4QIBA

Oxidation-mediated inhibition of the peptidyl-prolyl isomerase pin1
Total Genus 39
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
39
sequence length
157
structure length
144
Chain Sequence
LPPGWEKAMSRSSGRVYYFNHITNASQWERPSEPARVRCSHLLVKHSQSRRPSSWRQEKITRTKEEALELINGYIQKIKSGEEDFESLASQFSDSSAKARGDLGAFSRGQMQKPFEDASFALRTGEMSGPVFTDSGIHIILRTE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Peroxide-mediated oxidation and inhibition of the peptidyl-prolyl isomerase Pin1.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Isomerase
molecule keywords Peptidyl-prolyl cis-trans isomerase NIMA-interacting 1
total genus 39
structure length 144
sequence length 157
ec nomenclature ec 5.2.1.8: Peptidylprolyl isomerase.
pdb deposition date 2014-05-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00397 WW WW domain
A PF00639 Rotamase PPIC-type PPIASE domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.20.70.10 Mainly Beta Single Sheet Ubiquitin Ligase Nedd4; Chain: W; Ubiquitin Ligase Nedd4; Chain: W; 4qibA01
3.10.50.40 Alpha Beta Roll Chitinase A; domain 3 Chitinase A; domain 3 4qibA02
2LAJA 2PV2A 3O5JA 5DITA 5HTGA 3M85A 4JFKA 2XP3A 2JZVA 3CGNA 3O5QA 1ROUA 1U79A 4JYSA 3RGCA 5DIUA 1FKSA 1WR7A 4C02B 2M2AA 3O5KA 4J4NA 4J4OA 2PPOA 2F4EA 2VN1A 4U86A 5HW6A 4G2PA 3TCZA 2FAPA 4DROA 3TDBA 4TX0A 2DK7A 2ZR6A 1Q6IA 1EQ3A 1J4HA 2M3OW 3JYMA 1W26A 3M7NA 1D7IA 1KT1A 3O5PA 2ZQUA 2JXWA 2F21A 1D7JA 1QPFA 4GGQA 4TW8A 1PINA 2ZAJA 2ZR5A 1FKTA 2XP8A 1D6OA 2VCDA 3VAWA 1NSGA 2UZ5A 4MGVA 2KR7A 5GPGA 4JFLA 1FKKA 2KO7A 2MF9A 1FKDA 5HWBA 1ZCNA 1TCOC 4DRPA 3JXVA 2PBCA 1QPLA 3O5IA 4DRIA 4DT4A 1FAPA 2M8JA 3UI4A 1PBKA 4TW7A 2RUDA 4U84A 1K9QA 1O6WA 5B8IC 2OFNA 3CGMA 4LAVA 1FKRA 5BXJA 1JVWA 1NMWA 4W9QA 2BA1A 3CNGA 3KAHA 2IF4A 1P5QA 1N1AA 1Q1CA 3O5DA 3NRKA 4LAYA 3RFWA 4BF8A 1R9HA 4TW6A 3KAFA 1FKLA 2YSBA 3KCEA 2DG4A 4ODQA 4QT3A 4DRJA 2JX8A 2XP9A 4DZ2A 4DRKA 2XPBA 2PPNA 1F40A 2ITKA 3PA7A 2LJ4A 4MSPA 2M1IA 3IHZA 3UI5A 2M08A 3O5OA 1Y0OA 2MLXA 1KT0A 4ODKA 2KXQA 1J4RA 4G50A 4ODNA 1NMVA 1FKGA 4IPXA 5HWCA 1FKFA 4JFJA 5D75A 3IKGA 4DRQA 4DRNA 2N87A 5J6EA 3UQAA 5HUAA 1F8AB 1J4IA 3KZ7A 2LKNA 3PRDA 5HW8A 2E45A 5I98A 5HT1A 2MLYA 2RURA 2L4JA 2LPVA 2AWGA 4FN2A 1QZ2A 1EYMA 4JFMA 2MDIA 2YSHA 4R0XA 5HKGA 2JMFA 1I5HW 1D7HA 2D9FA 2RUCA 2ZQTA 3KAIA 2DG9A 2DK1A 2K8IA 2XP4A 1FD9A 4DRHA 2F2DA 3NI6A 1WMVA 1BL4A 4IQCA 1FKJA 3IK8A 2RE3A 4DZ3A 4IQ2A 2XP7A 4JFIA 1JNSA 4LAWA 2DWVA 4W9OA 4DH0A 1EG4A 1YW5A 2KFWA 3IKDA 1B6CA 3UQBA 1L1PA 2L2SA 1HXVA 2DG3A 2PPPA 1T11A 1C9HA 2PV3A 2Y78A 4TYOA 1FKBA 4DIPA 3KABA 3ODKA 2FKEA 2LGOA 3O5GA 2RSEA 1FKHA 3O5EA 4GIVA 4ODOA 3L4HA 2RUQA 3I6CA 4E5RA 1K9RA 1Q6HA 1EG3A 2ZQVA 1BKFA 3UI6A 1FKIA 1JMQA 4QT2A 3LUOA 3TC5A 1ROTA 4ODLA 3KACA 1YATA 2DMVA 2JV4A 2XP6A 5CQ2A 2YSIA 1Q6UA 3NTPA 2RQSA 1M5YA 2XP5A 2ZR4A 2XPAA 3LE4A 3FAPA 3H9RB 4ODMA 5DIVA 2YSGA 2PV1A 3WH0A 3EY6A 2Q5AA 3O5MA 4ODRA 4W9PA 3JYJA 5HW7A 3KADA 3UF8A 2MNTA 4DRMA 4REXA 4QIBA 2KE0A 2MLZA 4NNRA 4TNSA 3O5RA 1A7XA 4O2TA 1ZK6A 2KI3A 3B7XA 3GPKA 4ITZA 2M8IA 4N19A 4ODPA 2ZQSA 3OOBA 2KGJA 3O5LA 3O5FA 2MPHA 2YSFA 3PRBA 5AHTA 3KAGA 1FJDA 1J6YA 1TK7A 4FAPA 2EZ5W 4LAXA 2DJYA 3MDYB 1JNTA 3UQIA 4U85A
chains in the Genus database with same CATH superfamily
5E62A 2PV2A 3CHDA 5HTGA 1WNOA 2JZVA 3CGNA 4UDMA 3RM4A 4J4OA 3O5KA 3ARZA 4NZCA 4G2PA 4MTVA 1ZBKA 3G6LA 4S3JA 4Q7NA 1TR8A 3JYMA 2DSZA 1D7JA 2P4VA 2ZAJA 5GPGA 3WD3A 2KO7A 2MF9A 5HWBA 1ZCNA 3EIPA 4DWSC 1QPLA 3PRAA 4DT4A 1O6IA 3UI4A 1GPFA 1PBKA 2RUDA 1E6NA 2FDMA 4P8VA 1TFVA 1O6WA 3AS0A 2QRVA 5BXJA 2IF4A 3NRKA 4HARA 3KCEA 2DG4A 2JX8A 2XP9A 1W1VA 2ITKA 4LGXA 1JCHB 1NWTA 2M08A 2ETNA 3AS2A 4G50A 4IT6A 1NMVA 4JFJA 5D75A 1LL6A 1OGGA 2DT3A 2LKNA 4Z2LA 2E45A 4Z2JA 2RURA 1WB0A 4R0XA 5HKGA 2MDIA 5E5WA 2DSVA 3CZ8A 2D9FA 4XAKA 2K8IA 2DG9A 4DRHA 3MQHA 1WMVA 1BL4A 4L72B 2RE3A 4IQ2A 4WK9A 1E6PA 2DT1A 1IX5A 4DH0A 1YW5A 4P8WA 1XRVA 3B9DA 1B6CA 1OGBA 1T11A 3ALGA 2PV3A 3KABA 2LGOA 1FKHA 1HKKA 1W9VA 1Q6HA 3ARYA 2OWOA 1FKIA 3LUOA 1ROTA 2RQSA 2XP6A 3MCBB 2B5UB 3LE4A 3FAPA 5HBFA 3H9RB 1GUVA 3FSBA 3WH0A 3CHCA 3JYJA 3KADA 1GRJA 3W4RA 2MNTA 3GTYX 1EDQA 4QIBA 2KE0A 3O5RA 1A7XA 4O2TA 1OWQA 4HBEA 3O5LA 3O5FA 2G41A 5DEZA 1X6NA 1ZB5A 2DJYA 3WIJA 1JNTA 3O5JA 5DITA 4JFKA 5U47A 3O5QA 1ROUA 1U79A 4JYSA 3RGCA 1WR7A 2M2AA 2G8ZA 4MNLA 2VN1A 4U86A 3TCZA 2FAPA 4ZPTR 3TDBA 3BMBA 2ZR6A 1Q6IA 1EQ3A 1E6RA 1W26A 1HJVA 4GGQA 3WL0A 1UR9A 2ZR5A 1FKTA 1D6OA 4Q22A 2UZ5A 2KR7A 1TCOC 4DRIA 5DF0A 1FAPA 4U84A 1K9QA 3CGMA 2WLYA 1NMWA 2Y8NB 3KAHA 4WIWA 3ARXA 1Q1CA 4IT4A 4TW6A 4DRJA 4ODQA 2YSBA 1LG2A 3CHFA 1F40A 2M1IA 4URIA 3O5OA 2MLXA 2DPEA 4ODKA 4ODNA 3RMEA 1W1PA 5E64A 1FFQA 3ARWA 1FKFA 4DRQA 4DRNA 3UQAA 5HUAA 4KQZA 3KZ7A 5I98A 2MLYA 2PN0A 2DSWA 2L4JA 2LPVA 4FN2A 1SYTA 3ALFA 1I5HW 1W1TA 1E15A 3NI6A 1FKJA 1K9TA 4NSBA 2XP7A 4JFIA 1HKIA 4Z2GA 2DT0A 4LAWA 4QZVB 2IUZA 1WAWA 2WAEA 1HXVA 4R5EA 2DG3A 2PPPA 2Y78A 4TYOA 1FKBA 3ODKA 3FY1A 3O5GA 3WQVA 4ML4A 4MNJA 3L4HA 3WD0A 4WKHA 1EHNA 1EG3A 1BKFA 1JMQA 4QT2A 2PI6A 2DMVA 2JV4A 1VF8A 2XP5A 2XPAA 3WL1A 2PV1A 4Z2KA 3ARQA 4W9PA 1H0GA 5HW7A 4TNSA 4P8UA 4ODPA 2KGJA 2OLHA 3AQUA 5AHTA 3KAGA 1J6YA 3ARRA 3ARPA 1RD6A 2WLZA 1W9UA 3QOKA 4U85A 3FSCA 3PR9A 2XP3A 3AS1A 3AROA 3CH9A 4J4NA 2PPOA 4DROA 1W1YA 4MAVA 4TX0A 2DK7A 2M3OW 4DWSB 3M7NA 1D7IA 1KT1A 2ZQUA 2JXWA 2F21A 2AOSA 1PINA 3VAWA 2VCDA 2XP8A 2A3EA 4JFLA 3MQGA 3O5IA 2A3CA 4TW7A 3ARTA 1NH6A 5GPRA 4WKAA 2OFNA 1SR0A 2BA1A 3O5DA 4MSPA 3RFWA 1P5QA 1N1AA 4LAYA 1FKLA 2WADA 3WKZA 1E9LA 4PTMA 4ZPVR 2XPBA 3WQWA 2A3AA 3PA7A 2LJ4A 3IHZA 4KR0B 1KT0A 1J4RA 4IPXA 5J6EA 3ARSA 4WKFA 1ZBVA 3LKXA 3RM8A 3RM9A 2AWGA 4P8XA 2A3BA 2JMFA 1D7HA 1NWRA 2XP4A 1FD9A 1LG1A 2F2DA 3WD1A 3IK8A 2O92A 4DZ3A 1JNSA 4W9OA 1JNDA 2KFWA 4DWSD 4ZS6A 1H0IA 1C9HA 3WD2A 1X6LA 1JNEA 2RSEA 3O5EA 4MNMA 4A0UA 4ODOA 2RUQA 1K9RA 1HKMA 3TC5A 1YATA 5CQ2A 2YSIA 5DIVA 4GLXA 1KFWA 4ODRA 3UF8A 2B31A 4DRMA 4NNRA 2MLZA 1CTNA 1ZK6A 4ITZA 4N19A 2MPHA 2YSFA 3PRBA 1TK7A 4FAPA 2EZ5W 4LAXA 5JH8A 3MDYB 2YBTA 4MPKA 3OA5A 2LAJA 3UQIA 3M85A 3B9AA 5DIUA 1FKSA 4C02B 4DWSA 1LQ0A 2F4EA 5HW6A 3FS8A 4A0TA 1J4HA 1GOIA 3G6MA 3CHEA 3AS3A 4TW8A 1QPFA 1LL4A 1RP5A 1NSGA 3ARVA 4MGVA 5E66A 1FKKA 1FKDA 3B8SA 4DRPA 5E65A 3JXVA 2PBCA 2M8JA 3FXYA 3MCBA 4ZPWR 1W9PA 5B8IC 1FKRA 4LAVA 3LKXB 1JVWA 2DT2A 2WM0A 4W9QA 3CNGA 4BF8A 3UQBA 1R9HA 3KAFA 4QT3A 4DZ2A 4L3NA 4DRKA 1HJWA 2PPNA 2QF8A 1FFRA 2DSUA 1UR8A 3UI5A 1XHGA 1NWUA 4HBOA 1Y0OA 2KXQA 1FKGA 3GU0A 1LJYA 5HWCA 4Z2HA 3IKGA 2N87A 1F8AB 1J4IA 1HKJA 3PRDA 4WJXA 4AY1A 5HW8A 5HT1A 1NWSA 1EYMA 1QZ2A 2YSHA 3B9EA 4JFMA 2RUCA 2ZQTA 3KAIA 5DO2A 2DK1A 4S3KA 1LL7A 4IQCA 3PQHA 2YBUA 2DWVA 2EULA 1ZBWA 1EG4A 2YAJB 2ESCA 4Z2IA 3IKDA 1L1PA 2L2SA 4DIPA 1D2KA 2FKEA 1HJXA 4GIVA 2O9OA 3BXWA 3I6CA 4E5RA 1FLCA 2ZQVA 3UI6A 1E44A 4ODLA 3KACA 1Q6UA 1EIBA 3O5PA 3NTPA 1ZL1A 1M5YA 2ZR4A 4ODMA 2YSGA 3EY6A 2Q5AA 3O5MA 3ARUA 2F23A 3WD4A 1E6ZA 4REXA 4W5UA 1ZBCA 2KI3A 3B7XA 3GPKA 2M8IA 2ZQSA 3OOBA 1ZU8A 1FJDA 2WK2A 5GQBA 4MNKA 1ITXA
chains in the Genus database with same CATH topology
5E62A 2PV2A 3CHDA 5HTGA 1WNOA 2JZVA 3CGNA 3RM4A 4J4OA 3O5KA 3ARZA 4NZCA 4G2PA 4MTVA 1ZBKA 3G6LA 4S3JA 4Q7NA 1TR8A 3JYMA 2DSZA 1D7JA 2ZAJA 5GPGA 3WD3A 2KO7A 2MF9A 5HWBA 1ZCNA 4DWSC 1QPLA 3PRAA 4DT4A 1O6IA 3UI4A 1GPFA 1PBKA 2RUDA 1E6NA 2FDMA 4P8VA 1TFVA 1O6WA 3AS0A 2QRVA 5BXJA 2IF4A 3NRKA 4HARA 3KCEA 2DG4A 2JX8A 2XP9A 1W1VA 2ITKA 4LGXA 1NWTA 2M08A 3AS2A 4G50A 4IT6A 1NMVA 4JFJA 5D75A 1LL6A 1OGGA 2DT3A 2LKNA 4Z2LA 2E45A 4Z2JA 2RURA 1WB0A 4R0XA 5HKGA 2MDIA 5E5WA 2DSVA 3CZ8A 2D9FA 4XAKA 2K8IA 2DG9A 4DRHA 3MQHA 1WMVA 1BL4A 4L72B 2RE3A 4IQ2A 4WK9A 1E6PA 2DT1A 1IX5A 4DH0A 1YW5A 4P8WA 1XRVA 3B9DA 1B6CA 1OGBA 1T11A 3ALGA 2PV3A 3KABA 2LGOA 1FKHA 1HKKA 1W9VA 1Q6HA 3ARYA 2OWOA 1FKIA 3LUOA 1ROTA 2RQSA 2XP6A 3MCBB 3LE4A 3FAPA 5HBFA 3H9RB 1GUVA 3FSBA 3WH0A 3CHCA 3JYJA 3KADA 3W4RA 2MNTA 1EDQA 4QIBA 2KE0A 3O5RA 1A7XA 4O2TA 1OWQA 4HBEA 3O5LA 3O5FA 2G41A 5DEZA 1X6NA 1ZB5A 2DJYA 3WIJA 1JNTA 3O5JA 5DITA 4JFKA 5U47A 3O5QA 1ROUA 1U79A 4JYSA 3RGCA 1WR7A 2M2AA 2G8ZA 4MNLA 2VN1A 4U86A 3TCZA 2FAPA 4ZPTR 3TDBA 2ZR6A 1Q6IA 1EQ3A 1E6RA 1W26A 1HJVA 4GGQA 3WL0A 1UR9A 2ZR5A 1FKTA 1D6OA 4Q22A 2UZ5A 2KR7A 1TCOC 4DRIA 5DF0A 1FAPA 4U84A 1K9QA 3CGMA 2WLYA 1NMWA 2Y8NB 3KAHA 4WIWA 3ARXA 1Q1CA 4IT4A 4TW6A 4DRJA 4ODQA 2YSBA 1LG2A 3CHFA 1F40A 2M1IA 4URIA 3O5OA 2MLXA 2DPEA 4ODKA 4ODNA 3RMEA 1W1PA 5E64A 1FFQA 3ARWA 1FKFA 4DRQA 4DRNA 3UQAA 5HUAA 4KQZA 3KZ7A 5I98A 2MLYA 2DSWA 2L4JA 2LPVA 4FN2A 1SYTA 3ALFA 1I5HW 1W1TA 1E15A 3NI6A 1FKJA 1K9TA 4NSBA 2XP7A 4JFIA 1HKIA 4Z2GA 2DT0A 4LAWA 4QZVB 2IUZA 1WAWA 2WAEA 1HXVA 4R5EA 2DG3A 2PPPA 2Y78A 4TYOA 1FKBA 3ODKA 3FY1A 3O5GA 3WQVA 4ML4A 4MNJA 3L4HA 3WD0A 4WKHA 1EHNA 1EG3A 1BKFA 1JMQA 4QT2A 2PI6A 2DMVA 2JV4A 1VF8A 2XP5A 2XPAA 3WL1A 2PV1A 4Z2KA 3ARQA 4W9PA 1H0GA 5HW7A 4TNSA 4P8UA 4ODPA 2KGJA 2OLHA 3AQUA 5AHTA 3KAGA 1J6YA 3ARRA 3ARPA 1RD6A 2WLZA 1W9UA 3QOKA 4U85A 3FSCA 3PR9A 2XP3A 3AS1A 3AROA 3CH9A 4J4NA 2PPOA 4DROA 1W1YA 4MAVA 4TX0A 2DK7A 2M3OW 4DWSB 3M7NA 1D7IA 1KT1A 2ZQUA 2JXWA 2F21A 2AOSA 1PINA 3VAWA 2VCDA 2XP8A 2A3EA 4JFLA 3MQGA 3O5IA 2A3CA 4TW7A 3ARTA 1NH6A 5GPRA 4WKAA 2OFNA 1SR0A 2BA1A 3O5DA 4MSPA 3RFWA 1P5QA 1N1AA 4LAYA 1FKLA 2WADA 3WKZA 1E9LA 4PTMA 4ZPVR 2XPBA 3WQWA 2A3AA 3PA7A 2LJ4A 3IHZA 4KR0B 1KT0A 1J4RA 4IPXA 5J6EA 3ARSA 4WKFA 1ZBVA 3LKXA 3RM8A 3RM9A 2AWGA 4P8XA 2A3BA 2JMFA 1D7HA 1NWRA 2XP4A 1FD9A 1LG1A 2F2DA 3WD1A 3IK8A 2O92A 4DZ3A 1JNSA 4W9OA 1JNDA 2KFWA 4DWSD 4ZS6A 1H0IA 1C9HA 3WD2A 1X6LA 1JNEA 2RSEA 3O5EA 4MNMA 4A0UA 4ODOA 2RUQA 1K9RA 1HKMA 3TC5A 1YATA 5CQ2A 2YSIA 5DIVA 4GLXA 1KFWA 4ODRA 3UF8A 2B31A 4DRMA 4NNRA 2MLZA 1CTNA 1ZK6A 4ITZA 4N19A 2MPHA 2YSFA 3PRBA 1TK7A 4FAPA 2EZ5W 4LAXA 5JH8A 3MDYB 2YBTA 4MPKA 3OA5A 2LAJA 3UQIA 3M85A 3B9AA 5DIUA 1FKSA 4C02B 4DWSA 1LQ0A 2F4EA 5HW6A 3FS8A 4A0TA 1J4HA 1GOIA 3G6MA 3CHEA 3AS3A 4TW8A 1QPFA 1LL4A 1RP5A 1NSGA 3ARVA 4MGVA 5E66A 1FKKA 1FKDA 3B8SA 4DRPA 5E65A 3JXVA 2PBCA 2M8JA 3FXYA 3MCBA 4ZPWR 1W9PA 5B8IC 1FKRA 4LAVA 3LKXB 1JVWA 2DT2A 2WM0A 4W9QA 3CNGA 4BF8A 3UQBA 1R9HA 3KAFA 4QT3A 4DZ2A 4L3NA 4DRKA 1HJWA 2PPNA 2QF8A 1FFRA 2DSUA 1UR8A 3UI5A 1XHGA 1NWUA 4HBOA 1Y0OA 2KXQA 1FKGA 1LJYA 5HWCA 4Z2HA 3IKGA 2N87A 1F8AB 1J4IA 1HKJA 3PRDA 4WJXA 4AY1A 5HW8A 5HT1A 1NWSA 1EYMA 1QZ2A 2YSHA 3B9EA 4JFMA 2RUCA 2ZQTA 3KAIA 5DO2A 2DK1A 4S3KA 1LL7A 4IQCA 3PQHA 2YBUA 2DWVA 1ZBWA 1EG4A 2YAJB 2ESCA 4Z2IA 3IKDA 1L1PA 2L2SA 4DIPA 1D2KA 2FKEA 1HJXA 4GIVA 2O9OA 3BXWA 3I6CA 4E5RA 1FLCA 2ZQVA 3UI6A 4ODLA 3KACA 1Q6UA 1EIBA 3O5PA 3NTPA 1ZL1A 1M5YA 2ZR4A 4ODMA 2YSGA 3EY6A 2Q5AA 3O5MA 3ARUA 3WD4A 1E6ZA 4REXA 4W5UA 1ZBCA 2KI3A 3B7XA 3GPKA 2M8IA 2ZQSA 3OOBA 1ZU8A 1FJDA 2WK2A 5GQBA 4MNKA 1ITXA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2LAJ A;  2PV2 A;  3O5J A;  5DIT A;  5HTG A;  3M85 A;  4JFK A;  2XP3 A;  2JZV A;  3CGN A;  3O5Q A;  1ROU A;  1U79 A;  4JYS A;  3RGC A;  5DIU A;  1FKS A;  1WR7 A;  4C02 B;  2M2A A;  3O5K A;  4J4N A;  4J4O A;  2PPO A;  2F4E A;  2VN1 A;  4U86 A;  5HW6 A;  4G2P A;  3TCZ A;  2FAP A;  4DRO A;  3TDB A;  4TX0 A;  2DK7 A;  2ZR6 A;  1Q6I A;  1EQ3 A;  1J4H A;  2M3O W;  3JYM A;  1W26 A;  3M7N A;  1D7I A;  1KT1 A;  3O5P A;  2ZQU A;  2JXW A;  2F21 A;  1D7J A;  1QPF A;  4GGQ A;  4TW8 A;  1PIN A;  2ZAJ A;  2ZR5 A;  1FKT A;  2XP8 A;  1D6O A;  2VCD A;  3VAW A;  1NSG A;  2UZ5 A;  4MGV A;  2KR7 A;  5GPG A;  4JFL A;  1FKK A;  2KO7 A;  2MF9 A;  1FKD A;  5HWB A;  1ZCN A;  1TCO C;  4DRP A;  3JXV A;  2PBC A;  1QPL A;  3O5I A;  4DRI A;  4DT4 A;  1FAP A;  2M8J A;  3UI4 A;  1PBK A;  4TW7 A;  2RUD A;  4U84 A;  1K9Q A;  1O6W A;  5B8I C;  2OFN A;  3CGM A;  4LAV A;  1FKR A;  5BXJ A;  1JVW A;  1NMW A;  4W9Q A;  2BA1 A;  3CNG A;  3KAH A;  2IF4 A;  1P5Q A;  1N1A A;  1Q1C A;  3O5D A;  3NRK A;  4LAY A;  3RFW A;  4BF8 A;  1R9H A;  4TW6 A;  3KAF A;  1FKL A;  2YSB A;  3KCE A;  2DG4 A;  4ODQ A;  4QT3 A;  4DRJ A;  2JX8 A;  2XP9 A;  4DZ2 A;  4DRK A;  2XPB A;  2PPN A;  1F40 A;  2ITK A;  3PA7 A;  2LJ4 A;  4MSP A;  2M1I A;  3IHZ A;  3UI5 A;  2M08 A;  3O5O A;  1Y0O A;  2MLX A;  1KT0 A;  4ODK A;  2KXQ A;  1J4R A;  4G50 A;  4ODN A;  1NMV A;  1FKG A;  4IPX A;  5HWC A;  1FKF A;  4JFJ A;  5D75 A;  3IKG A;  4DRQ A;  4DRN A;  2N87 A;  5J6E A;  3UQA A;  5HUA A;  1F8A B;  1J4I A;  3KZ7 A;  2LKN A;  3PRD A;  5HW8 A;  2E45 A;  5I98 A;  5HT1 A;  2MLY A;  2RUR A;  2L4J A;  2LPV A;  2AWG A;  4FN2 A;  1QZ2 A;  1EYM A;  4JFM A;  2MDI A;  2YSH A;  4R0X A;  5HKG A;  2JMF A;  1I5H W;  1D7H A;  2D9F A;  2RUC A;  2ZQT A;  3KAI A;  2DG9 A;  2DK1 A;  2K8I A;  2XP4 A;  1FD9 A;  4DRH A;  2F2D A;  3NI6 A;  1WMV A;  1BL4 A;  4IQC A;  1FKJ A;  3IK8 A;  2RE3 A;  4DZ3 A;  4IQ2 A;  2XP7 A;  4JFI A;  1JNS A;  4LAW A;  2DWV A;  4W9O A;  4DH0 A;  1EG4 A;  1YW5 A;  2KFW A;  3IKD A;  1B6C A;  3UQB A;  1L1P A;  2L2S A;  1HXV A;  2DG3 A;  2PPP A;  1T11 A;  1C9H A;  2PV3 A;  2Y78 A;  4TYO A;  1FKB A;  4DIP A;  3KAB A;  3ODK A;  2FKE A;  2LGO A;  3O5G A;  2RSE A;  1FKH A;  3O5E A;  4GIV A;  4ODO A;  3L4H A;  2RUQ A;  3I6C A;  4E5R A;  1K9R A;  1Q6H A;  1EG3 A;  2ZQV A;  1BKF A;  3UI6 A;  1FKI A;  1JMQ A;  4QT2 A;  3LUO A;  3TC5 A;  1ROT A;  4ODL A;  3KAC A;  1YAT A;  2DMV A;  2JV4 A;  2XP6 A;  5CQ2 A;  2YSI A;  1Q6U A;  3NTP A;  2RQS A;  1M5Y A;  2XP5 A;  2ZR4 A;  2XPA A;  3LE4 A;  3FAP A;  3H9R B;  4ODM A;  5DIV A;  2YSG A;  2PV1 A;  3WH0 A;  3EY6 A;  2Q5A A;  3O5M A;  4ODR A;  4W9P A;  3JYJ A;  5HW7 A;  3KAD A;  3UF8 A;  2MNT A;  4DRM A;  4REX A;  4QIB A;  2KE0 A;  2MLZ A;  4NNR A;  4TNS A;  3O5R A;  1A7X A;  4O2T A;  1ZK6 A;  2KI3 A;  3B7X A;  3GPK A;  4ITZ A;  2M8I A;  4N19 A;  4ODP A;  2ZQS A;  3OOB A;  2KGJ A;  3O5L A;  3O5F A;  2MPH A;  2YSF A;  3PRB A;  5AHT A;  3KAG A;  1FJD A;  1J6Y A;  1TK7 A;  4FAP A;  2EZ5 W;  4LAX A;  2DJY A;  3MDY B;  1JNT A;  3UQI A;  4U85 A; 
#chains in the Genus database with same CATH topology
 5E62 A;  2PV2 A;  3CHD A;  5HTG A;  1WNO A;  2JZV A;  3CGN A;  4UDM A;  3RM4 A;  4J4O A;  3O5K A;  3ARZ A;  4NZC A;  4G2P A;  4MTV A;  1ZBK A;  3G6L A;  4S3J A;  4Q7N A;  1TR8 A;  3JYM A;  2DSZ A;  1D7J A;  2P4V A;  2ZAJ A;  5GPG A;  3WD3 A;  2KO7 A;  2MF9 A;  5HWB A;  1ZCN A;  3EIP A;  4DWS C;  1QPL A;  3PRA A;  4DT4 A;  1O6I A;  3UI4 A;  1GPF A;  1PBK A;  2RUD A;  1E6N A;  2FDM A;  4P8V A;  1TFV A;  1O6W A;  3AS0 A;  2QRV A;  5BXJ A;  2IF4 A;  3NRK A;  4HAR A;  3KCE A;  2DG4 A;  2JX8 A;  2XP9 A;  1W1V A;  2ITK A;  4LGX A;  1JCH B;  1NWT A;  2M08 A;  2ETN A;  3AS2 A;  4G50 A;  4IT6 A;  1NMV A;  4JFJ A;  5D75 A;  1LL6 A;  1OGG A;  2DT3 A;  2LKN A;  4Z2L A;  2E45 A;  4Z2J A;  2RUR A;  1WB0 A;  4R0X A;  5HKG A;  2MDI A;  5E5W A;  2DSV A;  3CZ8 A;  2D9F A;  4XAK A;  2K8I A;  2DG9 A;  4DRH A;  3MQH A;  1WMV A;  1BL4 A;  4L72 B;  2RE3 A;  4IQ2 A;  4WK9 A;  1E6P A;  2DT1 A;  1IX5 A;  4DH0 A;  1YW5 A;  4P8W A;  1XRV A;  3B9D A;  1B6C A;  1OGB A;  1T11 A;  3ALG A;  2PV3 A;  3KAB A;  2LGO A;  1FKH A;  1HKK A;  1W9V A;  1Q6H A;  3ARY A;  2OWO A;  1FKI A;  3LUO A;  1ROT A;  2RQS A;  2XP6 A;  3MCB B;  2B5U B;  3LE4 A;  3FAP A;  5HBF A;  3H9R B;  1GUV A;  3FSB A;  3WH0 A;  3CHC A;  3JYJ A;  3KAD A;  1GRJ A;  3W4R A;  2MNT A;  3GTY X;  1EDQ A;  4QIB A;  2KE0 A;  3O5R A;  1A7X A;  4O2T A;  1OWQ A;  4HBE A;  3O5L A;  3O5F A;  2G41 A;  5DEZ A;  1X6N A;  1ZB5 A;  2DJY A;  3WIJ A;  1JNT A;  3O5J A;  5DIT A;  4JFK A;  5U47 A;  3O5Q A;  1ROU A;  1U79 A;  4JYS A;  3RGC A;  1WR7 A;  2M2A A;  2G8Z A;  4MNL A;  2VN1 A;  4U86 A;  3TCZ A;  2FAP A;  4ZPT R;  3TDB A;  3BMB A;  2ZR6 A;  1Q6I A;  1EQ3 A;  1E6R A;  1W26 A;  1HJV A;  4GGQ A;  3WL0 A;  1UR9 A;  2ZR5 A;  1FKT A;  1D6O A;  4Q22 A;  2UZ5 A;  2KR7 A;  1TCO C;  4DRI A;  5DF0 A;  1FAP A;  4U84 A;  1K9Q A;  3CGM A;  2WLY A;  1NMW A;  2Y8N B;  3KAH A;  4WIW A;  3ARX A;  1Q1C A;  4IT4 A;  4TW6 A;  4DRJ A;  4ODQ A;  2YSB A;  1LG2 A;  3CHF A;  1F40 A;  2M1I A;  4URI A;  3O5O A;  2MLX A;  2DPE A;  4ODK A;  4ODN A;  3RME A;  1W1P A;  5E64 A;  1FFQ A;  3ARW A;  1FKF A;  4DRQ A;  4DRN A;  3UQA A;  5HUA A;  4KQZ A;  3KZ7 A;  5I98 A;  2MLY A;  2PN0 A;  2DSW A;  2L4J A;  2LPV A;  4FN2 A;  1SYT A;  3ALF A;  1I5H W;  1W1T A;  1E15 A;  3NI6 A;  1FKJ A;  1K9T A;  4NSB A;  2XP7 A;  4JFI A;  1HKI A;  4Z2G A;  2DT0 A;  4LAW A;  4QZV B;  2IUZ A;  1WAW A;  2WAE A;  1HXV A;  4R5E A;  2DG3 A;  2PPP A;  2Y78 A;  4TYO A;  1FKB A;  3ODK A;  3FY1 A;  3O5G A;  3WQV A;  4ML4 A;  4MNJ A;  3L4H A;  3WD0 A;  4WKH A;  1EHN A;  1EG3 A;  1BKF A;  1JMQ A;  4QT2 A;  2PI6 A;  2DMV A;  2JV4 A;  1VF8 A;  2XP5 A;  2XPA A;  3WL1 A;  2PV1 A;  4Z2K A;  3ARQ A;  4W9P A;  1H0G A;  5HW7 A;  4TNS A;  4P8U A;  4ODP A;  2KGJ A;  2OLH A;  3AQU A;  5AHT A;  3KAG A;  1J6Y A;  3ARR A;  3ARP A;  1RD6 A;  2WLZ A;  1W9U A;  3QOK A;  4U85 A;  3FSC A;  3PR9 A;  2XP3 A;  3AS1 A;  3ARO A;  3CH9 A;  4J4N A;  2PPO A;  4DRO A;  1W1Y A;  4MAV A;  4TX0 A;  2DK7 A;  2M3O W;  4DWS B;  3M7N A;  1D7I A;  1KT1 A;  2ZQU A;  2JXW A;  2F21 A;  2AOS A;  1PIN A;  3VAW A;  2VCD A;  2XP8 A;  2A3E A;  4JFL A;  3MQG A;  3O5I A;  2A3C A;  4TW7 A;  3ART A;  1NH6 A;  5GPR A;  4WKA A;  2OFN A;  1SR0 A;  2BA1 A;  3O5D A;  4MSP A;  3RFW A;  1P5Q A;  1N1A A;  4LAY A;  1FKL A;  2WAD A;  3WKZ A;  1E9L A;  4PTM A;  4ZPV R;  2XPB A;  3WQW A;  2A3A A;  3PA7 A;  2LJ4 A;  3IHZ A;  4KR0 B;  1KT0 A;  1J4R A;  4IPX A;  5J6E A;  3ARS A;  4WKF A;  1ZBV A;  3LKX A;  3RM8 A;  3RM9 A;  2AWG A;  4P8X A;  2A3B A;  2JMF A;  1D7H A;  1NWR A;  2XP4 A;  1FD9 A;  1LG1 A;  2F2D A;  3WD1 A;  3IK8 A;  2O92 A;  4DZ3 A;  1JNS A;  4W9O A;  1JND A;  2KFW A;  4DWS D;  4ZS6 A;  1H0I A;  1C9H A;  3WD2 A;  1X6L A;  1JNE A;  2RSE A;  3O5E A;  4MNM A;  4A0U A;  4ODO A;  2RUQ A;  1K9R A;  1HKM A;  3TC5 A;  1YAT A;  5CQ2 A;  2YSI A;  5DIV A;  4GLX A;  1KFW A;  4ODR A;  3UF8 A;  2B31 A;  4DRM A;  4NNR A;  2MLZ A;  1CTN A;  1ZK6 A;  4ITZ A;  4N19 A;  2MPH A;  2YSF A;  3PRB A;  1TK7 A;  4FAP A;  2EZ5 W;  4LAX A;  5JH8 A;  3MDY B;  2YBT A;  4MPK A;  3OA5 A;  2LAJ A;  3UQI A;  3M85 A;  3B9A A;  5DIU A;  1FKS A;  4C02 B;  4DWS A;  1LQ0 A;  2F4E A;  5HW6 A;  3FS8 A;  4A0T A;  1J4H A;  1GOI A;  3G6M A;  3CHE A;  3AS3 A;  4TW8 A;  1QPF A;  1LL4 A;  1RP5 A;  1NSG A;  3ARV A;  4MGV A;  5E66 A;  1FKK A;  1FKD A;  3B8S A;  4DRP A;  5E65 A;  3JXV A;  2PBC A;  2M8J A;  3FXY A;  3MCB A;  4ZPW R;  1W9P A;  5B8I C;  1FKR A;  4LAV A;  3LKX B;  1JVW A;  2DT2 A;  2WM0 A;  4W9Q A;  3CNG A;  4BF8 A;  3UQB A;  1R9H A;  3KAF A;  4QT3 A;  4DZ2 A;  4L3N A;  4DRK A;  1HJW A;  2PPN A;  2QF8 A;  1FFR A;  2DSU A;  1UR8 A;  3UI5 A;  1XHG A;  1NWU A;  4HBO A;  1Y0O A;  2KXQ A;  1FKG A;  3GU0 A;  1LJY A;  5HWC A;  4Z2H A;  3IKG A;  2N87 A;  1F8A B;  1J4I A;  1HKJ A;  3PRD A;  4WJX A;  4AY1 A;  5HW8 A;  5HT1 A;  1NWS A;  1EYM A;  1QZ2 A;  2YSH A;  3B9E A;  4JFM A;  2RUC A;  2ZQT A;  3KAI A;  5DO2 A;  2DK1 A;  4S3K A;  1LL7 A;  4IQC A;  3PQH A;  2YBU A;  2DWV A;  2EUL A;  1ZBW A;  1EG4 A;  2YAJ B;  2ESC A;  4Z2I A;  3IKD A;  1L1P A;  2L2S A;  4DIP A;  1D2K A;  2FKE A;  1HJX A;  4GIV A;  2O9O A;  3BXW A;  3I6C A;  4E5R A;  1FLC A;  2ZQV A;  3UI6 A;  1E44 A;  4ODL A;  3KAC A;  1Q6U A;  1EIB A;  3O5P A;  3NTP A;  1ZL1 A;  1M5Y A;  2ZR4 A;  4ODM A;  2YSG A;  3EY6 A;  2Q5A A;  3O5M A;  3ARU A;  2F23 A;  3WD4 A;  1E6Z A;  4REX A;  4W5U A;  1ZBC A;  2KI3 A;  3B7X A;  3GPK A;  2M8I A;  2ZQS A;  3OOB A;  1ZU8 A;  1FJD A;  2WK2 A;  5GQB A;  4MNK A;  1ITX A; 
#chains in the Genus database with same CATH homology
 5E62 A;  2PV2 A;  3CHD A;  5HTG A;  1WNO A;  2JZV A;  3CGN A;  3RM4 A;  4J4O A;  3O5K A;  3ARZ A;  4NZC A;  4G2P A;  4MTV A;  1ZBK A;  3G6L A;  4S3J A;  4Q7N A;  1TR8 A;  3JYM A;  2DSZ A;  1D7J A;  2ZAJ A;  5GPG A;  3WD3 A;  2KO7 A;  2MF9 A;  5HWB A;  1ZCN A;  4DWS C;  1QPL A;  3PRA A;  4DT4 A;  1O6I A;  3UI4 A;  1GPF A;  1PBK A;  2RUD A;  1E6N A;  2FDM A;  4P8V A;  1TFV A;  1O6W A;  3AS0 A;  2QRV A;  5BXJ A;  2IF4 A;  3NRK A;  4HAR A;  3KCE A;  2DG4 A;  2JX8 A;  2XP9 A;  1W1V A;  2ITK A;  4LGX A;  1NWT A;  2M08 A;  3AS2 A;  4G50 A;  4IT6 A;  1NMV A;  4JFJ A;  5D75 A;  1LL6 A;  1OGG A;  2DT3 A;  2LKN A;  4Z2L A;  2E45 A;  4Z2J A;  2RUR A;  1WB0 A;  4R0X A;  5HKG A;  2MDI A;  5E5W A;  2DSV A;  3CZ8 A;  2D9F A;  4XAK A;  2K8I A;  2DG9 A;  4DRH A;  3MQH A;  1WMV A;  1BL4 A;  4L72 B;  2RE3 A;  4IQ2 A;  4WK9 A;  1E6P A;  2DT1 A;  1IX5 A;  4DH0 A;  1YW5 A;  4P8W A;  1XRV A;  3B9D A;  1B6C A;  1OGB A;  1T11 A;  3ALG A;  2PV3 A;  3KAB A;  2LGO A;  1FKH A;  1HKK A;  1W9V A;  1Q6H A;  3ARY A;  2OWO A;  1FKI A;  3LUO A;  1ROT A;  2RQS A;  2XP6 A;  3MCB B;  3LE4 A;  3FAP A;  5HBF A;  3H9R B;  1GUV A;  3FSB A;  3WH0 A;  3CHC A;  3JYJ A;  3KAD A;  3W4R A;  2MNT A;  1EDQ A;  4QIB A;  2KE0 A;  3O5R A;  1A7X A;  4O2T A;  1OWQ A;  4HBE A;  3O5L A;  3O5F A;  2G41 A;  5DEZ A;  1X6N A;  1ZB5 A;  2DJY A;  3WIJ A;  1JNT A;  3O5J A;  5DIT A;  4JFK A;  5U47 A;  3O5Q A;  1ROU A;  1U79 A;  4JYS A;  3RGC A;  1WR7 A;  2M2A A;  2G8Z A;  4MNL A;  2VN1 A;  4U86 A;  3TCZ A;  2FAP A;  4ZPT R;  3TDB A;  2ZR6 A;  1Q6I A;  1EQ3 A;  1E6R A;  1W26 A;  1HJV A;  4GGQ A;  3WL0 A;  1UR9 A;  2ZR5 A;  1FKT A;  1D6O A;  4Q22 A;  2UZ5 A;  2KR7 A;  1TCO C;  4DRI A;  5DF0 A;  1FAP A;  4U84 A;  1K9Q A;  3CGM A;  2WLY A;  1NMW A;  2Y8N B;  3KAH A;  4WIW A;  3ARX A;  1Q1C A;  4IT4 A;  4TW6 A;  4DRJ A;  4ODQ A;  2YSB A;  1LG2 A;  3CHF A;  1F40 A;  2M1I A;  4URI A;  3O5O A;  2MLX A;  2DPE A;  4ODK A;  4ODN A;  3RME A;  1W1P A;  5E64 A;  1FFQ A;  3ARW A;  1FKF A;  4DRQ A;  4DRN A;  3UQA A;  5HUA A;  4KQZ A;  3KZ7 A;  5I98 A;  2MLY A;  2DSW A;  2L4J A;  2LPV A;  4FN2 A;  1SYT A;  3ALF A;  1I5H W;  1W1T A;  1E15 A;  3NI6 A;  1FKJ A;  1K9T A;  4NSB A;  2XP7 A;  4JFI A;  1HKI A;  4Z2G A;  2DT0 A;  4LAW A;  4QZV B;  2IUZ A;  1WAW A;  2WAE A;  1HXV A;  4R5E A;  2DG3 A;  2PPP A;  2Y78 A;  4TYO A;  1FKB A;  3ODK A;  3FY1 A;  3O5G A;  3WQV A;  4ML4 A;  4MNJ A;  3L4H A;  3WD0 A;  4WKH A;  1EHN A;  1EG3 A;  1BKF A;  1JMQ A;  4QT2 A;  2PI6 A;  2DMV A;  2JV4 A;  1VF8 A;  2XP5 A;  2XPA A;  3WL1 A;  2PV1 A;  4Z2K A;  3ARQ A;  4W9P A;  1H0G A;  5HW7 A;  4TNS A;  4P8U A;  4ODP A;  2KGJ A;  2OLH A;  3AQU A;  5AHT A;  3KAG A;  1J6Y A;  3ARR A;  3ARP A;  1RD6 A;  2WLZ A;  1W9U A;  3QOK A;  4U85 A;  3FSC A;  3PR9 A;  2XP3 A;  3AS1 A;  3ARO A;  3CH9 A;  4J4N A;  2PPO A;  4DRO A;  1W1Y A;  4MAV A;  4TX0 A;  2DK7 A;  2M3O W;  4DWS B;  3M7N A;  1D7I A;  1KT1 A;  2ZQU A;  2JXW A;  2F21 A;  2AOS A;  1PIN A;  3VAW A;  2VCD A;  2XP8 A;  2A3E A;  4JFL A;  3MQG A;  3O5I A;  2A3C A;  4TW7 A;  3ART A;  1NH6 A;  5GPR A;  4WKA A;  2OFN A;  1SR0 A;  2BA1 A;  3O5D A;  4MSP A;  3RFW A;  1P5Q A;  1N1A A;  4LAY A;  1FKL A;  2WAD A;  3WKZ A;  1E9L A;  4PTM A;  4ZPV R;  2XPB A;  3WQW A;  2A3A A;  3PA7 A;  2LJ4 A;  3IHZ A;  4KR0 B;  1KT0 A;  1J4R A;  4IPX A;  5J6E A;  3ARS A;  4WKF A;  1ZBV A;  3LKX A;  3RM8 A;  3RM9 A;  2AWG A;  4P8X A;  2A3B A;  2JMF A;  1D7H A;  1NWR A;  2XP4 A;  1FD9 A;  1LG1 A;  2F2D A;  3WD1 A;  3IK8 A;  2O92 A;  4DZ3 A;  1JNS A;  4W9O A;  1JND A;  2KFW A;  4DWS D;  4ZS6 A;  1H0I A;  1C9H A;  3WD2 A;  1X6L A;  1JNE A;  2RSE A;  3O5E A;  4MNM A;  4A0U A;  4ODO A;  2RUQ A;  1K9R A;  1HKM A;  3TC5 A;  1YAT A;  5CQ2 A;  2YSI A;  5DIV A;  4GLX A;  1KFW A;  4ODR A;  3UF8 A;  2B31 A;  4DRM A;  4NNR A;  2MLZ A;  1CTN A;  1ZK6 A;  4ITZ A;  4N19 A;  2MPH A;  2YSF A;  3PRB A;  1TK7 A;  4FAP A;  2EZ5 W;  4LAX A;  5JH8 A;  3MDY B;  2YBT A;  4MPK A;  3OA5 A;  2LAJ A;  3UQI A;  3M85 A;  3B9A A;  5DIU A;  1FKS A;  4C02 B;  4DWS A;  1LQ0 A;  2F4E A;  5HW6 A;  3FS8 A;  4A0T A;  1J4H A;  1GOI A;  3G6M A;  3CHE A;  3AS3 A;  4TW8 A;  1QPF A;  1LL4 A;  1RP5 A;  1NSG A;  3ARV A;  4MGV A;  5E66 A;  1FKK A;  1FKD A;  3B8S A;  4DRP A;  5E65 A;  3JXV A;  2PBC A;  2M8J A;  3FXY A;  3MCB A;  4ZPW R;  1W9P A;  5B8I C;  1FKR A;  4LAV A;  3LKX B;  1JVW A;  2DT2 A;  2WM0 A;  4W9Q A;  3CNG A;  4BF8 A;  3UQB A;  1R9H A;  3KAF A;  4QT3 A;  4DZ2 A;  4L3N A;  4DRK A;  1HJW A;  2PPN A;  2QF8 A;  1FFR A;  2DSU A;  1UR8 A;  3UI5 A;  1XHG A;  1NWU A;  4HBO A;  1Y0O A;  2KXQ A;  1FKG A;  1LJY A;  5HWC A;  4Z2H A;  3IKG A;  2N87 A;  1F8A B;  1J4I A;  1HKJ A;  3PRD A;  4WJX A;  4AY1 A;  5HW8 A;  5HT1 A;  1NWS A;  1EYM A;  1QZ2 A;  2YSH A;  3B9E A;  4JFM A;  2RUC A;  2ZQT A;  3KAI A;  5DO2 A;  2DK1 A;  4S3K A;  1LL7 A;  4IQC A;  3PQH A;  2YBU A;  2DWV A;  1ZBW A;  1EG4 A;  2YAJ B;  2ESC A;  4Z2I A;  3IKD A;  1L1P A;  2L2S A;  4DIP A;  1D2K A;  2FKE A;  1HJX A;  4GIV A;  2O9O A;  3BXW A;  3I6C A;  4E5R A;  1FLC A;  2ZQV A;  3UI6 A;  4ODL A;  3KAC A;  1Q6U A;  1EIB A;  3O5P A;  3NTP A;  1ZL1 A;  1M5Y A;  2ZR4 A;  4ODM A;  2YSG A;  3EY6 A;  2Q5A A;  3O5M A;  3ARU A;  3WD4 A;  1E6Z A;  4REX A;  4W5U A;  1ZBC A;  2KI3 A;  3B7X A;  3GPK A;  2M8I A;  2ZQS A;  3OOB A;  1ZU8 A;  1FJD A;  2WK2 A;  5GQB A;  4MNK A;  1ITX A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...