNGA 3KAGA 3M7NA 3FAPA 5BXJA 3UQBA 2F2DA 2ZQVA 4LAXA 3JYJA 3UQAA 4ODKA 4R0XA 2VCDA 3NI6A 1QPFA 1FD9A 2KFWA 1Q1CA 4ODMA 4JFMA 4JYSA 2KGJA 4GGQA 1JVWA 4IQ2A 1Q6HA 3KADA 4W9QA 4ODPA 4DRKA 1NMWA 1JMQA 2XP6A 2PV3A 4C02B 4FAPA 1JNSA 4GIVA 2LAJA 2L4JA 4U85A 1JNTA 4DROA 4DRMA 1O6WA 4JFLA 4G2PA 4U86A 1K9RA 4DRPA 1PINA 4W9OA 2Y78A 3WH0A 4DRIA 2MPHA 2XP7A 2PV2A 3NRKA 5J6EA 1F40A 4TNSA 3IK8A 5B8IC 2M1IA 2L2SA 2XPAA 5HW6A 3I6CA 3O5OA 4DH0A 2RE3A 4DIPA 1TK7A 3O5KA 2MDIA 4LAYA 2KE0A 2PPPA 1NMVA 2JZVA 2XPBA 4JFIA 4JFKA 2RUQA 2MLXA 1J6YA 4NNRA 2DMVA 1ZK6A 4N19A 4ODLA 4DT4A 1FKTA 3KZ7A 4DZ2A 1J4RA 5HT1A 3GPKA 1QPLA 4DRJA 2D9FA 2RUDA 3CGNA 5HW7A 2PV1A 5I98A 4JFJA 2KO7A 4TW8A 3UF8A 1FKSA 4E5RA 3O5QA 3OOBA 2RQSA 1FAPA 3O5LA 4ITZA 3RGCA 2XP4A 2PPNA 2IF4A 3CGMA 4MGVA 2ZR4A 4ODOA 1PBKA 3O5IA 3UI6A 1W26A 1P5QA 1KT1A 4FN2A 4LAWA 1FKKA 4BF8A 1QZ2A 2LPVA 1D7HA 2LJ4A 4LAVA 3O5GA 2KXQA 2VN1A 5HKGA 2ZQTA 2UZ5A 1EYMA 1WR7A 2DK1A 3O5RA 3O5FA 3KABA 2DWVA 2ITKA 2PBCA 3M85A 2DG4A 2LKNA 2N87A 2DG3A 2KI3A 4DZ3A 1FKDA 2F21A 1B6CA 2XP5A 1FKFA 1KT0A 3KACA 2E45A 5AHTA 1HXVA 1YW5A 3MDYB 4ODRA 4DRQA 4REXA 2PPOA 3LE4A 2FKEA 1N1AA 5HTGA 2MNTA 4ODQA 5HWBA 4TYOA 3KAHA 4J4OA 3KAIA 2EZ5W 3VAWA 3H9RB 2YSHA 1D7IA 1TCOC 1FKHA 5D75A 1L1PA 2FAPA 1Q6IA 4ODNA 1R9HA 4J4NA 1FKGA 2BA1A 2ZR5A 1FKJA 1Y0OA 2M08A 3IHZA 1WMVA 4QT2A 5DIVA 3KAFA 2ZAJA 1I5HW 1F8AB 2MLYA 2YSIA 1J4HA 4QT3A 2YSFA 5DITA 3LUOA 2MF9A 1FKLA 1EQ3A 2JXWA 3IKDA 2JX8A 1YATA 1T11A 2XP3A 1ROTA 3PA7A 2XP9A 1J4IA 1FKRA 4U84A 5CQ2A 1NSGA 4QIBA 2ZQUA 1A7XA 3EY6A 3PRDA 2AWGA 1FKBA 3RFWA 4G50A 4DRNA 3TC5A 5HWCA 1BL4A 2M2AA 1BKFA 1U79A 3O5PA 1D7JA 3JXVA 2ZQSA 2RUCA 4TW7A 4TX0A 2OFNA 2M3OW 4O2TA 2M8IA 3IKGA 1FJDA 2DJYA 5HUAA 4DRHA 2JV4A 1D6OA 3UI5A 1C9HA 3O5EA 3L4HA 4TW6A 2XP8A 3O5MA 2JMFA 2K8IA 3UI4A 1Q6UA 3JYMA 3PRBA 2ZR6A 3TDBA 2RURA 2KR7A 4IPXA 2DG9A 3ODKA 1M5YA 3NTPA 3KCEA 3O5DA 1ZCNA 1K9QA 2M8JA 1EG4A 2DK7A 5DIUA 2MLZA 5HW8A
chains in the Genus database with same CATH superfamily
2YSBA 2YSGA 1IX5A 2F4EA 2RSEA 5HBFA 5GPGA 2WADA 2LGOA 3TCZA 1CTNA 1FKIA 2Q5AA 1SR0A 3GTYX 2P4VA 1ROUA 3B7XA 4MTVA 1EG3A 3UQIA 3O5JA 3W4RA 1W1YA 4A0UA 4W9PA 2A3EA 1ZU8A 4IQCA 3B8SA 4MSPA 3CNGA 1NWTA 3KAGA 3M7NA 3FAPA 5BXJA 1EHNA 3UQBA 2F2DA 5E62A 3CHCA 2ZQVA 1K9TA 4LAXA 2DT3A 1JCHB 4WK9A 3JYJA 3UQAA 4ODKA 4ZPWR 4R0XA 2ESCA 2VCDA 1VF8A 3NI6A 2DT0A 3RM8A 1QPFA 1E44A 1FD9A 2KFWA 1Q1CA 2O92A 4WJXA 3ALFA 1TFVA 4ODMA 3G6MA 1HJVA 2G8ZA 4JFMA 4JYSA 2KGJA 4GGQA 1JVWA 4IQ2A 1Q6HA 3KADA 4HBOA 3QOKA 4W9QA 4ODPA 4QZVB 4DRKA 2OWOA 1NMWA 1JMQA 2XP6A 2PV3A 3BXWA 4C02B 4FAPA 1WB0A 1JNSA 4GIVA 2LAJA 1E6RA 1W9PA 2L4JA 4U85A 1JNTA 3AROA 4DROA 4DRMA 4MNLA 1O6WA 2IUZA 1LL7A 4JFLA 4G2PA 4U86A 1K9RA 4DRPA 1PINA 3CHFA 4W9OA 1ZBKA 3WD2A 2Y78A 3WH0A 4DRIA 1LJYA 2MPHA 2XP7A 3MQHA 2PV2A 3NRKA 5J6EA 1JNEA 1F40A 4TNSA 3IK8A 2DT2A 3CH9A 4IT6A 5GPRA 1GRJA 1UR9A 4NSBA 5B8IC 3WL1A 3AS2A 2M1IA 2L2SA 3B9EA 4WKHA 2XPAA 1H0GA 1WAWA 5HW6A 3I6CA 3O5OA 4PTMA 4DH0A 2RE3A 4DIPA 5GQBA 1TK7A 4WKFA 3O5KA 4Q7NA 1ITXA 1E6ZA 2MDIA 4LAYA 1E6NA 2KE0A 2PPPA 4ZPTR 1NMVA 3LKXB 2JZVA 2XPBA 4JFIA 4JFKA 3FSCA 2RUQA 2WK2A 3FS8A 1FFQA 2MLXA 2DSZA 3ARYA 4NNRA 1J6YA 2DMVA 1ZK6A 4N19A 4Z2KA 4ODLA 1ZBWA 5E64A 3CHEA 4DT4A 1FKTA 2YBTA 3KZ7A 5DO2A 4DZ2A 1J4RA 5HT1A 3WKZA 3CZ8A 3GPKA 1QPLA 4DRJA 2WLYA 3AS3A 3BMBA 2D9FA 2RUDA 1HJXA 3CGNA 3AQUA 2ETNA 2PV1A 4ZPVR 5HW7A 5I98A 3LKXA 4LGXA 2DPEA 4JFJA 2KO7A 4TW8A 3WD3A 4P8UA 1FKSA 3UF8A 2QRVA 4Z2LA 4E5RA 3O5QA 3B9AA 3OOBA 2RQSA 1FAPA 1EDQA 2DSUA 3O5LA 4URIA 4ZS6A 4L3NA 4Q22A 4ITZA 3ARUA 3RGCA 2XP4A 2PPNA 2AOSA 1UR8A 2IF4A 3CGMA 4MGVA 4MNJA 2ZR4A 2Y8NB 4WIWA 1HKJA 4ODOA 1PBKA 4S3KA 3O5IA 3UI6A 1GUVA 3G6LA 3PQHA 2B31A 1LQ0A 1W26A 3B9DA 3ARRA 4Z2IA 1P5QA 1KT1A 1ZL1A 4FN2A 4LAWA 1FKKA 4BF8A 1QZ2A 2LPVA 1D7HA 2LJ4A 3ARZA 3ARXA 3ALGA 4LAVA 4AY1A 3O5GA 1NWRA 2KXQA 2VN1A 5HKGA 1LL6A 3WIJA 2DSVA 3EIPA 2ZQTA 1KFWA 2UZ5A 4ML4A 1EYMA 1WR7A 2DK1A 1W1VA 3O5RA 3O5FA 3KABA 1HKKA 2DWVA 2ITKA 2YBUA 2PBCA 1LL4A 2DT1A 3ARPA 5DF0A 3M85A 3ARWA 2DG4A 2LKNA 2N87A 2DG3A 2KI3A 4P8XA 4DZ3A 4Z2HA 1FKDA 1FLCA 2G41A 2F21A 1B6CA 3CHDA 3GU0A 4NZCA 2XP5A 1FKFA 1KT0A 1HKMA 2E45A 3KACA 5AHTA 3RM9A 1RP5A 1HXVA 1YW5A 3MDYB 5JH8A 4ODRA 1LG2A 4DRQA 4REXA 3WL0A 2PPOA 3LE4A 3FSBA 2FKEA 1N1AA 5HTGA 3OA5A 2MNTA 1W1PA 4ODQA 5HWBA 4TYOA 4A0TA 3KAHA 4J4OA 3KAIA 2EZ5W 3ARTA 3VAWA 1E15A 2PN0A 1GPFA 1HJWA 3H9RB 3WD0A 2YSHA 1D7IA 1O6IA 1FKHA 1TCOC 1SYTA 4W5UA 5D75A 1L1PA 2FAPA 1Q6IA 1W1TA 1FFRA 4DWSC 4ODNA 1R9HA 3PR9A 3RMEA 4J4NA 4XAKA 1E6PA 1FKGA 2BA1A 4HBEA 2ZR5A 4IT4A 4HARA 1FKJA 3ARSA 1Y0OA 5U47A 4DWSB 2M08A 3IHZA 1HKIA 3MCBB 1WMVA 3WD1A 4QT2A 2A3AA 5DIVA 3KAFA 2F23A 2ZAJA 1I5HW 1JNDA 1F8AB 2MLYA 5E66A 2FDMA 1H0IA 2YSIA 1J4HA 3ARVA 4QT3A 4P8WA 2YSFA 3PRAA 5DITA 3LUOA 2MF9A 1FKLA 1EQ3A 2JXWA 3IKDA 1NWSA 4MPKA 2O9OA 2JX8A 1YATA 1T11A 1OWQA 4WKAA 2XP3A 1ROTA 3PA7A 4Z2JA 2XP9A 3WD4A 1J4IA 1FKRA 4S3JA 2WLZA 4U84A 4DWSA 2PI6A 5CQ2A 5DEZA 3MCBA 1NSGA 4QIBA 2ZQUA 1A7XA 3EY6A 2A3CA 3PRDA 1NWUA 2AWGA 2OLHA 1E9LA 1FKBA 3RFWA 4G50A 4DRNA 3WQVA 1XRVA 4L72B 5E5WA 3TC5A 4KR0B 5HWCA 4Z2GA 1BL4A 2M2AA 1BKFA 1U79A 3O5PA 1TR8A 1XHGA 3FXYA 3ARQA 1D7JA 3JXVA 2ZQSA 2RUCA 3FY1A 2DSWA 4TW7A 3WQWA 4TX0A 2OFNA 2M3OW 4KQZA 1LG1A 1OGGA 3AS0A 4O2TA 2M8IA 1OGBA 1ZB5A 3IKGA 2WAEA 3MQGA 1FJDA 2DJYA 5HUAA 4GLXA 4DWSD 4DRHA 2JV4A 1D6OA 3UI5A 1C9HA 1RD6A 3O5EA 1ZBVA 3L4HA 1GOIA 4TW6A 2XP8A 3O5MA 2JMFA 2K8IA 4MAVA 1ZBCA 4MNKA 3UI4A 5E65A 2EULA 1Q6UA 3JYMA 3PRBA 2A3BA 2YAJB 1EIBA 3RM4A 2B5UB 2ZR6A 3TDBA 2RURA 1X6NA 4UDMA 2KR7A 4IPXA 4R5EA 2DG9A 3ODKA 1M5YA 1NH6A 3NTPA 3KCEA 3O5DA 1ZCNA 4MNMA 1W9UA 1X6LA 1K9QA 2M8JA 1W9VA 4P8VA 1EG4A 2DK7A 2QF8A 5DIUA 2MLZA 1D2KA 2WM0A 5HW8A 3AS1A 1WNOA
chains in the Genus database with same CATH topology
2YSBA 2YSGA 1IX5A 2F4EA 2RSEA 5HBFA 5GPGA 2WADA 2LGOA 3TCZA 1CTNA 1FKIA 2Q5AA 1SR0A 1ROUA 3B7XA 4MTVA 1EG3A 3UQIA 3O5JA 3W4RA 1W1YA 4A0UA 4W9PA 2A3EA 1ZU8A 4IQCA 3B8SA 4MSPA 3CNGA 1NWTA 3KAGA 3M7NA 3FAPA 5BXJA 1EHNA 3UQBA 2F2DA 5E62A 3CHCA 2ZQVA 1K9TA 4LAXA 2DT3A 4WK9A 3JYJA 3UQAA 4ODKA 4ZPWR 4R0XA 2ESCA 2VCDA 1VF8A 3NI6A 2DT0A 3RM8A 1QPFA 1FD9A 2KFWA 1Q1CA 2O92A 4WJXA 3ALFA 1TFVA 4ODMA 3G6MA 1HJVA 2G8ZA 4JFMA 4JYSA 2KGJA 4GGQA 1JVWA 4IQ2A 1Q6HA 3KADA 4HBOA 3QOKA 4W9QA 4ODPA 4QZVB 4DRKA 2OWOA 1NMWA 1JMQA 2XP6A 2PV3A 3BXWA 4C02B 4FAPA 1WB0A 1JNSA 4GIVA 2LAJA 1E6RA 1W9PA 2L4JA 4U85A 1JNTA 3AROA 4DROA 4DRMA 4MNLA 1O6WA 2IUZA 1LL7A 4JFLA 4G2PA 4U86A 1K9RA 4DRPA 1PINA 3CHFA 4W9OA 1ZBKA 3WD2A 2Y78A 3WH0A 4DRIA 1LJYA 2MPHA 2XP7A 3MQHA 2PV2A 3NRKA 5J6EA 1JNEA 1F40A 4TNSA 3IK8A 2DT2A 3CH9A 4IT6A 5GPRA 1UR9A 4NSBA 5B8IC 3WL1A 3AS2A 2M1IA 2L2SA 3B9EA 4WKHA 2XPAA 1H0GA 1WAWA 5HW6A 3I6CA 3O5OA 4PTMA 4DH0A 2RE3A 4DIPA 5GQBA 1TK7A 4WKFA 3O5KA 4Q7NA 1ITXA 1E6ZA 2MDIA 4LAYA 1E6NA 2KE0A 2PPPA 4ZPTR 1NMVA 3LKXB 2JZVA 2XPBA 4JFIA 4JFKA 3FSCA 2RUQA 2WK2A 3FS8A 1FFQA 2MLXA 2DSZA 3ARYA 4NNRA 1J6YA 2DMVA 1ZK6A 4N19A 4Z2KA 4ODLA 1ZBWA 5E64A 3CHEA 4DT4A 1FKTA 2YBTA 3KZ7A 5DO2A 4DZ2A 1J4RA 5HT1A 3WKZA 3CZ8A 3GPKA 1QPLA 4DRJA 2WLYA 3AS3A 2D9FA 2RUDA 1HJXA 3CGNA 3AQUA 5HW7A 2PV1A 4ZPVR 5I98A 3LKXA 4LGXA 2DPEA 4JFJA 2KO7A 4TW8A 3WD3A 4P8UA 1FKSA 3UF8A 2QRVA 4Z2LA 4E5RA 3O5QA 3B9AA 3OOBA 2RQSA 1FAPA 1EDQA 2DSUA 3O5LA 4URIA 4ZS6A 4L3NA 4Q22A 4ITZA 3ARUA 3RGCA 2XP4A 2PPNA 2AOSA 1UR8A 2IF4A 3CGMA 4MGVA 4MNJA 2ZR4A 2Y8NB 4WIWA 1HKJA 4ODOA 1PBKA 4S3KA 3O5IA 3UI6A 1GUVA 3G6LA 3PQHA 2B31A 1LQ0A 1W26A 3B9DA 3ARRA 4Z2IA 1P5QA 1KT1A 1ZL1A 4FN2A 4LAWA 1FKKA 4BF8A 1QZ2A 2LPVA 1D7HA 2LJ4A 3ARZA 3ARXA 3ALGA 4LAVA 4AY1A 3O5GA 1NWRA 2KXQA 2VN1A 5HKGA 1LL6A 3WIJA 2DSVA 2ZQTA 1KFWA 2UZ5A 4ML4A 1EYMA 1WR7A 2DK1A 1W1VA 3O5RA 3O5FA 3KABA 1HKKA 2DWVA 2ITKA 2YBUA 2PBCA 1LL4A 2DT1A 3ARPA 5DF0A 3M85A 3ARWA 2DG4A 2LKNA 2N87A 2DG3A 2KI3A 4P8XA 4DZ3A 4Z2HA 1FKDA 1FLCA 2G41A 2F21A 1B6CA 3CHDA 4NZCA 2XP5A 1FKFA 1KT0A 1HKMA 2E45A 3KACA 5AHTA 3RM9A 1RP5A 1HXVA 1YW5A 3MDYB 5JH8A 4ODRA 1LG2A 4DRQA 4REXA 3WL0A 2PPOA 3LE4A 3FSBA 2FKEA 1N1AA 5HTGA 3OA5A 2MNTA 1W1PA 4ODQA 5HWBA 4TYOA 4A0TA 3KAHA 4J4OA 3KAIA 2EZ5W 3ARTA 3VAWA 1E15A 1GPFA 1HJWA 3H9RB 3WD0A 2YSHA 1D7IA 1O6IA 1FKHA 1TCOC 1SYTA 4W5UA 5D75A 1L1PA 2FAPA 1Q6IA 1W1TA 1FFRA 4DWSC 4ODNA 1R9HA 3PR9A 3RMEA 4J4NA 4XAKA 1E6PA 1FKGA 2BA1A 4HBEA 2ZR5A 4IT4A 4HARA 1FKJA 3ARSA 1Y0OA 5U47A 4DWSB 2M08A 3IHZA 1HKIA 3MCBB 1WMVA 3WD1A 4QT2A 2A3AA 5DIVA 3KAFA 2ZAJA 1I5HW 1JNDA 1F8AB 2MLYA 5E66A 2FDMA 1H0IA 2YSIA 1J4HA 3ARVA 4QT3A 4P8WA 2YSFA 3PRAA 5DITA 3LUOA 2MF9A 1FKLA 1EQ3A 2JXWA 3IKDA 1NWSA 4MPKA 2O9OA 2JX8A 1YATA 1T11A 1OWQA 4WKAA 2XP3A 1ROTA 3PA7A 4Z2JA 2XP9A 3WD4A 1J4IA 1FKRA 4S3JA 2WLZA 4U84A 4DWSA 2PI6A 5CQ2A 5DEZA 3MCBA 1NSGA 4QIBA 2ZQUA 1A7XA 3EY6A 2A3CA 3PRDA 1NWUA 2AWGA 2OLHA 1E9LA 1FKBA 3RFWA 4G50A 4DRNA 3WQVA 1XRVA 4L72B 5E5WA 3TC5A 4KR0B 5HWCA 4Z2GA 1BL4A 2M2AA 1BKFA 1U79A 3O5PA 1TR8A 1XHGA 3FXYA 3ARQA 1D7JA 3JXVA 2ZQSA 2RUCA 3FY1A 2DSWA 4TW7A 3WQWA 4TX0A 2OFNA 2M3OW 4KQZA 1LG1A 1OGGA 3AS0A 4O2TA 2M8IA 1OGBA 1ZB5A 3IKGA 2WAEA 3MQGA 1FJDA 2DJYA 5HUAA 4GLXA 4DWSD 4DRHA 2JV4A 1D6OA 3UI5A 1C9HA 1RD6A 3O5EA 1ZBVA 3L4HA 1GOIA 4TW6A 2XP8A 3O5MA 2JMFA 2K8IA 4MAVA 1ZBCA 4MNKA 3UI4A 5E65A 1Q6UA 3JYMA 3PRBA 2A3BA 2YAJB 1EIBA 3RM4A 2ZR6A 3TDBA 2RURA 1X6NA 2KR7A 4IPXA 4R5EA 2DG9A 3ODKA 1M5YA 1NH6A 3NTPA 3KCEA 3O5DA 1ZCNA 4MNMA 1W9UA 1X6LA 1K9QA 2M8JA 1W9VA 4P8VA 1EG4A 2DK7A 2QF8A 5DIUA 2MLZA 1D2KA 2WM0A 5HW8A 3AS1A 1WNOA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2YSB A;  2YSG A;  2F4E A;  2RSE A;  5GPG A;  2LGO A;  3TCZ A;  1FKI A;  2Q5A A;  1ROU A;  3B7X A;  1EG3 A;  3UQI A;  3O5J A;  4W9P A;  4IQC A;  4MSP A;  3CNG A;  3KAG A;  3M7N A;  3FAP A;  5BXJ A;  3UQB A;  2F2D A;  2ZQV A;  4LAX A;  3JYJ A;  3UQA A;  4ODK A;  4R0X A;  2VCD A;  3NI6 A;  1QPF A;  1FD9 A;  2KFW A;  1Q1C A;  4ODM A;  4JFM A;  4JYS A;  2KGJ A;  4GGQ A;  1JVW A;  4IQ2 A;  1Q6H A;  3KAD A;  4W9Q A;  4ODP A;  4DRK A;  1NMW A;  1JMQ A;  2XP6 A;  2PV3 A;  4C02 B;  4FAP A;  1JNS A;  4GIV A;  2LAJ A;  2L4J A;  4U85 A;  1JNT A;  4DRO A;  4DRM A;  1O6W A;  4JFL A;  4G2P A;  4U86 A;  1K9R A;  4DRP A;  1PIN A;  4W9O A;  2Y78 A;  3WH0 A;  4DRI A;  2MPH A;  2XP7 A;  2PV2 A;  3NRK A;  5J6E A;  1F40 A;  4TNS A;  3IK8 A;  5B8I C;  2M1I A;  2L2S A;  2XPA A;  5HW6 A;  3I6C A;  3O5O A;  4DH0 A;  2RE3 A;  4DIP A;  1TK7 A;  3O5K A;  2MDI A;  4LAY A;  2KE0 A;  2PPP A;  1NMV A;  2JZV A;  2XPB A;  4JFI A;  4JFK A;  2RUQ A;  2MLX A;  1J6Y A;  4NNR A;  2DMV A;  1ZK6 A;  4N19 A;  4ODL A;  4DT4 A;  1FKT A;  3KZ7 A;  4DZ2 A;  1J4R A;  5HT1 A;  3GPK A;  1QPL A;  4DRJ A;  2D9F A;  2RUD A;  3CGN A;  5HW7 A;  2PV1 A;  5I98 A;  4JFJ A;  2KO7 A;  4TW8 A;  3UF8 A;  1FKS A;  4E5R A;  3O5Q A;  3OOB A;  2RQS A;  1FAP A;  3O5L A;  4ITZ A;  3RGC A;  2XP4 A;  2PPN A;  2IF4 A;  3CGM A;  4MGV A;  2ZR4 A;  4ODO A;  1PBK A;  3O5I A;  3UI6 A;  1W26 A;  1P5Q A;  1KT1 A;  4FN2 A;  4LAW A;  1FKK A;  4BF8 A;  1QZ2 A;  2LPV A;  1D7H A;  2LJ4 A;  4LAV A;  3O5G A;  2KXQ A;  2VN1 A;  5HKG A;  2ZQT A;  2UZ5 A;  1EYM A;  1WR7 A;  2DK1 A;  3O5R A;  3O5F A;  3KAB A;  2DWV A;  2ITK A;  2PBC A;  3M85 A;  2DG4 A;  2LKN A;  2N87 A;  2DG3 A;  2KI3 A;  4DZ3 A;  1FKD A;  2F21 A;  1B6C A;  2XP5 A;  1FKF A;  1KT0 A;  3KAC A;  2E45 A;  5AHT A;  1HXV A;  1YW5 A;  3MDY B;  4ODR A;  4DRQ A;  4REX A;  2PPO A;  3LE4 A;  2FKE A;  1N1A A;  5HTG A;  2MNT A;  4ODQ A;  5HWB A;  4TYO A;  3KAH A;  4J4O A;  3KAI A;  2EZ5 W;  3VAW A;  3H9R B;  2YSH A;  1D7I A;  1TCO C;  1FKH A;  5D75 A;  1L1P A;  2FAP A;  1Q6I A;  4ODN A;  1R9H A;  4J4N A;  1FKG A;  2BA1 A;  2ZR5 A;  1FKJ A;  1Y0O A;  2M08 A;  3IHZ A;  1WMV A;  4QT2 A;  5DIV A;  3KAF A;  2ZAJ A;  1I5H W;  1F8A B;  2MLY A;  2YSI A;  1J4H A;  4QT3 A;  2YSF A;  5DIT A;  3LUO A;  2MF9 A;  1FKL A;  1EQ3 A;  2JXW A;  3IKD A;  2JX8 A;  1YAT A;  1T11 A;  2XP3 A;  1ROT A;  3PA7 A;  2XP9 A;  1J4I A;  1FKR A;  4U84 A;  5CQ2 A;  1NSG A;  4QIB A;  2ZQU A;  1A7X A;  3EY6 A;  3PRD A;  2AWG A;  1FKB A;  3RFW A;  4G50 A;  4DRN A;  3TC5 A;  5HWC A;  1BL4 A;  2M2A A;  1BKF A;  1U79 A;  3O5P A;  1D7J A;  3JXV A;  2ZQS A;  2RUC A;  4TW7 A;  4TX0 A;  2OFN A;  2M3O W;  4O2T A;  2M8I A;  3IKG A;  1FJD A;  2DJY A;  5HUA A;  4DRH A;  2JV4 A;  1D6O A;  3UI5 A;  1C9H A;  3O5E A;  3L4H A;  4TW6 A;  2XP8 A;  3O5M A;  2JMF A;  2K8I A;  3UI4 A;  1Q6U A;  3JYM A;  3PRB A;  2ZR6 A;  3TDB A;  2RUR A;  2KR7 A;  4IPX A;  2DG9 A;  3ODK A;  1M5Y A;  3NTP A;  3KCE A;  3O5D A;  1ZCN A;  1K9Q A;  2M8J A;  1EG4 A;  2DK7 A;  5DIU A;  2MLZ A;  5HW8 A; 
#chains in the Genus database with same CATH topology
 2YSB A;  2YSG A;  1IX5 A;  2F4E A;  2RSE A;  5HBF A;  5GPG A;  2WAD A;  2LGO A;  3TCZ A;  1CTN A;  1FKI A;  2Q5A A;  1SR0 A;  3GTY X;  2P4V A;  1ROU A;  3B7X A;  4MTV A;  1EG3 A;  3UQI A;  3O5J A;  3W4R A;  1W1Y A;  4A0U A;  4W9P A;  2A3E A;  1ZU8 A;  4IQC A;  3B8S A;  4MSP A;  3CNG A;  1NWT A;  3KAG A;  3M7N A;  3FAP A;  5BXJ A;  1EHN A;  3UQB A;  2F2D A;  5E62 A;  3CHC A;  2ZQV A;  1K9T A;  4LAX A;  2DT3 A;  1JCH B;  4WK9 A;  3JYJ A;  3UQA A;  4ODK A;  4ZPW R;  4R0X A;  2ESC A;  2VCD A;  1VF8 A;  3NI6 A;  2DT0 A;  3RM8 A;  1QPF A;  1E44 A;  1FD9 A;  2KFW A;  1Q1C A;  2O92 A;  4WJX A;  3ALF A;  1TFV A;  4ODM A;  3G6M A;  1HJV A;  2G8Z A;  4JFM A;  4JYS A;  2KGJ A;  4GGQ A;  1JVW A;  4IQ2 A;  1Q6H A;  3KAD A;  4HBO A;  3QOK A;  4W9Q A;  4ODP A;  4QZV B;  4DRK A;  2OWO A;  1NMW A;  1JMQ A;  2XP6 A;  2PV3 A;  3BXW A;  4C02 B;  4FAP A;  1WB0 A;  1JNS A;  4GIV A;  2LAJ A;  1E6R A;  1W9P A;  2L4J A;  4U85 A;  1JNT A;  3ARO A;  4DRO A;  4DRM A;  4MNL A;  1O6W A;  2IUZ A;  1LL7 A;  4JFL A;  4G2P A;  4U86 A;  1K9R A;  4DRP A;  1PIN A;  3CHF A;  4W9O A;  1ZBK A;  3WD2 A;  2Y78 A;  3WH0 A;  4DRI A;  1LJY A;  2MPH A;  2XP7 A;  3MQH A;  2PV2 A;  3NRK A;  5J6E A;  1JNE A;  1F40 A;  4TNS A;  3IK8 A;  2DT2 A;  3CH9 A;  4IT6 A;  5GPR A;  1GRJ A;  1UR9 A;  4NSB A;  5B8I C;  3WL1 A;  3AS2 A;  2M1I A;  2L2S A;  3B9E A;  4WKH A;  2XPA A;  1H0G A;  1WAW A;  5HW6 A;  3I6C A;  3O5O A;  4PTM A;  4DH0 A;  2RE3 A;  4DIP A;  5GQB A;  1TK7 A;  4WKF A;  3O5K A;  4Q7N A;  1ITX A;  1E6Z A;  2MDI A;  4LAY A;  1E6N A;  2KE0 A;  2PPP A;  4ZPT R;  1NMV A;  3LKX B;  2JZV A;  2XPB A;  4JFI A;  4JFK A;  3FSC A;  2RUQ A;  2WK2 A;  3FS8 A;  1FFQ A;  2MLX A;  2DSZ A;  3ARY A;  4NNR A;  1J6Y A;  2DMV A;  1ZK6 A;  4N19 A;  4Z2K A;  4ODL A;  1ZBW A;  5E64 A;  3CHE A;  4DT4 A;  1FKT A;  2YBT A;  3KZ7 A;  5DO2 A;  4DZ2 A;  1J4R A;  5HT1 A;  3WKZ A;  3CZ8 A;  3GPK A;  1QPL A;  4DRJ A;  2WLY A;  3AS3 A;  3BMB A;  2D9F A;  2RUD A;  1HJX A;  3CGN A;  3AQU A;  2ETN A;  2PV1 A;  4ZPV R;  5HW7 A;  5I98 A;  3LKX A;  4LGX A;  2DPE A;  4JFJ A;  2KO7 A;  4TW8 A;  3WD3 A;  4P8U A;  1FKS A;  3UF8 A;  2QRV A;  4Z2L A;  4E5R A;  3O5Q A;  3B9A A;  3OOB A;  2RQS A;  1FAP A;  1EDQ A;  2DSU A;  3O5L A;  4URI A;  4ZS6 A;  4L3N A;  4Q22 A;  4ITZ A;  3ARU A;  3RGC A;  2XP4 A;  2PPN A;  2AOS A;  1UR8 A;  2IF4 A;  3CGM A;  4MGV A;  4MNJ A;  2ZR4 A;  2Y8N B;  4WIW A;  1HKJ A;  4ODO A;  1PBK A;  4S3K A;  3O5I A;  3UI6 A;  1GUV A;  3G6L A;  3PQH A;  2B31 A;  1LQ0 A;  1W26 A;  3B9D A;  3ARR A;  4Z2I A;  1P5Q A;  1KT1 A;  1ZL1 A;  4FN2 A;  4LAW A;  1FKK A;  4BF8 A;  1QZ2 A;  2LPV A;  1D7H A;  2LJ4 A;  3ARZ A;  3ARX A;  3ALG A;  4LAV A;  4AY1 A;  3O5G A;  1NWR A;  2KXQ A;  2VN1 A;  5HKG A;  1LL6 A;  3WIJ A;  2DSV A;  3EIP A;  2ZQT A;  1KFW A;  2UZ5 A;  4ML4 A;  1EYM A;  1WR7 A;  2DK1 A;  1W1V A;  3O5R A;  3O5F A;  3KAB A;  1HKK A;  2DWV A;  2ITK A;  2YBU A;  2PBC A;  1LL4 A;  2DT1 A;  3ARP A;  5DF0 A;  3M85 A;  3ARW A;  2DG4 A;  2LKN A;  2N87 A;  2DG3 A;  2KI3 A;  4P8X A;  4DZ3 A;  4Z2H A;  1FKD A;  1FLC A;  2G41 A;  2F21 A;  1B6C A;  3CHD A;  3GU0 A;  4NZC A;  2XP5 A;  1FKF A;  1KT0 A;  1HKM A;  2E45 A;  3KAC A;  5AHT A;  3RM9 A;  1RP5 A;  1HXV A;  1YW5 A;  3MDY B;  5JH8 A;  4ODR A;  1LG2 A;  4DRQ A;  4REX A;  3WL0 A;  2PPO A;  3LE4 A;  3FSB A;  2FKE A;  1N1A A;  5HTG A;  3OA5 A;  2MNT A;  1W1P A;  4ODQ A;  5HWB A;  4TYO A;  4A0T A;  3KAH A;  4J4O A;  3KAI A;  2EZ5 W;  3ART A;  3VAW A;  1E15 A;  2PN0 A;  1GPF A;  1HJW A;  3H9R B;  3WD0 A;  2YSH A;  1D7I A;  1O6I A;  1FKH A;  1TCO C;  1SYT A;  4W5U A;  5D75 A;  1L1P A;  2FAP A;  1Q6I A;  1W1T A;  1FFR A;  4DWS C;  4ODN A;  1R9H A;  3PR9 A;  3RME A;  4J4N A;  4XAK A;  1E6P A;  1FKG A;  2BA1 A;  4HBE A;  2ZR5 A;  4IT4 A;  4HAR A;  1FKJ A;  3ARS A;  1Y0O A;  5U47 A;  4DWS B;  2M08 A;  3IHZ A;  1HKI A;  3MCB B;  1WMV A;  3WD1 A;  4QT2 A;  2A3A A;  5DIV A;  3KAF A;  2F23 A;  2ZAJ A;  1I5H W;  1JND A;  1F8A B;  2MLY A;  5E66 A;  2FDM A;  1H0I A;  2YSI A;  1J4H A;  3ARV A;  4QT3 A;  4P8W A;  2YSF A;  3PRA A;  5DIT A;  3LUO A;  2MF9 A;  1FKL A;  1EQ3 A;  2JXW A;  3IKD A;  1NWS A;  4MPK A;  2O9O A;  2JX8 A;  1YAT A;  1T11 A;  1OWQ A;  4WKA A;  2XP3 A;  1ROT A;  3PA7 A;  4Z2J A;  2XP9 A;  3WD4 A;  1J4I A;  1FKR A;  4S3J A;  2WLZ A;  4U84 A;  4DWS A;  2PI6 A;  5CQ2 A;  5DEZ A;  3MCB A;  1NSG A;  4QIB A;  2ZQU A;  1A7X A;  3EY6 A;  2A3C A;  3PRD A;  1NWU A;  2AWG A;  2OLH A;  1E9L A;  1FKB A;  3RFW A;  4G50 A;  4DRN A;  3WQV A;  1XRV A;  4L72 B;  5E5W A;  3TC5 A;  4KR0 B;  5HWC A;  4Z2G A;  1BL4 A;  2M2A A;  1BKF A;  1U79 A;  3O5P A;  1TR8 A;  1XHG A;  3FXY A;  3ARQ A;  1D7J A;  3JXV A;  2ZQS A;  2RUC A;  3FY1 A;  2DSW A;  4TW7 A;  3WQW A;  4TX0 A;  2OFN A;  2M3O W;  4KQZ A;  1LG1 A;  1OGG A;  3AS0 A;  4O2T A;  2M8I A;  1OGB A;  1ZB5 A;  3IKG A;  2WAE A;  3MQG A;  1FJD A;  2DJY A;  5HUA A;  4GLX A;  4DWS D;  4DRH A;  2JV4 A;  1D6O A;  3UI5 A;  1C9H A;  1RD6 A;  3O5E A;  1ZBV A;  3L4H A;  1GOI A;  4TW6 A;  2XP8 A;  3O5M A;  2JMF A;  2K8I A;  4MAV A;  1ZBC A;  4MNK A;  3UI4 A;  5E65 A;  2EUL A;  1Q6U A;  3JYM A;  3PRB A;  2A3B A;  2YAJ B;  1EIB A;  3RM4 A;  2B5U B;  2ZR6 A;  3TDB A;  2RUR A;  1X6N A;  4UDM A;  2KR7 A;  4IPX A;  4R5E A;  2DG9 A;  3ODK A;  1M5Y A;  1NH6 A;  3NTP A;  3KCE A;  3O5D A;  1ZCN A;  4MNM A;  1W9U A;  1X6L A;  1K9Q A;  2M8J A;  1W9V A;  4P8V A;  1EG4 A;  2DK7 A;  2QF8 A;  5DIU A;  2MLZ A;  1D2K A;  2WM0 A;  5HW8 A;  3AS1 A;  1WNO A; 
#chains in the Genus database with same CATH homology
 2YSB A;  2YSG A;  1IX5 A;  2F4E A;  2RSE A;  5HBF A;  5GPG A;  2WAD A;  2LGO A;  3TCZ A;  1CTN A;  1FKI A;  2Q5A A;  1SR0 A;  1ROU A;  3B7X A;  4MTV A;  1EG3 A;  3UQI A;  3O5J A;  3W4R A;  1W1Y A;  4A0U A;  4W9P A;  2A3E A;  1ZU8 A;  4IQC A;  3B8S A;  4MSP A;  3CNG A;  1NWT A;  3KAG A;  3M7N A;  3FAP A;  5BXJ A;  1EHN A;  3UQB A;  2F2D A;  5E62 A;  3CHC A;  2ZQV A;  1K9T A;  4LAX A;  2DT3 A;  4WK9 A;  3JYJ A;  3UQA A;  4ODK A;  4ZPW R;  4R0X A;  2ESC A;  2VCD A;  1VF8 A;  3NI6 A;  2DT0 A;  3RM8 A;  1QPF A;  1FD9 A;  2KFW A;  1Q1C A;  2O92 A;  4WJX A;  3ALF A;  1TFV A;  4ODM A;  3G6M A;  1HJV A;  2G8Z A;  4JFM A;  4JYS A;  2KGJ A;  4GGQ A;  1JVW A;  4IQ2 A;  1Q6H A;  3KAD A;  4HBO A;  3QOK A;  4W9Q A;  4ODP A;  4QZV B;  4DRK A;  2OWO A;  1NMW A;  1JMQ A;  2XP6 A;  2PV3 A;  3BXW A;  4C02 B;  4FAP A;  1WB0 A;  1JNS A;  4GIV A;  2LAJ A;  1E6R A;  1W9P A;  2L4J A;  4U85 A;  1JNT A;  3ARO A;  4DRO A;  4DRM A;  4MNL A;  1O6W A;  2IUZ A;  1LL7 A;  4JFL A;  4G2P A;  4U86 A;  1K9R A;  4DRP A;  1PIN A;  3CHF A;  4W9O A;  1ZBK A;  3WD2 A;  2Y78 A;  3WH0 A;  4DRI A;  1LJY A;  2MPH A;  2XP7 A;  3MQH A;  2PV2 A;  3NRK A;  5J6E A;  1JNE A;  1F40 A;  4TNS A;  3IK8 A;  2DT2 A;  3CH9 A;  4IT6 A;  5GPR A;  1UR9 A;  4NSB A;  5B8I C;  3WL1 A;  3AS2 A;  2M1I A;  2L2S A;  3B9E A;  4WKH A;  2XPA A;  1H0G A;  1WAW A;  5HW6 A;  3I6C A;  3O5O A;  4PTM A;  4DH0 A;  2RE3 A;  4DIP A;  5GQB A;  1TK7 A;  4WKF A;  3O5K A;  4Q7N A;  1ITX A;  1E6Z A;  2MDI A;  4LAY A;  1E6N A;  2KE0 A;  2PPP A;  4ZPT R;  1NMV A;  3LKX B;  2JZV A;  2XPB A;  4JFI A;  4JFK A;  3FSC A;  2RUQ A;  2WK2 A;  3FS8 A;  1FFQ A;  2MLX A;  2DSZ A;  3ARY A;  4NNR A;  1J6Y A;  2DMV A;  1ZK6 A;  4N19 A;  4Z2K A;  4ODL A;  1ZBW A;  5E64 A;  3CHE A;  4DT4 A;  1FKT A;  2YBT A;  3KZ7 A;  5DO2 A;  4DZ2 A;  1J4R A;  5HT1 A;  3WKZ A;  3CZ8 A;  3GPK A;  1QPL A;  4DRJ A;  2WLY A;  3AS3 A;  2D9F A;  2RUD A;  1HJX A;  3CGN A;  3AQU A;  5HW7 A;  2PV1 A;  4ZPV R;  5I98 A;  3LKX A;  4LGX A;  2DPE A;  4JFJ A;  2KO7 A;  4TW8 A;  3WD3 A;  4P8U A;  1FKS A;  3UF8 A;  2QRV A;  4Z2L A;  4E5R A;  3O5Q A;  3B9A A;  3OOB A;  2RQS A;  1FAP A;  1EDQ A;  2DSU A;  3O5L A;  4URI A;  4ZS6 A;  4L3N A;  4Q22 A;  4ITZ A;  3ARU A;  3RGC A;  2XP4 A;  2PPN A;  2AOS A;  1UR8 A;  2IF4 A;  3CGM A;  4MGV A;  4MNJ A;  2ZR4 A;  2Y8N B;  4WIW A;  1HKJ A;  4ODO A;  1PBK A;  4S3K A;  3O5I A;  3UI6 A;  1GUV A;  3G6L A;  3PQH A;  2B31 A;  1LQ0 A;  1W26 A;  3B9D A;  3ARR A;  4Z2I A;  1P5Q A;  1KT1 A;  1ZL1 A;  4FN2 A;  4LAW A;  1FKK A;  4BF8 A;  1QZ2 A;  2LPV A;  1D7H A;  2LJ4 A;  3ARZ A;  3ARX A;  3ALG A;  4LAV A;  4AY1 A;  3O5G A;  1NWR A;  2KXQ A;  2VN1 A;  5HKG A;  1LL6 A;  3WIJ A;  2DSV A;  2ZQT A;  1KFW A;  2UZ5 A;  4ML4 A;  1EYM A;  1WR7 A;  2DK1 A;  1W1V A;  3O5R A;  3O5F A;  3KAB A;  1HKK A;  2DWV A;  2ITK A;  2YBU A;  2PBC A;  1LL4 A;  2DT1 A;  3ARP A;  5DF0 A;  3M85 A;  3ARW A;  2DG4 A;  2LKN A;  2N87 A;  2DG3 A;  2KI3 A;  4P8X A;  4DZ3 A;  4Z2H A;  1FKD A;  1FLC A;  2G41 A;  2F21 A;  1B6C A;  3CHD A;  4NZC A;  2XP5 A;  1FKF A;  1KT0 A;  1HKM A;  2E45 A;  3KAC A;  5AHT A;  3RM9 A;  1RP5 A;  1HXV A;  1YW5 A;  3MDY B;  5JH8 A;  4ODR A;  1LG2 A;  4DRQ A;  4REX A;  3WL0 A;  2PPO A;  3LE4 A;  3FSB A;  2FKE A;  1N1A A;  5HTG A;  3OA5 A;  2MNT A;  1W1P A;  4ODQ A;  5HWB A;  4TYO A;  4A0T A;  3KAH A;  4J4O A;  3KAI A;  2EZ5 W;  3ART A;  3VAW A;  1E15 A;  1GPF A;  1HJW A;  3H9R B;  3WD0 A;  2YSH A;  1D7I A;  1O6I A;  1FKH A;  1TCO C;  1SYT A;  4W5U A;  5D75 A;  1L1P A;  2FAP A;  1Q6I A;  1W1T A;  1FFR A;  4DWS C;  4ODN A;  1R9H A;  3PR9 A;  3RME A;  4J4N A;  4XAK A;  1E6P A;  1FKG A;  2BA1 A;  4HBE A;  2ZR5 A;  4IT4 A;  4HAR A;  1FKJ A;  3ARS A;  1Y0O A;  5U47 A;  4DWS B;  2M08 A;  3IHZ A;  1HKI A;  3MCB B;  1WMV A;  3WD1 A;  4QT2 A;  2A3A A;  5DIV A;  3KAF A;  2ZAJ A;  1I5H W;  1JND A;  1F8A B;  2MLY A;  5E66 A;  2FDM A;  1H0I A;  2YSI A;  1J4H A;  3ARV A;  4QT3 A;  4P8W A;  2YSF A;  3PRA A;  5DIT A;  3LUO A;  2MF9 A;  1FKL A;  1EQ3 A;  2JXW A;  3IKD A;  1NWS A;  4MPK A;  2O9O A;  2JX8 A;  1YAT A;  1T11 A;  1OWQ A;  4WKA A;  2XP3 A;  1ROT A;  3PA7 A;  4Z2J A;  2XP9 A;  3WD4 A;  1J4I A;  1FKR A;  4S3J A;  2WLZ A;  4U84 A;  4DWS A;  2PI6 A;  5CQ2 A;  5DEZ A;  3MCB A;  1NSG A;  4QIB A;  2ZQU A;  1A7X A;  3EY6 A;  2A3C A;  3PRD A;  1NWU A;  2AWG A;  2OLH A;  1E9L A;  1FKB A;  3RFW A;  4G50 A;  4DRN A;  3WQV A;  1XRV A;  4L72 B;  5E5W A;  3TC5 A;  4KR0 B;  5HWC A;  4Z2G A;  1BL4 A;  2M2A A;  1BKF A;  1U79 A;  3O5P A;  1TR8 A;  1XHG A;  3FXY A;  3ARQ A;  1D7J A;  3JXV A;  2ZQS A;  2RUC A;  3FY1 A;  2DSW A;  4TW7 A;  3WQW A;  4TX0 A;  2OFN A;  2M3O W;  4KQZ A;  1LG1 A;  1OGG A;  3AS0 A;  4O2T A;  2M8I A;  1OGB A;  1ZB5 A;  3IKG A;  2WAE A;  3MQG A;  1FJD A;  2DJY A;  5HUA A;  4GLX A;  4DWS D;  4DRH A;  2JV4 A;  1D6O A;  3UI5 A;  1C9H A;  1RD6 A;  3O5E A;  1ZBV A;  3L4H A;  1GOI A;  4TW6 A;  2XP8 A;  3O5M A;  2JMF A;  2K8I A;  4MAV A;  1ZBC A;  4MNK A;  3UI4 A;  5E65 A;  1Q6U A;  3JYM A;  3PRB A;  2A3B A;  2YAJ B;  1EIB A;  3RM4 A;  2ZR6 A;  3TDB A;  2RUR A;  1X6N A;  2KR7 A;  4IPX A;  4R5E A;  2DG9 A;  3ODK A;  1M5Y A;  1NH6 A;  3NTP A;  3KCE A;  3O5D A;  1ZCN A;  4MNM A;  1W9U A;  1X6L A;  1K9Q A;  2M8J A;  1W9V A;  4P8V A;  1EG4 A;  2DK7 A;  2QF8 A;  5DIU A;  2MLZ A;  1D2K A;  2WM0 A;  5HW8 A;  3AS1 A;  1WNO A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...