4QIBA

Oxidation-mediated inhibition of the peptidyl-prolyl isomerase pin1
Total Genus 39
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
39
sequence length
157
structure length
144
Chain Sequence
b'LPPGWEKAMSRSSGRVYYFNHITNASQWERPSEPARVRCSHLLVKHSQSRRPSSWRQEKITRTKEEALELINGYIQKIKSGEEDFESLASQFSDSSAKARGDLGAFSRGQMQKPFEDASFALRTGEMSGPVFTDSGIHIILRTE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Peptidyl-prolyl cis-trans isomerase NIMA-interacting 1
publication title Peroxide-mediated oxidation and inhibition of the peptidyl-prolyl isomerase Pin1.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Isomerase
total genus 39
structure length 144
sequence length 157
ec nomenclature ec 5.2.1.8: Peptidylprolyl isomerase.
pdb deposition date 2014-05-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00397 WW WW domain
A PF00639 Rotamase PPIC-type PPIASE domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.20.70.10 Mainly Beta Single Sheet Ubiquitin Ligase Nedd4; Chain: W; Ubiquitin Ligase Nedd4; Chain: W; 4qibA01
3.10.50.40 Alpha Beta Roll Chitinase A; domain 3 Chitinase A; domain 3 4qibA02
2PPOA 3CNGA 3KADA 1D7HA 3M85A 4ODNA 1ZCNA 2ZQTA 4DRMA 5HTGA 1D7IA 4LAVA 2YSHA 4DRHA 3M7NA 4IPXA 2XP8A 1I5HW 3O5IA 2XP9A 1F8AB 1KT0A 4MSPA 3TCZA 3KAHA 2KXQA 2PV3A 5DIVA 2JV4A 2KGJA 2RSEA 4U86A 1NMVA 4ODKA 4TYOA 1FKJA 4DZ3A 1Y0OA 1WR7A 3O5MA 2MDIA 3PRBA 3O5JA 2L4JA 1Q6UA 4DRQA 5HKGA 2F2DA 4DZ2A 2MF9A 1F40A 4QT2A 2LGOA 3PA7A 2DK7A 4ODOA 3L4HA 2LJ4A 2M3OW 2KO7A 4G50A 3KAFA 1EQ3A 4DT4A 3O5RA 4LAYA 5HW6A 5HUAA 1FKGA 5AHTA 1FKKA 4TW6A 2VN1A 4O2TA 1P5QA 4QIBA 3O5PA 4ODMA 1YATA 2AWGA 2KI3A 4JFMA 2RURA 1FKSA 2ZR6A 5DIUA 2ZQVA 2PBCA 2N87A 3LUOA 5J6EA 1BL4A 2MLXA 2MNTA 3TC5A 2XPAA 2LAJA 3O5KA 3O5GA 1QPLA 2PV1A 3JXVA 4LAWA 2LKNA 3KABA 1PBKA 4QT3A 2JXWA 2RUCA 5GPGA 1Q6HA 2DK1A 3WH0A 1FKTA 2L2SA 4FN2A 2RQSA 2UZ5A 4LAXA 1L1PA 4REXA 1FKBA 3KAGA 2E45A 2JX8A 3UQAA 1PINA 2Y78A 5B8IC 3CGMA 1N1AA 1T11A 2XP5A 2LPVA 3O5LA 4U85A 1JNTA 1M5YA 1J4RA 2DG3A 4N19A 2DJYA 4IQCA 1K9QA 2RUDA 2F21A 1HXVA 2BA1A 4ODPA 4MGVA 3KACA 2RUQA 3UQIA 3O5FA 4BF8A 2PPNA 4NNRA 4DROA 5HW8A 1ZK6A 3JYMA 3KCEA 2M2AA 1BKFA 4W9QA 2ZAJA 1JNSA 4U84A 3IHZA 2M08A 2YSFA 5HWBA 1O6WA 2ZQSA 2D9FA 5HW7A 2XPBA 3NTPA 4DIPA 5HWCA 1FKDA 2PPPA 2FKEA 2M8IA 2K8IA 3H9RB 3KZ7A 1NMWA 1FD9A 2KFWA 3NI6A 2DG4A 1QZ2A 1Q1CA 2DMVA 5BXJA 1FKRA 3CGNA 3IK8A 1EYMA 4JFJA 3EY6A 2JZVA 4R0XA 2VCDA 3O5DA 3VAWA 1YW5A 4TNSA 4TW8A 1WMVA 2JMFA 3NRKA 4C02B 2M8JA 4W9PA 2KE0A 5HT1A 1C9HA 1FKLA 2ZR4A 4FAPA 1A7XA 2EZ5W 1J4HA 2FAPA 1TK7A 3B7XA 1D6OA 4DH0A 1U79A 3KAIA 4E5RA 4DRJA 3OOBA 2YSIA 4DRPA 2KR7A 1FKFA 1B6CA 3ODKA 3UF8A 1KT1A 3UI6A 2IF4A 3GPKA 4ODRA 4G2PA 2MLZA 2Q5AA 2ZQUA 1J6YA 2ITKA 3UQBA 2XP3A 4J4NA 3RFWA 1J4IA 3I6CA 5CQ2A 4GIVA 2XP6A 3TDBA 4JFLA 4JYSA 3LE4A 2DG9A 4IQ2A 3UI4A 4DRIA 2DWVA 3JYJA 3RGCA 1D7JA 2RE3A 2XP7A 4DRNA 2PV2A 3PRDA 3IKDA 1QPFA 3O5QA 5I98A 2OFNA 2M1IA 3IKGA 1ROUA 3FAPA 2MPHA 1JVWA 1W26A 1Q6IA 3UI5A 1ROTA 2MLYA 1NSGA 1FKHA 2F4EA 1JMQA 1FAPA 1R9HA 4ODLA 1EG3A 5D75A 4TX0A 4JFIA 4JFKA 5DITA 4DRKA 1FKIA 4TW7A 4W9OA 4GGQA 4ITZA 3O5OA 3MDYB 1TCOC 1EG4A 2XP4A 1K9RA 1FJDA 4ODQA 4J4OA 2YSGA 3O5EA 2YSBA 2ZR5A
chains in the Genus database with same CATH superfamily
2PPOA 3CNGA 1SYTA 3KADA 1D7HA 4MTVA 3M85A 4R5EA 3WD4A 4ODNA 1ZCNA 1WB0A 2O9OA 2ZQTA 4Q22A 5E65A 4DRMA 5HTGA 2ETNA 1D7IA 1O6IA 3AQUA 4LAVA 2YSHA 4L72B 5GQBA 4DRHA 3M7NA 4MPKA 3WQWA 4IPXA 2XP8A 2B5UB 1I5HW 2QF8A 3O5IA 2XP9A 3WL1A 1F8AB 2YBUA 1E6NA 1GRJA 1KT0A 4MSPA 1LL4A 3TCZA 3KAHA 4MNLA 2DSZA 2KXQA 2PV3A 5DIVA 2JV4A 2KGJA 2RSEA 4S3JA 4U86A 1NMVA 4ODKA 4TYOA 1FKJA 4DZ3A 1Y0OA 2EULA 1WR7A 3CHFA 1W9PA 1FFRA 3O5MA 4A0TA 3WD3A 2DSUA 2MDIA 4Z2GA 1FLCA 3MQGA 4W5UA 3PRBA 3O5JA 1NWUA 1HJVA 2L4JA 1Q6UA 2OWOA 4DRQA 5HKGA 3QOKA 2F2DA 4DZ2A 3FS8A 3WD2A 3CHDA 4MAVA 2MF9A 1F40A 1E9LA 2DT2A 2DSWA 4QT2A 2LGOA 3EIPA 1TFVA 3PA7A 4Z2IA 2DK7A 4ODOA 3W4RA 3L4HA 2LJ4A 2M3OW 4IT4A 2KO7A 4G50A 3KAFA 1EQ3A 4DT4A 3O5RA 4LAYA 4KQZA 4P8WA 1W9UA 1HKIA 1JNEA 5HW6A 4HARA 5HUAA 1WAWA 1FKGA 5AHTA 1FKKA 4TW6A 2VN1A 4O2TA 1P5QA 1UR8A 4QIBA 2WM0A 1LL7A 3B9DA 3O5PA 4ODMA 1YATA 2AWGA 3LKXA 5JH8A 3G6LA 3FXYA 2KI3A 3CH9A 3AS1A 4JFMA 2RURA 1FKSA 1LL6A 4P8UA 2ZR6A 1ZL1A 5DIUA 1EHNA 4QZVB 4L3NA 3AROA 1ZU8A 1HJWA 1ZBCA 2ZQVA 1K9TA 2PBCA 2N87A 3LUOA 5J6EA 1BL4A 2MLXA 1LG1A 2MNTA 3TC5A 2XPAA 5E66A 2LAJA 3O5KA 4Z2LA 3O5GA 1QPLA 4UDMA 2PV1A 3JXVA 4LAWA 2FDMA 2LKNA 4A0UA 3KABA 1PBKA 2AOSA 2WAEA 2Y8NB 3ARVA 3FSCA 3ARZA 4QT3A 2JXWA 2RUCA 2YBTA 3GU0A 5GPGA 1Q6HA 2DK1A 3WH0A 1FKTA 2L2SA 1W1PA 4FN2A 1GOIA 4URIA 2RQSA 2UZ5A 4LAXA 1L1PA 4REXA 1FKBA 3ARPA 3KAGA 2E45A 2JX8A 3UQAA 1PINA 1KFWA 4DWSA 2Y78A 4NZCA 5B8IC 3CGMA 5DO2A 2WLYA 1N1AA 1T11A 3GTYX 2O92A 2XP5A 1W1VA 2LPVA 3RM8A 4HBOA 5U47A 4WK9A 3O5LA 4U85A 1TR8A 1JNTA 1M5YA 5E64A 1J4RA 1GPFA 1XRVA 2DG3A 4N19A 2DJYA 1ZBKA 3CHEA 2A3AA 4IQCA 5E62A 1K9QA 4Z2JA 2RUDA 2F21A 1HXVA 2BA1A 4ODPA 4MGVA 3KACA 3WIJA 2RUQA 3UQIA 3BMBA 1NWRA 5E5WA 1X6NA 3O5FA 2G41A 2PPNA 4NNRA 4BF8A 4DROA 5HW8A 1ZK6A 1W1TA 3JYMA 3KCEA 2M2AA 1W1YA 1BKFA 2OLHA 4GLXA 2ZAJA 4W9QA 1JNSA 1JNDA 4U84A 1OGBA 3IHZA 2M08A 2A3BA 2YSFA 1JCHB 5HWBA 1O6WA 2ZQSA 2D9FA 5HW7A 1GUVA 2XPBA 3NTPA 4DIPA 5HWCA 3ARXA 1FKDA 2PPPA 2FKEA 3ALGA 2M8IA 2K8IA 2DT1A 3H9RB 3KZ7A 3WL0A 1NMWA 1FD9A 2KFWA 3ARSA 1H0IA 3NI6A 2DG4A 1QZ2A 1OWQA 1W9VA 2A3EA 1ZBVA 1Q1CA 4AY1A 2DMVA 1XHGA 5BXJA 1FKRA 3CGNA 3IK8A 1HJXA 4MNKA 1EYMA 1UR9A 4JFJA 4NSBA 3EY6A 2JZVA 4IT6A 3RMEA 4R0XA 1RP5A 1HKJA 1ZBWA 2VCDA 3O5DA 3VAWA 1IX5A 1YW5A 3PQHA 4TNSA 4TW8A 1WMVA 2JMFA 2F23A 3NRKA 4C02B 2M8JA 4W9PA 2KE0A 5DEZA 5HT1A 1C9HA 3WD0A 2WADA 3ALFA 1LQ0A 1FKLA 3AS0A 3FY1A 2ZR4A 1A7XA 4FAPA 2EZ5W 1J4HA 2FAPA 1TK7A 3B7XA 1D6OA 4WIWA 2WLZA 1LJYA 4DH0A 3BXWA 1U79A 3ARTA 3KAIA 4E5RA 3CZ8A 1E6PA 2DT3A 4DRJA 3OOBA 3WD1A 4ZS6A 2YSIA 4DRPA 2KR7A 1FKFA 1B6CA 3ODKA 3UF8A 1KT1A 4WJXA 5DF0A 2ESCA 3UI6A 2IF4A 3GPKA 4XAKA 4DWSC 4ODRA 1LG2A 4G2PA 2MLZA 2Q5AA 2ZQUA 3FSBA 1RD6A 3ARUA 1J6YA 1NWTA 4Q7NA 2WK2A 2ITKA 3ARWA 3B8SA 3OA5A 3UQBA 4MNMA 4PTMA 2XP3A 3RM4A 4J4NA 2PN0A 4P8XA 4MNJA 1ITXA 4P8VA 4DWSD 1VF8A 4ZPVR 3RFWA 4S3KA 2YAJB 3CHCA 1J4IA 2DSVA 3ARYA 3I6CA 5CQ2A 3PR9A 4GIVA 2XP6A 3TDBA 3WKZA 4JFLA 2A3CA 3G6MA 4JYSA 3LE4A 2QRVA 2DG9A 4IQ2A 3UI4A 4HBEA 4DRIA 2DWVA 3JYJA 3RGCA 4Z2KA 3LKXB 1D7JA 4LGXA 2RE3A 2XP7A 4DRNA 1E15A 3B9AA 3MCBB 2PV2A 2G8ZA 4Z2HA 3PRDA 1NWSA 4ML4A 1HKKA 3WQVA 5GPRA 2P4VA 1NH6A 2DPEA 3IKDA 1QPFA 2DT0A 3O5QA 1E6ZA 5I98A 3MQHA 3AS2A 4WKFA 1EIBA 2OFNA 3B9EA 4KR0B 5HBFA 3AS3A 2M1IA 4WKAA 1ROUA 3IKGA 3FAPA 2MPHA 3ARRA 3RM9A 1JVWA 1H0GA 4WKHA 1W26A 1OGGA 1Q6IA 3UI5A 1EDQA 1ZB5A 2B31A 1ROTA 2MLYA 3ARQA 1X6LA 1NSGA 1FKHA 2F4EA 1JMQA 1FAPA 1R9HA 3MCBA 4ODLA 1EG3A 3PRAA 5D75A 1E44A 4TX0A 4JFIA 1D2KA 4JFKA 5DITA 1FFQA 4DRKA 4ZPTR 1SR0A 1FKIA 4TW7A 4ZPWR 1WNOA 4W9OA 4GGQA 4ITZA 1HKMA 2IUZA 3O5OA 1CTNA 1E6RA 2PI6A 3MDYB 4DWSB 1TCOC 1EG4A 2XP4A 1K9RA 1FJDA 4ODQA 4J4OA 2YSGA 3O5EA 2YSBA 2ZR5A
chains in the Genus database with same CATH topology
2PPOA 3CNGA 1SYTA 3KADA 1D7HA 4MTVA 3M85A 4R5EA 3WD4A 4ODNA 1ZCNA 1WB0A 2O9OA 2ZQTA 4Q22A 5E65A 4DRMA 5HTGA 1D7IA 1O6IA 3AQUA 4LAVA 2YSHA 4L72B 5GQBA 4DRHA 3M7NA 4MPKA 3WQWA 4IPXA 2XP8A 1I5HW 2QF8A 3O5IA 2XP9A 3WL1A 1F8AB 2YBUA 1E6NA 1KT0A 4MSPA 1LL4A 3TCZA 3KAHA 4MNLA 2DSZA 2KXQA 2PV3A 5DIVA 2JV4A 2KGJA 2RSEA 4S3JA 4U86A 1NMVA 4ODKA 4TYOA 1FKJA 4DZ3A 1Y0OA 1WR7A 3CHFA 1W9PA 1FFRA 3O5MA 4A0TA 3WD3A 2DSUA 2MDIA 4Z2GA 1FLCA 3MQGA 4W5UA 3PRBA 3O5JA 1NWUA 1HJVA 2L4JA 1Q6UA 2OWOA 4DRQA 5HKGA 3QOKA 2F2DA 4DZ2A 3FS8A 3WD2A 3CHDA 4MAVA 2MF9A 1F40A 1E9LA 2DT2A 2DSWA 4QT2A 2LGOA 1TFVA 3PA7A 4Z2IA 2DK7A 4ODOA 3W4RA 3L4HA 2LJ4A 2M3OW 4IT4A 2KO7A 4G50A 3KAFA 1EQ3A 4DT4A 3O5RA 4LAYA 4KQZA 4P8WA 1W9UA 1HKIA 1JNEA 5HW6A 4HARA 5HUAA 1WAWA 1FKGA 5AHTA 1FKKA 4TW6A 2VN1A 4O2TA 1P5QA 1UR8A 4QIBA 2WM0A 1LL7A 3B9DA 3O5PA 4ODMA 1YATA 2AWGA 3LKXA 5JH8A 3G6LA 3FXYA 2KI3A 3CH9A 3AS1A 4JFMA 2RURA 1FKSA 1LL6A 4P8UA 2ZR6A 1ZL1A 5DIUA 1EHNA 4QZVB 4L3NA 3AROA 1ZU8A 1HJWA 1ZBCA 2ZQVA 1K9TA 2PBCA 2N87A 3LUOA 5J6EA 1BL4A 2MLXA 1LG1A 2MNTA 3TC5A 2XPAA 5E66A 2LAJA 3O5KA 4Z2LA 3O5GA 1QPLA 2PV1A 3JXVA 4LAWA 2FDMA 2LKNA 4A0UA 3KABA 1PBKA 2AOSA 2WAEA 2Y8NB 3ARVA 3FSCA 3ARZA 4QT3A 2JXWA 2RUCA 2YBTA 5GPGA 1Q6HA 2DK1A 3WH0A 1FKTA 2L2SA 1W1PA 4FN2A 1GOIA 4URIA 2RQSA 2UZ5A 4LAXA 1L1PA 4REXA 1FKBA 3ARPA 3KAGA 2E45A 2JX8A 3UQAA 1PINA 1KFWA 4DWSA 2Y78A 4NZCA 5B8IC 3CGMA 5DO2A 2WLYA 1N1AA 1T11A 2O92A 2XP5A 1W1VA 2LPVA 3RM8A 4HBOA 5U47A 4WK9A 3O5LA 4U85A 1TR8A 1JNTA 1M5YA 5E64A 1J4RA 1GPFA 1XRVA 2DG3A 4N19A 2DJYA 1ZBKA 3CHEA 2A3AA 4IQCA 5E62A 1K9QA 4Z2JA 2RUDA 2F21A 1HXVA 2BA1A 4ODPA 4MGVA 3KACA 3WIJA 2RUQA 3UQIA 1NWRA 5E5WA 1X6NA 3O5FA 2G41A 2PPNA 4NNRA 4BF8A 4DROA 5HW8A 1ZK6A 1W1TA 3JYMA 3KCEA 2M2AA 1W1YA 1BKFA 2OLHA 4GLXA 2ZAJA 4W9QA 1JNSA 1JNDA 4U84A 1OGBA 3IHZA 2M08A 2A3BA 2YSFA 5HWBA 1O6WA 2ZQSA 2D9FA 5HW7A 1GUVA 2XPBA 3NTPA 4DIPA 5HWCA 3ARXA 1FKDA 2PPPA 2FKEA 3ALGA 2M8IA 2K8IA 2DT1A 3H9RB 3KZ7A 3WL0A 1NMWA 1FD9A 2KFWA 3ARSA 1H0IA 3NI6A 2DG4A 1QZ2A 1OWQA 1W9VA 2A3EA 1ZBVA 1Q1CA 4AY1A 2DMVA 1XHGA 5BXJA 1FKRA 3CGNA 3IK8A 1HJXA 4MNKA 1EYMA 1UR9A 4JFJA 4NSBA 3EY6A 2JZVA 4IT6A 3RMEA 4R0XA 1RP5A 1HKJA 1ZBWA 2VCDA 3O5DA 3VAWA 1IX5A 1YW5A 3PQHA 4TNSA 4TW8A 1WMVA 2JMFA 3NRKA 4C02B 2M8JA 4W9PA 2KE0A 5DEZA 5HT1A 1C9HA 3WD0A 2WADA 3ALFA 1LQ0A 1FKLA 3AS0A 3FY1A 2ZR4A 1A7XA 4FAPA 2EZ5W 1J4HA 2FAPA 1TK7A 3B7XA 1D6OA 4WIWA 2WLZA 1LJYA 4DH0A 3BXWA 1U79A 3ARTA 3KAIA 4E5RA 3CZ8A 1E6PA 2DT3A 4DRJA 3OOBA 3WD1A 4ZS6A 2YSIA 4DRPA 2KR7A 1FKFA 1B6CA 3ODKA 3UF8A 1KT1A 4WJXA 5DF0A 2ESCA 3UI6A 2IF4A 3GPKA 4XAKA 4DWSC 4ODRA 1LG2A 4G2PA 2MLZA 2Q5AA 2ZQUA 3FSBA 1RD6A 3ARUA 1J6YA 1NWTA 4Q7NA 2WK2A 2ITKA 3ARWA 3B8SA 3OA5A 3UQBA 4MNMA 4PTMA 2XP3A 3RM4A 4J4NA 4P8XA 4MNJA 1ITXA 4P8VA 4DWSD 1VF8A 4ZPVR 3RFWA 4S3KA 2YAJB 3CHCA 1J4IA 2DSVA 3ARYA 3I6CA 5CQ2A 3PR9A 4GIVA 2XP6A 3TDBA 3WKZA 4JFLA 2A3CA 3G6MA 4JYSA 3LE4A 2QRVA 2DG9A 4IQ2A 3UI4A 4HBEA 4DRIA 2DWVA 3JYJA 3RGCA 4Z2KA 3LKXB 1D7JA 4LGXA 2RE3A 2XP7A 4DRNA 1E15A 3B9AA 3MCBB 2PV2A 2G8ZA 4Z2HA 3PRDA 1NWSA 4ML4A 1HKKA 3WQVA 5GPRA 1NH6A 2DPEA 3IKDA 1QPFA 2DT0A 3O5QA 1E6ZA 5I98A 3MQHA 3AS2A 4WKFA 1EIBA 2OFNA 3B9EA 4KR0B 5HBFA 3AS3A 2M1IA 4WKAA 1ROUA 3IKGA 3FAPA 2MPHA 3ARRA 3RM9A 1JVWA 1H0GA 4WKHA 1W26A 1OGGA 1Q6IA 3UI5A 1EDQA 1ZB5A 2B31A 1ROTA 2MLYA 3ARQA 1X6LA 1NSGA 1FKHA 2F4EA 1JMQA 1FAPA 1R9HA 3MCBA 4ODLA 1EG3A 3PRAA 5D75A 4TX0A 4JFIA 1D2KA 4JFKA 5DITA 1FFQA 4DRKA 4ZPTR 1SR0A 1FKIA 4TW7A 4ZPWR 1WNOA 4W9OA 4GGQA 4ITZA 1HKMA 2IUZA 3O5OA 1CTNA 1E6RA 2PI6A 3MDYB 4DWSB 1TCOC 1EG4A 2XP4A 1K9RA 1FJDA 4ODQA 4J4OA 2YSGA 3O5EA 2YSBA 2ZR5A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2PPO A;  3CNG A;  3KAD A;  1D7H A;  3M85 A;  4ODN A;  1ZCN A;  2ZQT A;  4DRM A;  5HTG A;  1D7I A;  4LAV A;  2YSH A;  4DRH A;  3M7N A;  4IPX A;  2XP8 A;  1I5H W;  3O5I A;  2XP9 A;  1F8A B;  1KT0 A;  4MSP A;  3TCZ A;  3KAH A;  2KXQ A;  2PV3 A;  5DIV A;  2JV4 A;  2KGJ A;  2RSE A;  4U86 A;  1NMV A;  4ODK A;  4TYO A;  1FKJ A;  4DZ3 A;  1Y0O A;  1WR7 A;  3O5M A;  2MDI A;  3PRB A;  3O5J A;  2L4J A;  1Q6U A;  4DRQ A;  5HKG A;  2F2D A;  4DZ2 A;  2MF9 A;  1F40 A;  4QT2 A;  2LGO A;  3PA7 A;  2DK7 A;  4ODO A;  3L4H A;  2LJ4 A;  2M3O W;  2KO7 A;  4G50 A;  3KAF A;  1EQ3 A;  4DT4 A;  3O5R A;  4LAY A;  5HW6 A;  5HUA A;  1FKG A;  5AHT A;  1FKK A;  4TW6 A;  2VN1 A;  4O2T A;  1P5Q A;  4QIB A;  3O5P A;  4ODM A;  1YAT A;  2AWG A;  2KI3 A;  4JFM A;  2RUR A;  1FKS A;  2ZR6 A;  5DIU A;  2ZQV A;  2PBC A;  2N87 A;  3LUO A;  5J6E A;  1BL4 A;  2MLX A;  2MNT A;  3TC5 A;  2XPA A;  2LAJ A;  3O5K A;  3O5G A;  1QPL A;  2PV1 A;  3JXV A;  4LAW A;  2LKN A;  3KAB A;  1PBK A;  4QT3 A;  2JXW A;  2RUC A;  5GPG A;  1Q6H A;  2DK1 A;  3WH0 A;  1FKT A;  2L2S A;  4FN2 A;  2RQS A;  2UZ5 A;  4LAX A;  1L1P A;  4REX A;  1FKB A;  3KAG A;  2E45 A;  2JX8 A;  3UQA A;  1PIN A;  2Y78 A;  5B8I C;  3CGM A;  1N1A A;  1T11 A;  2XP5 A;  2LPV A;  3O5L A;  4U85 A;  1JNT A;  1M5Y A;  1J4R A;  2DG3 A;  4N19 A;  2DJY A;  4IQC A;  1K9Q A;  2RUD A;  2F21 A;  1HXV A;  2BA1 A;  4ODP A;  4MGV A;  3KAC A;  2RUQ A;  3UQI A;  3O5F A;  4BF8 A;  2PPN A;  4NNR A;  4DRO A;  5HW8 A;  1ZK6 A;  3JYM A;  3KCE A;  2M2A A;  1BKF A;  4W9Q A;  2ZAJ A;  1JNS A;  4U84 A;  3IHZ A;  2M08 A;  2YSF A;  5HWB A;  1O6W A;  2ZQS A;  2D9F A;  5HW7 A;  2XPB A;  3NTP A;  4DIP A;  5HWC A;  1FKD A;  2PPP A;  2FKE A;  2M8I A;  2K8I A;  3H9R B;  3KZ7 A;  1NMW A;  1FD9 A;  2KFW A;  3NI6 A;  2DG4 A;  1QZ2 A;  1Q1C A;  2DMV A;  5BXJ A;  1FKR A;  3CGN A;  3IK8 A;  1EYM A;  4JFJ A;  3EY6 A;  2JZV A;  4R0X A;  2VCD A;  3O5D A;  3VAW A;  1YW5 A;  4TNS A;  4TW8 A;  1WMV A;  2JMF A;  3NRK A;  4C02 B;  2M8J A;  4W9P A;  2KE0 A;  5HT1 A;  1C9H A;  1FKL A;  2ZR4 A;  4FAP A;  1A7X A;  2EZ5 W;  1J4H A;  2FAP A;  1TK7 A;  3B7X A;  1D6O A;  4DH0 A;  1U79 A;  3KAI A;  4E5R A;  4DRJ A;  3OOB A;  2YSI A;  4DRP A;  2KR7 A;  1FKF A;  1B6C A;  3ODK A;  3UF8 A;  1KT1 A;  3UI6 A;  2IF4 A;  3GPK A;  4ODR A;  4G2P A;  2MLZ A;  2Q5A A;  2ZQU A;  1J6Y A;  2ITK A;  3UQB A;  2XP3 A;  4J4N A;  3RFW A;  1J4I A;  3I6C A;  5CQ2 A;  4GIV A;  2XP6 A;  3TDB A;  4JFL A;  4JYS A;  3LE4 A;  2DG9 A;  4IQ2 A;  3UI4 A;  4DRI A;  2DWV A;  3JYJ A;  3RGC A;  1D7J A;  2RE3 A;  2XP7 A;  4DRN A;  2PV2 A;  3PRD A;  3IKD A;  1QPF A;  3O5Q A;  5I98 A;  2OFN A;  2M1I A;  3IKG A;  1ROU A;  3FAP A;  2MPH A;  1JVW A;  1W26 A;  1Q6I A;  3UI5 A;  1ROT A;  2MLY A;  1NSG A;  1FKH A;  2F4E A;  1JMQ A;  1FAP A;  1R9H A;  4ODL A;  1EG3 A;  5D75 A;  4TX0 A;  4JFI A;  4JFK A;  5DIT A;  4DRK A;  1FKI A;  4TW7 A;  4W9O A;  4GGQ A;  4ITZ A;  3O5O A;  3MDY B;  1TCO C;  1EG4 A;  2XP4 A;  1K9R A;  1FJD A;  4ODQ A;  4J4O A;  2YSG A;  3O5E A;  2YSB A;  2ZR5 A; 
#chains in the Genus database with same CATH topology
 2PPO A;  3CNG A;  1SYT A;  3KAD A;  1D7H A;  4MTV A;  3M85 A;  4R5E A;  3WD4 A;  4ODN A;  1ZCN A;  1WB0 A;  2O9O A;  2ZQT A;  4Q22 A;  5E65 A;  4DRM A;  5HTG A;  2ETN A;  1D7I A;  1O6I A;  3AQU A;  4LAV A;  2YSH A;  4L72 B;  5GQB A;  4DRH A;  3M7N A;  4MPK A;  3WQW A;  4IPX A;  2XP8 A;  2B5U B;  1I5H W;  2QF8 A;  3O5I A;  2XP9 A;  3WL1 A;  1F8A B;  2YBU A;  1E6N A;  1GRJ A;  1KT0 A;  4MSP A;  1LL4 A;  3TCZ A;  3KAH A;  4MNL A;  2DSZ A;  2KXQ A;  2PV3 A;  5DIV A;  2JV4 A;  2KGJ A;  2RSE A;  4S3J A;  4U86 A;  1NMV A;  4ODK A;  4TYO A;  1FKJ A;  4DZ3 A;  1Y0O A;  2EUL A;  1WR7 A;  3CHF A;  1W9P A;  1FFR A;  3O5M A;  4A0T A;  3WD3 A;  2DSU A;  2MDI A;  4Z2G A;  1FLC A;  3MQG A;  4W5U A;  3PRB A;  3O5J A;  1NWU A;  1HJV A;  2L4J A;  1Q6U A;  2OWO A;  4DRQ A;  5HKG A;  3QOK A;  2F2D A;  4DZ2 A;  3FS8 A;  3WD2 A;  3CHD A;  4MAV A;  2MF9 A;  1F40 A;  1E9L A;  2DT2 A;  2DSW A;  4QT2 A;  2LGO A;  3EIP A;  1TFV A;  3PA7 A;  4Z2I A;  2DK7 A;  4ODO A;  3W4R A;  3L4H A;  2LJ4 A;  2M3O W;  4IT4 A;  2KO7 A;  4G50 A;  3KAF A;  1EQ3 A;  4DT4 A;  3O5R A;  4LAY A;  4KQZ A;  4P8W A;  1W9U A;  1HKI A;  1JNE A;  5HW6 A;  4HAR A;  5HUA A;  1WAW A;  1FKG A;  5AHT A;  1FKK A;  4TW6 A;  2VN1 A;  4O2T A;  1P5Q A;  1UR8 A;  4QIB A;  2WM0 A;  1LL7 A;  3B9D A;  3O5P A;  4ODM A;  1YAT A;  2AWG A;  3LKX A;  5JH8 A;  3G6L A;  3FXY A;  2KI3 A;  3CH9 A;  3AS1 A;  4JFM A;  2RUR A;  1FKS A;  1LL6 A;  4P8U A;  2ZR6 A;  1ZL1 A;  5DIU A;  1EHN A;  4QZV B;  4L3N A;  3ARO A;  1ZU8 A;  1HJW A;  1ZBC A;  2ZQV A;  1K9T A;  2PBC A;  2N87 A;  3LUO A;  5J6E A;  1BL4 A;  2MLX A;  1LG1 A;  2MNT A;  3TC5 A;  2XPA A;  5E66 A;  2LAJ A;  3O5K A;  4Z2L A;  3O5G A;  1QPL A;  4UDM A;  2PV1 A;  3JXV A;  4LAW A;  2FDM A;  2LKN A;  4A0U A;  3KAB A;  1PBK A;  2AOS A;  2WAE A;  2Y8N B;  3ARV A;  3FSC A;  3ARZ A;  4QT3 A;  2JXW A;  2RUC A;  2YBT A;  3GU0 A;  5GPG A;  1Q6H A;  2DK1 A;  3WH0 A;  1FKT A;  2L2S A;  1W1P A;  4FN2 A;  1GOI A;  4URI A;  2RQS A;  2UZ5 A;  4LAX A;  1L1P A;  4REX A;  1FKB A;  3ARP A;  3KAG A;  2E45 A;  2JX8 A;  3UQA A;  1PIN A;  1KFW A;  4DWS A;  2Y78 A;  4NZC A;  5B8I C;  3CGM A;  5DO2 A;  2WLY A;  1N1A A;  1T11 A;  3GTY X;  2O92 A;  2XP5 A;  1W1V A;  2LPV A;  3RM8 A;  4HBO A;  5U47 A;  4WK9 A;  3O5L A;  4U85 A;  1TR8 A;  1JNT A;  1M5Y A;  5E64 A;  1J4R A;  1GPF A;  1XRV A;  2DG3 A;  4N19 A;  2DJY A;  1ZBK A;  3CHE A;  2A3A A;  4IQC A;  5E62 A;  1K9Q A;  4Z2J A;  2RUD A;  2F21 A;  1HXV A;  2BA1 A;  4ODP A;  4MGV A;  3KAC A;  3WIJ A;  2RUQ A;  3UQI A;  3BMB A;  1NWR A;  5E5W A;  1X6N A;  3O5F A;  2G41 A;  2PPN A;  4NNR A;  4BF8 A;  4DRO A;  5HW8 A;  1ZK6 A;  1W1T A;  3JYM A;  3KCE A;  2M2A A;  1W1Y A;  1BKF A;  2OLH A;  4GLX A;  2ZAJ A;  4W9Q A;  1JNS A;  1JND A;  4U84 A;  1OGB A;  3IHZ A;  2M08 A;  2A3B A;  2YSF A;  1JCH B;  5HWB A;  1O6W A;  2ZQS A;  2D9F A;  5HW7 A;  1GUV A;  2XPB A;  3NTP A;  4DIP A;  5HWC A;  3ARX A;  1FKD A;  2PPP A;  2FKE A;  3ALG A;  2M8I A;  2K8I A;  2DT1 A;  3H9R B;  3KZ7 A;  3WL0 A;  1NMW A;  1FD9 A;  2KFW A;  3ARS A;  1H0I A;  3NI6 A;  2DG4 A;  1QZ2 A;  1OWQ A;  1W9V A;  2A3E A;  1ZBV A;  1Q1C A;  4AY1 A;  2DMV A;  1XHG A;  5BXJ A;  1FKR A;  3CGN A;  3IK8 A;  1HJX A;  4MNK A;  1EYM A;  1UR9 A;  4JFJ A;  4NSB A;  3EY6 A;  2JZV A;  4IT6 A;  3RME A;  4R0X A;  1RP5 A;  1HKJ A;  1ZBW A;  2VCD A;  3O5D A;  3VAW A;  1IX5 A;  1YW5 A;  3PQH A;  4TNS A;  4TW8 A;  1WMV A;  2JMF A;  2F23 A;  3NRK A;  4C02 B;  2M8J A;  4W9P A;  2KE0 A;  5DEZ A;  5HT1 A;  1C9H A;  3WD0 A;  2WAD A;  3ALF A;  1LQ0 A;  1FKL A;  3AS0 A;  3FY1 A;  2ZR4 A;  1A7X A;  4FAP A;  2EZ5 W;  1J4H A;  2FAP A;  1TK7 A;  3B7X A;  1D6O A;  4WIW A;  2WLZ A;  1LJY A;  4DH0 A;  3BXW A;  1U79 A;  3ART A;  3KAI A;  4E5R A;  3CZ8 A;  1E6P A;  2DT3 A;  4DRJ A;  3OOB A;  3WD1 A;  4ZS6 A;  2YSI A;  4DRP A;  2KR7 A;  1FKF A;  1B6C A;  3ODK A;  3UF8 A;  1KT1 A;  4WJX A;  5DF0 A;  2ESC A;  3UI6 A;  2IF4 A;  3GPK A;  4XAK A;  4DWS C;  4ODR A;  1LG2 A;  4G2P A;  2MLZ A;  2Q5A A;  2ZQU A;  3FSB A;  1RD6 A;  3ARU A;  1J6Y A;  1NWT A;  4Q7N A;  2WK2 A;  2ITK A;  3ARW A;  3B8S A;  3OA5 A;  3UQB A;  4MNM A;  4PTM A;  2XP3 A;  3RM4 A;  4J4N A;  2PN0 A;  4P8X A;  4MNJ A;  1ITX A;  4P8V A;  4DWS D;  1VF8 A;  4ZPV R;  3RFW A;  4S3K A;  2YAJ B;  3CHC A;  1J4I A;  2DSV A;  3ARY A;  3I6C A;  5CQ2 A;  3PR9 A;  4GIV A;  2XP6 A;  3TDB A;  3WKZ A;  4JFL A;  2A3C A;  3G6M A;  4JYS A;  3LE4 A;  2QRV A;  2DG9 A;  4IQ2 A;  3UI4 A;  4HBE A;  4DRI A;  2DWV A;  3JYJ A;  3RGC A;  4Z2K A;  3LKX B;  1D7J A;  4LGX A;  2RE3 A;  2XP7 A;  4DRN A;  1E15 A;  3B9A A;  3MCB B;  2PV2 A;  2G8Z A;  4Z2H A;  3PRD A;  1NWS A;  4ML4 A;  1HKK A;  3WQV A;  5GPR A;  2P4V A;  1NH6 A;  2DPE A;  3IKD A;  1QPF A;  2DT0 A;  3O5Q A;  1E6Z A;  5I98 A;  3MQH A;  3AS2 A;  4WKF A;  1EIB A;  2OFN A;  3B9E A;  4KR0 B;  5HBF A;  3AS3 A;  2M1I A;  4WKA A;  1ROU A;  3IKG A;  3FAP A;  2MPH A;  3ARR A;  3RM9 A;  1JVW A;  1H0G A;  4WKH A;  1W26 A;  1OGG A;  1Q6I A;  3UI5 A;  1EDQ A;  1ZB5 A;  2B31 A;  1ROT A;  2MLY A;  3ARQ A;  1X6L A;  1NSG A;  1FKH A;  2F4E A;  1JMQ A;  1FAP A;  1R9H A;  3MCB A;  4ODL A;  1EG3 A;  3PRA A;  5D75 A;  1E44 A;  4TX0 A;  4JFI A;  1D2K A;  4JFK A;  5DIT A;  1FFQ A;  4DRK A;  4ZPT R;  1SR0 A;  1FKI A;  4TW7 A;  4ZPW R;  1WNO A;  4W9O A;  4GGQ A;  4ITZ A;  1HKM A;  2IUZ A;  3O5O A;  1CTN A;  1E6R A;  2PI6 A;  3MDY B;  4DWS B;  1TCO C;  1EG4 A;  2XP4 A;  1K9R A;  1FJD A;  4ODQ A;  4J4O A;  2YSG A;  3O5E A;  2YSB A;  2ZR5 A; 
#chains in the Genus database with same CATH homology
 2PPO A;  3CNG A;  1SYT A;  3KAD A;  1D7H A;  4MTV A;  3M85 A;  4R5E A;  3WD4 A;  4ODN A;  1ZCN A;  1WB0 A;  2O9O A;  2ZQT A;  4Q22 A;  5E65 A;  4DRM A;  5HTG A;  1D7I A;  1O6I A;  3AQU A;  4LAV A;  2YSH A;  4L72 B;  5GQB A;  4DRH A;  3M7N A;  4MPK A;  3WQW A;  4IPX A;  2XP8 A;  1I5H W;  2QF8 A;  3O5I A;  2XP9 A;  3WL1 A;  1F8A B;  2YBU A;  1E6N A;  1KT0 A;  4MSP A;  1LL4 A;  3TCZ A;  3KAH A;  4MNL A;  2DSZ A;  2KXQ A;  2PV3 A;  5DIV A;  2JV4 A;  2KGJ A;  2RSE A;  4S3J A;  4U86 A;  1NMV A;  4ODK A;  4TYO A;  1FKJ A;  4DZ3 A;  1Y0O A;  1WR7 A;  3CHF A;  1W9P A;  1FFR A;  3O5M A;  4A0T A;  3WD3 A;  2DSU A;  2MDI A;  4Z2G A;  1FLC A;  3MQG A;  4W5U A;  3PRB A;  3O5J A;  1NWU A;  1HJV A;  2L4J A;  1Q6U A;  2OWO A;  4DRQ A;  5HKG A;  3QOK A;  2F2D A;  4DZ2 A;  3FS8 A;  3WD2 A;  3CHD A;  4MAV A;  2MF9 A;  1F40 A;  1E9L A;  2DT2 A;  2DSW A;  4QT2 A;  2LGO A;  1TFV A;  3PA7 A;  4Z2I A;  2DK7 A;  4ODO A;  3W4R A;  3L4H A;  2LJ4 A;  2M3O W;  4IT4 A;  2KO7 A;  4G50 A;  3KAF A;  1EQ3 A;  4DT4 A;  3O5R A;  4LAY A;  4KQZ A;  4P8W A;  1W9U A;  1HKI A;  1JNE A;  5HW6 A;  4HAR A;  5HUA A;  1WAW A;  1FKG A;  5AHT A;  1FKK A;  4TW6 A;  2VN1 A;  4O2T A;  1P5Q A;  1UR8 A;  4QIB A;  2WM0 A;  1LL7 A;  3B9D A;  3O5P A;  4ODM A;  1YAT A;  2AWG A;  3LKX A;  5JH8 A;  3G6L A;  3FXY A;  2KI3 A;  3CH9 A;  3AS1 A;  4JFM A;  2RUR A;  1FKS A;  1LL6 A;  4P8U A;  2ZR6 A;  1ZL1 A;  5DIU A;  1EHN A;  4QZV B;  4L3N A;  3ARO A;  1ZU8 A;  1HJW A;  1ZBC A;  2ZQV A;  1K9T A;  2PBC A;  2N87 A;  3LUO A;  5J6E A;  1BL4 A;  2MLX A;  1LG1 A;  2MNT A;  3TC5 A;  2XPA A;  5E66 A;  2LAJ A;  3O5K A;  4Z2L A;  3O5G A;  1QPL A;  2PV1 A;  3JXV A;  4LAW A;  2FDM A;  2LKN A;  4A0U A;  3KAB A;  1PBK A;  2AOS A;  2WAE A;  2Y8N B;  3ARV A;  3FSC A;  3ARZ A;  4QT3 A;  2JXW A;  2RUC A;  2YBT A;  5GPG A;  1Q6H A;  2DK1 A;  3WH0 A;  1FKT A;  2L2S A;  1W1P A;  4FN2 A;  1GOI A;  4URI A;  2RQS A;  2UZ5 A;  4LAX A;  1L1P A;  4REX A;  1FKB A;  3ARP A;  3KAG A;  2E45 A;  2JX8 A;  3UQA A;  1PIN A;  1KFW A;  4DWS A;  2Y78 A;  4NZC A;  5B8I C;  3CGM A;  5DO2 A;  2WLY A;  1N1A A;  1T11 A;  2O92 A;  2XP5 A;  1W1V A;  2LPV A;  3RM8 A;  4HBO A;  5U47 A;  4WK9 A;  3O5L A;  4U85 A;  1TR8 A;  1JNT A;  1M5Y A;  5E64 A;  1J4R A;  1GPF A;  1XRV A;  2DG3 A;  4N19 A;  2DJY A;  1ZBK A;  3CHE A;  2A3A A;  4IQC A;  5E62 A;  1K9Q A;  4Z2J A;  2RUD A;  2F21 A;  1HXV A;  2BA1 A;  4ODP A;  4MGV A;  3KAC A;  3WIJ A;  2RUQ A;  3UQI A;  1NWR A;  5E5W A;  1X6N A;  3O5F A;  2G41 A;  2PPN A;  4NNR A;  4BF8 A;  4DRO A;  5HW8 A;  1ZK6 A;  1W1T A;  3JYM A;  3KCE A;  2M2A A;  1W1Y A;  1BKF A;  2OLH A;  4GLX A;  2ZAJ A;  4W9Q A;  1JNS A;  1JND A;  4U84 A;  1OGB A;  3IHZ A;  2M08 A;  2A3B A;  2YSF A;  5HWB A;  1O6W A;  2ZQS A;  2D9F A;  5HW7 A;  1GUV A;  2XPB A;  3NTP A;  4DIP A;  5HWC A;  3ARX A;  1FKD A;  2PPP A;  2FKE A;  3ALG A;  2M8I A;  2K8I A;  2DT1 A;  3H9R B;  3KZ7 A;  3WL0 A;  1NMW A;  1FD9 A;  2KFW A;  3ARS A;  1H0I A;  3NI6 A;  2DG4 A;  1QZ2 A;  1OWQ A;  1W9V A;  2A3E A;  1ZBV A;  1Q1C A;  4AY1 A;  2DMV A;  1XHG A;  5BXJ A;  1FKR A;  3CGN A;  3IK8 A;  1HJX A;  4MNK A;  1EYM A;  1UR9 A;  4JFJ A;  4NSB A;  3EY6 A;  2JZV A;  4IT6 A;  3RME A;  4R0X A;  1RP5 A;  1HKJ A;  1ZBW A;  2VCD A;  3O5D A;  3VAW A;  1IX5 A;  1YW5 A;  3PQH A;  4TNS A;  4TW8 A;  1WMV A;  2JMF A;  3NRK A;  4C02 B;  2M8J A;  4W9P A;  2KE0 A;  5DEZ A;  5HT1 A;  1C9H A;  3WD0 A;  2WAD A;  3ALF A;  1LQ0 A;  1FKL A;  3AS0 A;  3FY1 A;  2ZR4 A;  1A7X A;  4FAP A;  2EZ5 W;  1J4H A;  2FAP A;  1TK7 A;  3B7X A;  1D6O A;  4WIW A;  2WLZ A;  1LJY A;  4DH0 A;  3BXW A;  1U79 A;  3ART A;  3KAI A;  4E5R A;  3CZ8 A;  1E6P A;  2DT3 A;  4DRJ A;  3OOB A;  3WD1 A;  4ZS6 A;  2YSI A;  4DRP A;  2KR7 A;  1FKF A;  1B6C A;  3ODK A;  3UF8 A;  1KT1 A;  4WJX A;  5DF0 A;  2ESC A;  3UI6 A;  2IF4 A;  3GPK A;  4XAK A;  4DWS C;  4ODR A;  1LG2 A;  4G2P A;  2MLZ A;  2Q5A A;  2ZQU A;  3FSB A;  1RD6 A;  3ARU A;  1J6Y A;  1NWT A;  4Q7N A;  2WK2 A;  2ITK A;  3ARW A;  3B8S A;  3OA5 A;  3UQB A;  4MNM A;  4PTM A;  2XP3 A;  3RM4 A;  4J4N A;  4P8X A;  4MNJ A;  1ITX A;  4P8V A;  4DWS D;  1VF8 A;  4ZPV R;  3RFW A;  4S3K A;  2YAJ B;  3CHC A;  1J4I A;  2DSV A;  3ARY A;  3I6C A;  5CQ2 A;  3PR9 A;  4GIV A;  2XP6 A;  3TDB A;  3WKZ A;  4JFL A;  2A3C A;  3G6M A;  4JYS A;  3LE4 A;  2QRV A;  2DG9 A;  4IQ2 A;  3UI4 A;  4HBE A;  4DRI A;  2DWV A;  3JYJ A;  3RGC A;  4Z2K A;  3LKX B;  1D7J A;  4LGX A;  2RE3 A;  2XP7 A;  4DRN A;  1E15 A;  3B9A A;  3MCB B;  2PV2 A;  2G8Z A;  4Z2H A;  3PRD A;  1NWS A;  4ML4 A;  1HKK A;  3WQV A;  5GPR A;  1NH6 A;  2DPE A;  3IKD A;  1QPF A;  2DT0 A;  3O5Q A;  1E6Z A;  5I98 A;  3MQH A;  3AS2 A;  4WKF A;  1EIB A;  2OFN A;  3B9E A;  4KR0 B;  5HBF A;  3AS3 A;  2M1I A;  4WKA A;  1ROU A;  3IKG A;  3FAP A;  2MPH A;  3ARR A;  3RM9 A;  1JVW A;  1H0G A;  4WKH A;  1W26 A;  1OGG A;  1Q6I A;  3UI5 A;  1EDQ A;  1ZB5 A;  2B31 A;  1ROT A;  2MLY A;  3ARQ A;  1X6L A;  1NSG A;  1FKH A;  2F4E A;  1JMQ A;  1FAP A;  1R9H A;  3MCB A;  4ODL A;  1EG3 A;  3PRA A;  5D75 A;  4TX0 A;  4JFI A;  1D2K A;  4JFK A;  5DIT A;  1FFQ A;  4DRK A;  4ZPT R;  1SR0 A;  1FKI A;  4TW7 A;  4ZPW R;  1WNO A;  4W9O A;  4GGQ A;  4ITZ A;  1HKM A;  2IUZ A;  3O5O A;  1CTN A;  1E6R A;  2PI6 A;  3MDY B;  4DWS B;  1TCO C;  1EG4 A;  2XP4 A;  1K9R A;  1FJD A;  4ODQ A;  4J4O A;  2YSG A;  3O5E A;  2YSB A;  2ZR5 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...