3KAHA

Structure-guided design of alpha-amino acid-derived pin1 inhibitors
Total Genus 42
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
42
sequence length
157
structure length
145
Chain Sequence
LPPGWEKAMSRSSGRVYYFNHITNASQWERPSEPARVRCSHLLVKHSQSRRPSSWRQEKITRTKEEALELINGYIQKIKSGEEDFESLASQFSDCSSAKARGDLGAFSRGQMQKPFEDASFALRTGEMSGPVFTDSGIHIILRTE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure-guided design of alpha-amino acid-derived Pin1 inhibitors
pubmed doi rcsb
source organism Homo sapiens
molecule tags Isomerase
molecule keywords Peptidyl-prolyl cis-trans isomerase NIMA-interacting 1
total genus 42
structure length 145
sequence length 157
ec nomenclature ec 5.2.1.8: Peptidylprolyl isomerase.
pdb deposition date 2009-10-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00397 WW WW domain
A PF00639 Rotamase PPIC-type PPIASE domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.20.70.10 Mainly Beta Single Sheet Ubiquitin Ligase Nedd4; Chain: W; Ubiquitin Ligase Nedd4; Chain: W; 3kahA01
3.10.50.40 Alpha Beta Roll Chitinase A; domain 3 Chitinase A; domain 3 3kahA02
1D6OA 4TNSA 1KT0A 2MLYA 3KAGA 1Y0OA 1J4HA 3O5OA 3IKGA 2MF9A 2RQSA 4ODQA 1FJDA 4U84A 2FAPA 3CGMA 5HW6A 3O5JA 4U86A 1FKFA 1FKLA 3VAWA 5DITA 4JFJA 2RE3A 2JXWA 1W26A 5D75A 3JYJA 1FKKA 1Q6UA 3O5RA 3CGNA 2DK1A 3PRDA 3UQIA 2XP6A 3O5PA 4ODLA 4QIBA 3M85A 4FN2A 4JYSA 4ODNA 3LE4A 1Q6IA 2KE0A 1FKSA 2JZVA 4DROA 1K9QA 2RUDA 1FAPA 2DG3A 2PPPA 4J4OA 2Q5AA 2L2SA 2OFNA 4DRKA 5GPGA 1YW5A 4JFKA 2KR7A 3TDBA 1T11A 4R0XA 4JFMA 2XP5A 3TCZA 2XPBA 1FKDA 1U79A 2DMVA 3LUOA 1JMQA 1J4IA 2D9FA 1FD9A 2RUQA 3RGCA 3OOBA 4DRJA 2ZQVA 1FKIA 1Q6HA 3O5EA 3O5GA 3B7XA 2DK7A 3PA7A 4LAVA 2ZR4A 2M8JA 1M5YA 4QT2A 2JX8A 4DZ2A 5HWCA 5DIVA 1NMVA 3IKDA 3UI4A 1C9HA 3KAFA 2UZ5A 3KAHA 2XP7A 2XP3A 1FKTA 2DG4A 4MSPA 4ITZA 2BA1A 1F8AB 4O2TA 1L1PA 4ODOA 4DH0A 1BKFA 1R9HA 4QT3A 1ZCNA 2YSHA 3NTPA 3O5DA 2ITKA 2ZQUA 2ZR6A 3O5IA 2MNTA 4TW8A 1FKGA 3RFWA 1B6CA 4GIVA 1A7XA 4ODMA 2VN1A 5DIUA 5J6EA 2M3OW 4G50A 4DRNA 5I98A 4W9QA 2L4JA 4W9PA 2RSEA 1KT1A 1NMWA 2KO7A 1WMVA 4JFIA 4JFLA 3H9RB 4NNRA 4TX0A 2KXQA 4ODKA 5B8IC 3KAIA 3KCEA 1NSGA 2ZR5A 1PINA 4ODRA 3UI6A 5BXJA 1HXVA 2M2AA 2FKEA 2RUCA 4N19A 1TK7A 5CQ2A 1EG3A 2K8IA 1ROTA 2LAJA 1QPFA 2LPVA 1JVWA 4DRIA 4DT4A 2F4EA 4BF8A 2DG9A 2PV1A 4FAPA 4U85A 1JNTA 2XP9A 5HW8A 2E45A 2YSFA 3UF8A 3UQBA 2AWGA 1PBKA 2EZ5W 4GGQA 1FKJA 2KI3A 5AHTA 4MGVA 2YSIA 5HTGA 2M08A 5HW7A 2XP4A 1J4RA 2DJYA 4ODPA 5HWBA 2N87A 1J6YA 1JNSA 1FKBA 2LGOA 2M1IA 3FAPA 5HUAA 2JV4A 1D7HA 1Q1CA 2YSBA 1D7IA 1YATA 3KABA 2YSGA 2MDIA 1K9RA 1I5HW 1BL4A 1ZK6A 3JYMA 4LAYA 2KFWA 4LAWA 1QPLA 2RURA 2PBCA 4TW7A 4DRQA 2MPHA 1EG4A 3KADA 3O5LA 2XP8A 3NRKA 2JMFA 2PPOA 3MDYB 4TW6A 2PV2A 4G2PA 3IHZA 5HT1A 2KGJA 2Y78A 2ZQTA 3O5QA 4DRMA 3NI6A 2MLXA 3TC5A 1WR7A 4E5RA 2VCDA 3IK8A 3CNGA 4DIPA 3ODKA 3UQAA 2XPAA 3L4HA 3KZ7A 1FKHA 1N1AA 2LKNA 4IQ2A 4J4NA 1F40A 3M7NA 4W9OA 3JXVA 3GPKA 1EYMA 2PV3A 3I6CA 4C02B 3WH0A 3PRBA 4IPXA 4DRHA 4IQCA 4DZ3A 2DWVA 2ZQSA 1D7JA 1TCOC 5HKGA 2LJ4A 2M8IA 1QZ2A 1P5QA 4LAXA 1EQ3A 1FKRA 3O5FA 1O6WA 3UI5A 2MLZA 2IF4A 3KACA 3O5MA 4DRPA 2ZAJA 1ROUA 2F2DA 4TYOA 2F21A 3EY6A 2PPNA 4REXA 3O5KA
chains in the Genus database with same CATH superfamily
3KAGA 4ZPTR 3IKGA 1WNOA 2MF9A 3WD2A 1SR0A 5HW6A 4KQZA 3VAWA 1FKLA 5DITA 4JFJA 2RE3A 3LKXA 3O5RA 5DEZA 2XP6A 4ODNA 3CHCA 4FN2A 3LE4A 3W4RA 3FXYA 3ARRA 1HKIA 1K9QA 1XHGA 4L3NA 1KFWA 2OFNA 1EDQA 1T11A 2A3AA 3TCZA 2XPBA 3MQGA 1FKDA 1U79A 1J4IA 3RGCA 3OOBA 1W9PA 3ALFA 1Q6HA 4MNMA 4LAVA 4QT2A 2ZR4A 2JX8A 5DIVA 5DO2A 4L72B 3KAFA 2DG4A 1FFQA 4S3KA 1GPFA 1R9HA 4Z2IA 1NWTA 5J6EA 4P8VA 5I98A 3ARYA 4W9PA 2RSEA 4DT4A 4JFLA 4TX0A 1NSGA 2ZR5A 4ODRA 1LQ0A 2M2AA 4MNLA 2FKEA 4HBOA 1D2KA 1ZU8A 2LPVA 1QPFA 2PV1A 1JNTA 2E45A 1FKJA 2YSIA 2M08A 5HWBA 2XP4A 2DJYA 3WIJA 2LGOA 2M1IA 4KR0B 4PTMA 2QRVA 1D7HA 3ARZA 1ZK6A 2YSBA 1K9RA 4W9OA 3JYMA 2PBCA 1OWQA 3NRKA 3MDYB 1RD6A 4G2PA 2AOSA 2Y78A 3O5QA 4NSBA 3CHFA 3FY1A 1WR7A 2G8ZA 4P8XA 1W1VA 1W1TA 4WK9A 4P8WA 3PRBA 3WL1A 2DWVA 2LJ4A 2M8IA 3GTYX 1P5QA 4XAKA 4TYOA 5E66A 1ZBVA 3O5KA 1W9UA 2WK2A 1J4HA 3WD0A 4U84A 2YBTA 3CGMA 4U86A 1FKFA 1WAWA 3B9AA 5D75A 3JYJA 2PI6A 4ZS6A 4ODLA 3M85A 3ARSA 2KE0A 1Q6IA 2A3CA 1LL6A 4DROA 1E6NA 2RUDA 2DG3A 5DF0A 5HBFA 3WD4A 4DRKA 1W1PA 2KR7A 4R0XA 2XP5A 3LUOA 4IT6A 3AS2A 2RUQA 2DSVA 3RMEA 3O5GA 3B7XA 3PA7A 4UDMA 1M5YA 3B8SA 2EULA 3AROA 4DWSA 1FKTA 4MSPA 1ZB5A 2DT3A 4ITZA 3WKZA 1F8AB 1L1PA 4Z2HA 4ZPWR 1HJWA 2B5UB 3O5DA 2ZR6A 2O92A 1FKGA 2G41A 3RFWA 1A7XA 5DIUA 4DRNA 1JNEA 5GPRA 1KT1A 4JFIA 1JCHB 5B8IC 2KXQA 1FJDA 3UI6A 1PINA 1HXVA 1XRVA 4IT4A 3RM8A 1EG3A 2K8IA 1ROTA 4MAVA 2DG9A 3CHEA 4U85A 4WKHA 3UF8A 1HJXA 3UQBA 1LL4A 1E6RA 1O6IA 5AHTA 4MPKA 4WKAA 1JNSA 4A0UA 3FAPA 1TR8A 3KABA 2YSGA 1BL4A 4LAYA 3CZ8A 4TW7A 1LL7A 2KFWA 4LAWA 4DRQA 2MPHA 2DPEA 1EG4A 1ZBKA 2DT0A 2JMFA 1EIBA 2PPOA 3IHZA 5U47A 3LKXB 1OGGA 1E44A 2KGJA 3WQWA 3ARTA 3NI6A 2MLXA 4DIPA 4J4NA 2A3BA 1CTNA 3M7NA 1EYMA 3I6CA 3OA5A 3WH0A 3CH9A 4A0TA 1D7JA 1TCOC 1EQ3A 1E6ZA 1FKRA 3KACA 2IF4A 4DRPA 2DT1A 3EY6A 2PPNA 3H9RB 1FLCA 4TNSA 1KT0A 3WQVA 3ARUA 1Y0OA 2O9OA 3O5OA 3FS8A 2DT2A 2YAJB 2RQSA 2FAPA 1IX5A 1ZBCA 3CHDA 4Q7NA 2OLHA 2JXWA 3CGNA 3PRDA 3WL0A 3O5PA 4DWSC 4QIBA 1F40A 4S3JA 2JZVA 1FFRA 2WADA 3RM9A 4J4OA 2Q5AA 3FSCA 5E62A 3BMBA 4Z2KA 1GRJA 2IUZA 5GPGA 1YW5A 3GU0A 4JFKA 3TDBA 4JFMA 1LJYA 1JMQA 2B31A 1FD9A 4MNJA 2WM0A 4WKFA 4NZCA 1FKIA 4O2TA 5HW7A 2DK7A 4P8UA 5HWCA 1HJVA 3UI4A 2WLZA 3IKDA 1W9VA 1ITXA 2YBUA 4ODOA 4DH0A 1BKFA 4QT3A 2YSHA 3NTPA 2ZQUA 2DSZA 1H0IA 3O5IA 1GOIA 4GIVA 4ODMA 1ZBWA 2M3OW 4DWSD 1RP5A 3KAIA 1NWRA 1GUVA 1LG1A 2LAJA 1JVWA 2F4EA 4BF8A 5HW8A 1W1YA 2XP9A 2FDMA 1SYTA 1PBKA 1K9TA 2P4VA 4GGQA 4GLXA 2KI3A 3ARVA 3ARXA 4MGVA 5HTGA 1HKKA 2Y8NB 1VF8A 1FKBA 1YATA 5JH8A 2MDIA 2RURA 3O5LA 2XP8A 4TW6A 1X6NA 5HT1A 2ZQTA 2VCDA 3IK8A 4LGXA 1H0GA 2XPAA 3L4HA 2F23A 1FKHA 2LKNA 3KZ7A 3WD3A 3GPKA 2PV3A 4C02B 4DRHA 4DZ3A 2ZQSA 3G6LA 5HKGA 4LAXA 3O5FA 1O6WA 3UI5A 2MLZA 2ZAJA 1ROUA 3G6MA 5E5WA 3AQUA 1LG2A 1D6OA 3MCBB 2MLYA 4ML4A 3AS1A 4ODQA 1NH6A 4Z2GA 3O5JA 2QF8A 1W26A 1FKKA 1Q6UA 3UQIA 3BXWA 2DK1A 4JYSA 4MNKA 1NWUA 4HARA 1FKSA 1FAPA 1E9LA 2A3EA 2PPPA 2L2SA 4URIA 2WLYA 4ZPVR 2DMVA 5E64A 2DSWA 1UR8A 2D9FA 4WJXA 1UR9A 4DRJA 1ZL1A 2ZQVA 3O5EA 2M8JA 4DZ2A 1NMVA 3B9DA 1C9HA 2UZ5A 3AS3A 3KAHA 2XP7A 2XP3A 2BA1A 3PQHA 1HKMA 1ZCNA 2ITKA 1EHNA 2MNTA 4TW8A 2WAEA 1B6CA 1X6LA 2VN1A 3MQHA 3PR9A 4W5UA 4G50A 4W9QA 2L4JA 2KO7A 1NMWA 4WIWA 1WMVA 1E6PA 4NNRA 3EIPA 2OWOA 4ODKA 3KCEA 5BXJA 3FSBA 2RUCA 4N19A 1JNDA 1TK7A 4Z2LA 5CQ2A 1TFVA 4DRIA 5GQBA 4FAPA 2YSFA 1WB0A 2AWGA 4QZVB 2EZ5W 2DSUA 4Q22A 2PN0A 4MTVA 3RM4A 1J4RA 4ODPA 1J6YA 2N87A 3ARQA 1HKJA 4Z2JA 3ARWA 4AY1A 4DWSB 3B9EA 5HUAA 2JV4A 1Q1CA 1D7IA 1E15A 1I5HW 1QPLA 4R5EA 2ESCA 3KADA 3QOKA 3PRAA 2PV2A 1NWSA 4DRMA 3TC5A 4E5RA 3CNGA 3MCBA 3ODKA 4HBEA 4IQ2A 3UQAA 1N1AA 3ALGA 1OGBA 3JXVA 3ARPA 4IPXA 4IQCA 3WD1A 5E65A 1QZ2A 3AS0A 3O5MA 2ETNA 2F2DA 2F21A 4REXA
chains in the Genus database with same CATH topology
3KAGA 4ZPTR 3IKGA 1WNOA 2MF9A 3WD2A 1SR0A 5HW6A 4KQZA 3VAWA 1FKLA 5DITA 4JFJA 2RE3A 3LKXA 3O5RA 5DEZA 2XP6A 4ODNA 3CHCA 4FN2A 3LE4A 3W4RA 3FXYA 3ARRA 1HKIA 1K9QA 1XHGA 4L3NA 1KFWA 2OFNA 1EDQA 1T11A 2A3AA 3TCZA 2XPBA 3MQGA 1FKDA 1U79A 1J4IA 3RGCA 3OOBA 1W9PA 3ALFA 1Q6HA 4MNMA 4LAVA 4QT2A 2ZR4A 2JX8A 5DIVA 5DO2A 4L72B 3KAFA 2DG4A 1FFQA 4S3KA 1GPFA 1R9HA 4Z2IA 1NWTA 5J6EA 4P8VA 5I98A 3ARYA 4W9PA 2RSEA 4DT4A 4JFLA 4TX0A 1NSGA 2ZR5A 4ODRA 1LQ0A 2M2AA 4MNLA 2FKEA 4HBOA 1D2KA 1ZU8A 2LPVA 1QPFA 2PV1A 1JNTA 2E45A 1FKJA 2YSIA 2M08A 5HWBA 2XP4A 2DJYA 3WIJA 2LGOA 2M1IA 4KR0B 4PTMA 2QRVA 1D7HA 3ARZA 1ZK6A 2YSBA 1K9RA 4W9OA 3JYMA 2PBCA 1OWQA 3NRKA 3MDYB 1RD6A 4G2PA 2AOSA 2Y78A 3O5QA 4NSBA 3CHFA 3FY1A 1WR7A 2G8ZA 4P8XA 1W1VA 1W1TA 4WK9A 4P8WA 3PRBA 3WL1A 2DWVA 2LJ4A 2M8IA 1P5QA 4XAKA 4TYOA 5E66A 1ZBVA 3O5KA 1W9UA 2WK2A 1J4HA 3WD0A 4U84A 2YBTA 3CGMA 4U86A 1FKFA 1WAWA 3B9AA 5D75A 3JYJA 2PI6A 4ZS6A 4ODLA 3M85A 3ARSA 2KE0A 1Q6IA 2A3CA 1LL6A 4DROA 1E6NA 2RUDA 2DG3A 5DF0A 5HBFA 3WD4A 4DRKA 1W1PA 2KR7A 4R0XA 2XP5A 3LUOA 4IT6A 3AS2A 2RUQA 2DSVA 3RMEA 3O5GA 3B7XA 3PA7A 1M5YA 3B8SA 3AROA 4DWSA 1FKTA 4MSPA 1ZB5A 2DT3A 4ITZA 3WKZA 1F8AB 1L1PA 4Z2HA 4ZPWR 1HJWA 3O5DA 2ZR6A 2O92A 1FKGA 2G41A 3RFWA 1A7XA 5DIUA 4DRNA 1JNEA 5GPRA 1KT1A 4JFIA 5B8IC 2KXQA 1FJDA 3UI6A 1PINA 1HXVA 1XRVA 4IT4A 3RM8A 1EG3A 2K8IA 1ROTA 4MAVA 2DG9A 3CHEA 4U85A 4WKHA 3UF8A 1HJXA 3UQBA 1LL4A 1E6RA 1O6IA 5AHTA 4MPKA 4WKAA 1JNSA 4A0UA 3FAPA 1TR8A 3KABA 2YSGA 1BL4A 4LAYA 3CZ8A 4TW7A 1LL7A 2KFWA 4LAWA 4DRQA 2MPHA 2DPEA 1EG4A 1ZBKA 2DT0A 2JMFA 1EIBA 2PPOA 3IHZA 5U47A 3LKXB 1OGGA 2KGJA 3WQWA 3ARTA 3NI6A 2MLXA 4DIPA 4J4NA 2A3BA 1CTNA 3M7NA 1EYMA 3I6CA 3OA5A 3WH0A 3CH9A 4A0TA 1D7JA 1TCOC 1EQ3A 1E6ZA 1FKRA 3KACA 2IF4A 4DRPA 2DT1A 3EY6A 2PPNA 3H9RB 1FLCA 4TNSA 1KT0A 3WQVA 3ARUA 1Y0OA 2O9OA 3O5OA 3FS8A 2DT2A 2YAJB 2RQSA 2FAPA 1IX5A 1ZBCA 3CHDA 4Q7NA 2OLHA 2JXWA 3CGNA 3PRDA 3WL0A 3O5PA 4DWSC 4QIBA 1F40A 4S3JA 2JZVA 1FFRA 2WADA 3RM9A 4J4OA 2Q5AA 3FSCA 5E62A 4Z2KA 2IUZA 5GPGA 1YW5A 4JFKA 3TDBA 4JFMA 1LJYA 1JMQA 2B31A 1FD9A 4MNJA 2WM0A 4WKFA 4NZCA 1FKIA 4O2TA 5HW7A 2DK7A 4P8UA 5HWCA 1HJVA 3UI4A 2WLZA 3IKDA 1W9VA 1ITXA 2YBUA 4ODOA 4DH0A 1BKFA 4QT3A 2YSHA 3NTPA 2ZQUA 2DSZA 1H0IA 3O5IA 1GOIA 4GIVA 4ODMA 1ZBWA 2M3OW 4DWSD 1RP5A 3KAIA 1NWRA 1GUVA 1LG1A 2LAJA 1JVWA 2F4EA 4BF8A 5HW8A 1W1YA 2XP9A 2FDMA 1SYTA 1PBKA 1K9TA 4GGQA 4GLXA 2KI3A 3ARVA 3ARXA 4MGVA 5HTGA 1HKKA 2Y8NB 1VF8A 1FKBA 1YATA 5JH8A 2MDIA 2RURA 3O5LA 2XP8A 4TW6A 1X6NA 5HT1A 2ZQTA 2VCDA 3IK8A 4LGXA 1H0GA 2XPAA 3L4HA 3KZ7A 1FKHA 2LKNA 3WD3A 3GPKA 2PV3A 4C02B 4DRHA 4DZ3A 2ZQSA 3G6LA 5HKGA 4LAXA 3O5FA 1O6WA 3UI5A 2MLZA 2ZAJA 1ROUA 3G6MA 5E5WA 3AQUA 1LG2A 1D6OA 3MCBB 2MLYA 4ML4A 3AS1A 4ODQA 1NH6A 4Z2GA 3O5JA 2QF8A 1W26A 1FKKA 1Q6UA 3UQIA 3BXWA 2DK1A 4JYSA 4MNKA 1NWUA 4HARA 1FKSA 1FAPA 1E9LA 2A3EA 2PPPA 2L2SA 4URIA 2WLYA 4ZPVR 2DMVA 5E64A 2DSWA 1UR8A 2D9FA 4WJXA 1UR9A 4DRJA 1ZL1A 2ZQVA 3O5EA 2M8JA 4DZ2A 1NMVA 3B9DA 1C9HA 3AS3A 2UZ5A 3KAHA 2XP7A 2XP3A 2BA1A 3PQHA 1HKMA 1ZCNA 2ITKA 1EHNA 2MNTA 4TW8A 2WAEA 1B6CA 1X6LA 2VN1A 3MQHA 3PR9A 4W5UA 4G50A 4W9QA 2L4JA 2KO7A 1NMWA 4WIWA 1WMVA 1E6PA 4NNRA 2OWOA 4ODKA 3KCEA 5BXJA 3FSBA 2RUCA 4N19A 1JNDA 1TK7A 4Z2LA 5CQ2A 1TFVA 4DRIA 5GQBA 4FAPA 2YSFA 1WB0A 2AWGA 4QZVB 2EZ5W 2DSUA 4Q22A 4MTVA 3RM4A 1J4RA 4ODPA 1J6YA 2N87A 3ARQA 1HKJA 4Z2JA 3ARWA 4AY1A 4DWSB 3B9EA 5HUAA 2JV4A 1Q1CA 1D7IA 1E15A 1I5HW 1QPLA 4R5EA 2ESCA 3KADA 3QOKA 3PRAA 2PV2A 1NWSA 4DRMA 3TC5A 4E5RA 3CNGA 3MCBA 3ODKA 4HBEA 4IQ2A 3UQAA 1N1AA 3ALGA 1OGBA 3JXVA 3ARPA 4IPXA 4IQCA 3WD1A 5E65A 1QZ2A 3AS0A 3O5MA 2F2DA 2F21A 4REXA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1D6O A;  4TNS A;  1KT0 A;  2MLY A;  3KAG A;  1Y0O A;  1J4H A;  3O5O A;  3IKG A;  2MF9 A;  2RQS A;  4ODQ A;  1FJD A;  4U84 A;  2FAP A;  3CGM A;  5HW6 A;  3O5J A;  4U86 A;  1FKF A;  1FKL A;  3VAW A;  5DIT A;  4JFJ A;  2RE3 A;  2JXW A;  1W26 A;  5D75 A;  3JYJ A;  1FKK A;  1Q6U A;  3O5R A;  3CGN A;  2DK1 A;  3PRD A;  3UQI A;  2XP6 A;  3O5P A;  4ODL A;  4QIB A;  3M85 A;  4FN2 A;  4JYS A;  4ODN A;  3LE4 A;  1Q6I A;  2KE0 A;  1FKS A;  2JZV A;  4DRO A;  1K9Q A;  2RUD A;  1FAP A;  2DG3 A;  2PPP A;  4J4O A;  2Q5A A;  2L2S A;  2OFN A;  4DRK A;  5GPG A;  1YW5 A;  4JFK A;  2KR7 A;  3TDB A;  1T11 A;  4R0X A;  4JFM A;  2XP5 A;  3TCZ A;  2XPB A;  1FKD A;  1U79 A;  2DMV A;  3LUO A;  1JMQ A;  1J4I A;  2D9F A;  1FD9 A;  2RUQ A;  3RGC A;  3OOB A;  4DRJ A;  2ZQV A;  1FKI A;  1Q6H A;  3O5E A;  3O5G A;  3B7X A;  2DK7 A;  3PA7 A;  4LAV A;  2ZR4 A;  2M8J A;  1M5Y A;  4QT2 A;  2JX8 A;  4DZ2 A;  5HWC A;  5DIV A;  1NMV A;  3IKD A;  3UI4 A;  1C9H A;  3KAF A;  2UZ5 A;  3KAH A;  2XP7 A;  2XP3 A;  1FKT A;  2DG4 A;  4MSP A;  4ITZ A;  2BA1 A;  1F8A B;  4O2T A;  1L1P A;  4ODO A;  4DH0 A;  1BKF A;  1R9H A;  4QT3 A;  1ZCN A;  2YSH A;  3NTP A;  3O5D A;  2ITK A;  2ZQU A;  2ZR6 A;  3O5I A;  2MNT A;  4TW8 A;  1FKG A;  3RFW A;  1B6C A;  4GIV A;  1A7X A;  4ODM A;  2VN1 A;  5DIU A;  5J6E A;  2M3O W;  4G50 A;  4DRN A;  5I98 A;  4W9Q A;  2L4J A;  4W9P A;  2RSE A;  1KT1 A;  1NMW A;  2KO7 A;  1WMV A;  4JFI A;  4JFL A;  3H9R B;  4NNR A;  4TX0 A;  2KXQ A;  4ODK A;  5B8I C;  3KAI A;  3KCE A;  1NSG A;  2ZR5 A;  1PIN A;  4ODR A;  3UI6 A;  5BXJ A;  1HXV A;  2M2A A;  2FKE A;  2RUC A;  4N19 A;  1TK7 A;  5CQ2 A;  1EG3 A;  2K8I A;  1ROT A;  2LAJ A;  1QPF A;  2LPV A;  1JVW A;  4DRI A;  4DT4 A;  2F4E A;  4BF8 A;  2DG9 A;  2PV1 A;  4FAP A;  4U85 A;  1JNT A;  2XP9 A;  5HW8 A;  2E45 A;  2YSF A;  3UF8 A;  3UQB A;  2AWG A;  1PBK A;  2EZ5 W;  4GGQ A;  1FKJ A;  2KI3 A;  5AHT A;  4MGV A;  2YSI A;  5HTG A;  2M08 A;  5HW7 A;  2XP4 A;  1J4R A;  2DJY A;  4ODP A;  5HWB A;  2N87 A;  1J6Y A;  1JNS A;  1FKB A;  2LGO A;  2M1I A;  3FAP A;  5HUA A;  2JV4 A;  1D7H A;  1Q1C A;  2YSB A;  1D7I A;  1YAT A;  3KAB A;  2YSG A;  2MDI A;  1K9R A;  1I5H W;  1BL4 A;  1ZK6 A;  3JYM A;  4LAY A;  2KFW A;  4LAW A;  1QPL A;  2RUR A;  2PBC A;  4TW7 A;  4DRQ A;  2MPH A;  1EG4 A;  3KAD A;  3O5L A;  2XP8 A;  3NRK A;  2JMF A;  2PPO A;  3MDY B;  4TW6 A;  2PV2 A;  4G2P A;  3IHZ A;  5HT1 A;  2KGJ A;  2Y78 A;  2ZQT A;  3O5Q A;  4DRM A;  3NI6 A;  2MLX A;  3TC5 A;  1WR7 A;  4E5R A;  2VCD A;  3IK8 A;  3CNG A;  4DIP A;  3ODK A;  3UQA A;  2XPA A;  3L4H A;  3KZ7 A;  1FKH A;  1N1A A;  2LKN A;  4IQ2 A;  4J4N A;  1F40 A;  3M7N A;  4W9O A;  3JXV A;  3GPK A;  1EYM A;  2PV3 A;  3I6C A;  4C02 B;  3WH0 A;  3PRB A;  4IPX A;  4DRH A;  4IQC A;  4DZ3 A;  2DWV A;  2ZQS A;  1D7J A;  1TCO C;  5HKG A;  2LJ4 A;  2M8I A;  1QZ2 A;  1P5Q A;  4LAX A;  1EQ3 A;  1FKR A;  3O5F A;  1O6W A;  3UI5 A;  2MLZ A;  2IF4 A;  3KAC A;  3O5M A;  4DRP A;  2ZAJ A;  1ROU A;  2F2D A;  4TYO A;  2F21 A;  3EY6 A;  2PPN A;  4REX A;  3O5K A; 
#chains in the Genus database with same CATH topology
 3KAG A;  4ZPT R;  3IKG A;  1WNO A;  2MF9 A;  3WD2 A;  1SR0 A;  5HW6 A;  4KQZ A;  3VAW A;  1FKL A;  5DIT A;  4JFJ A;  2RE3 A;  3LKX A;  3O5R A;  5DEZ A;  2XP6 A;  4ODN A;  3CHC A;  4FN2 A;  3LE4 A;  3W4R A;  3FXY A;  3ARR A;  1HKI A;  1K9Q A;  1XHG A;  4L3N A;  1KFW A;  2OFN A;  1EDQ A;  1T11 A;  2A3A A;  3TCZ A;  2XPB A;  3MQG A;  1FKD A;  1U79 A;  1J4I A;  3RGC A;  3OOB A;  1W9P A;  3ALF A;  1Q6H A;  4MNM A;  4LAV A;  4QT2 A;  2ZR4 A;  2JX8 A;  5DIV A;  5DO2 A;  4L72 B;  3KAF A;  2DG4 A;  1FFQ A;  4S3K A;  1GPF A;  1R9H A;  4Z2I A;  1NWT A;  5J6E A;  4P8V A;  5I98 A;  3ARY A;  4W9P A;  2RSE A;  4DT4 A;  4JFL A;  4TX0 A;  1NSG A;  2ZR5 A;  4ODR A;  1LQ0 A;  2M2A A;  4MNL A;  2FKE A;  4HBO A;  1D2K A;  1ZU8 A;  2LPV A;  1QPF A;  2PV1 A;  1JNT A;  2E45 A;  1FKJ A;  2YSI A;  2M08 A;  5HWB A;  2XP4 A;  2DJY A;  3WIJ A;  2LGO A;  2M1I A;  4KR0 B;  4PTM A;  2QRV A;  1D7H A;  3ARZ A;  1ZK6 A;  2YSB A;  1K9R A;  4W9O A;  3JYM A;  2PBC A;  1OWQ A;  3NRK A;  3MDY B;  1RD6 A;  4G2P A;  2AOS A;  2Y78 A;  3O5Q A;  4NSB A;  3CHF A;  3FY1 A;  1WR7 A;  2G8Z A;  4P8X A;  1W1V A;  1W1T A;  4WK9 A;  4P8W A;  3PRB A;  3WL1 A;  2DWV A;  2LJ4 A;  2M8I A;  3GTY X;  1P5Q A;  4XAK A;  4TYO A;  5E66 A;  1ZBV A;  3O5K A;  1W9U A;  2WK2 A;  1J4H A;  3WD0 A;  4U84 A;  2YBT A;  3CGM A;  4U86 A;  1FKF A;  1WAW A;  3B9A A;  5D75 A;  3JYJ A;  2PI6 A;  4ZS6 A;  4ODL A;  3M85 A;  3ARS A;  2KE0 A;  1Q6I A;  2A3C A;  1LL6 A;  4DRO A;  1E6N A;  2RUD A;  2DG3 A;  5DF0 A;  5HBF A;  3WD4 A;  4DRK A;  1W1P A;  2KR7 A;  4R0X A;  2XP5 A;  3LUO A;  4IT6 A;  3AS2 A;  2RUQ A;  2DSV A;  3RME A;  3O5G A;  3B7X A;  3PA7 A;  4UDM A;  1M5Y A;  3B8S A;  2EUL A;  3ARO A;  4DWS A;  1FKT A;  4MSP A;  1ZB5 A;  2DT3 A;  4ITZ A;  3WKZ A;  1F8A B;  1L1P A;  4Z2H A;  4ZPW R;  1HJW A;  2B5U B;  3O5D A;  2ZR6 A;  2O92 A;  1FKG A;  2G41 A;  3RFW A;  1A7X A;  5DIU A;  4DRN A;  1JNE A;  5GPR A;  1KT1 A;  4JFI A;  1JCH B;  5B8I C;  2KXQ A;  1FJD A;  3UI6 A;  1PIN A;  1HXV A;  1XRV A;  4IT4 A;  3RM8 A;  1EG3 A;  2K8I A;  1ROT A;  4MAV A;  2DG9 A;  3CHE A;  4U85 A;  4WKH A;  3UF8 A;  1HJX A;  3UQB A;  1LL4 A;  1E6R A;  1O6I A;  5AHT A;  4MPK A;  4WKA A;  1JNS A;  4A0U A;  3FAP A;  1TR8 A;  3KAB A;  2YSG A;  1BL4 A;  4LAY A;  3CZ8 A;  4TW7 A;  1LL7 A;  2KFW A;  4LAW A;  4DRQ A;  2MPH A;  2DPE A;  1EG4 A;  1ZBK A;  2DT0 A;  2JMF A;  1EIB A;  2PPO A;  3IHZ A;  5U47 A;  3LKX B;  1OGG A;  1E44 A;  2KGJ A;  3WQW A;  3ART A;  3NI6 A;  2MLX A;  4DIP A;  4J4N A;  2A3B A;  1CTN A;  3M7N A;  1EYM A;  3I6C A;  3OA5 A;  3WH0 A;  3CH9 A;  4A0T A;  1D7J A;  1TCO C;  1EQ3 A;  1E6Z A;  1FKR A;  3KAC A;  2IF4 A;  4DRP A;  2DT1 A;  3EY6 A;  2PPN A;  3H9R B;  1FLC A;  4TNS A;  1KT0 A;  3WQV A;  3ARU A;  1Y0O A;  2O9O A;  3O5O A;  3FS8 A;  2DT2 A;  2YAJ B;  2RQS A;  2FAP A;  1IX5 A;  1ZBC A;  3CHD A;  4Q7N A;  2OLH A;  2JXW A;  3CGN A;  3PRD A;  3WL0 A;  3O5P A;  4DWS C;  4QIB A;  1F40 A;  4S3J A;  2JZV A;  1FFR A;  2WAD A;  3RM9 A;  4J4O A;  2Q5A A;  3FSC A;  5E62 A;  3BMB A;  4Z2K A;  1GRJ A;  2IUZ A;  5GPG A;  1YW5 A;  3GU0 A;  4JFK A;  3TDB A;  4JFM A;  1LJY A;  1JMQ A;  2B31 A;  1FD9 A;  4MNJ A;  2WM0 A;  4WKF A;  4NZC A;  1FKI A;  4O2T A;  5HW7 A;  2DK7 A;  4P8U A;  5HWC A;  1HJV A;  3UI4 A;  2WLZ A;  3IKD A;  1W9V A;  1ITX A;  2YBU A;  4ODO A;  4DH0 A;  1BKF A;  4QT3 A;  2YSH A;  3NTP A;  2ZQU A;  2DSZ A;  1H0I A;  3O5I A;  1GOI A;  4GIV A;  4ODM A;  1ZBW A;  2M3O W;  4DWS D;  1RP5 A;  3KAI A;  1NWR A;  1GUV A;  1LG1 A;  2LAJ A;  1JVW A;  2F4E A;  4BF8 A;  5HW8 A;  1W1Y A;  2XP9 A;  2FDM A;  1SYT A;  1PBK A;  1K9T A;  2P4V A;  4GGQ A;  4GLX A;  2KI3 A;  3ARV A;  3ARX A;  4MGV A;  5HTG A;  1HKK A;  2Y8N B;  1VF8 A;  1FKB A;  1YAT A;  5JH8 A;  2MDI A;  2RUR A;  3O5L A;  2XP8 A;  4TW6 A;  1X6N A;  5HT1 A;  2ZQT A;  2VCD A;  3IK8 A;  4LGX A;  1H0G A;  2XPA A;  3L4H A;  2F23 A;  1FKH A;  2LKN A;  3KZ7 A;  3WD3 A;  3GPK A;  2PV3 A;  4C02 B;  4DRH A;  4DZ3 A;  2ZQS A;  3G6L A;  5HKG A;  4LAX A;  3O5F A;  1O6W A;  3UI5 A;  2MLZ A;  2ZAJ A;  1ROU A;  3G6M A;  5E5W A;  3AQU A;  1LG2 A;  1D6O A;  3MCB B;  2MLY A;  4ML4 A;  3AS1 A;  4ODQ A;  1NH6 A;  4Z2G A;  3O5J A;  2QF8 A;  1W26 A;  1FKK A;  1Q6U A;  3UQI A;  3BXW A;  2DK1 A;  4JYS A;  4MNK A;  1NWU A;  4HAR A;  1FKS A;  1FAP A;  1E9L A;  2A3E A;  2PPP A;  2L2S A;  4URI A;  2WLY A;  4ZPV R;  2DMV A;  5E64 A;  2DSW A;  1UR8 A;  2D9F A;  4WJX A;  1UR9 A;  4DRJ A;  1ZL1 A;  2ZQV A;  3O5E A;  2M8J A;  4DZ2 A;  1NMV A;  3B9D A;  1C9H A;  2UZ5 A;  3AS3 A;  3KAH A;  2XP7 A;  2XP3 A;  2BA1 A;  3PQH A;  1HKM A;  1ZCN A;  2ITK A;  1EHN A;  2MNT A;  4TW8 A;  2WAE A;  1B6C A;  1X6L A;  2VN1 A;  3MQH A;  3PR9 A;  4W5U A;  4G50 A;  4W9Q A;  2L4J A;  2KO7 A;  1NMW A;  4WIW A;  1WMV A;  1E6P A;  4NNR A;  3EIP A;  2OWO A;  4ODK A;  3KCE A;  5BXJ A;  3FSB A;  2RUC A;  4N19 A;  1JND A;  1TK7 A;  4Z2L A;  5CQ2 A;  1TFV A;  4DRI A;  5GQB A;  4FAP A;  2YSF A;  1WB0 A;  2AWG A;  4QZV B;  2EZ5 W;  2DSU A;  4Q22 A;  2PN0 A;  4MTV A;  3RM4 A;  1J4R A;  4ODP A;  1J6Y A;  2N87 A;  3ARQ A;  1HKJ A;  4Z2J A;  3ARW A;  4AY1 A;  4DWS B;  3B9E A;  5HUA A;  2JV4 A;  1Q1C A;  1D7I A;  1E15 A;  1I5H W;  1QPL A;  4R5E A;  2ESC A;  3KAD A;  3QOK A;  3PRA A;  2PV2 A;  1NWS A;  4DRM A;  3TC5 A;  4E5R A;  3CNG A;  3MCB A;  3ODK A;  4HBE A;  4IQ2 A;  3UQA A;  1N1A A;  3ALG A;  1OGB A;  3JXV A;  3ARP A;  4IPX A;  4IQC A;  3WD1 A;  5E65 A;  1QZ2 A;  3AS0 A;  3O5M A;  2ETN A;  2F2D A;  2F21 A;  4REX A; 
#chains in the Genus database with same CATH homology
 3KAG A;  4ZPT R;  3IKG A;  1WNO A;  2MF9 A;  3WD2 A;  1SR0 A;  5HW6 A;  4KQZ A;  3VAW A;  1FKL A;  5DIT A;  4JFJ A;  2RE3 A;  3LKX A;  3O5R A;  5DEZ A;  2XP6 A;  4ODN A;  3CHC A;  4FN2 A;  3LE4 A;  3W4R A;  3FXY A;  3ARR A;  1HKI A;  1K9Q A;  1XHG A;  4L3N A;  1KFW A;  2OFN A;  1EDQ A;  1T11 A;  2A3A A;  3TCZ A;  2XPB A;  3MQG A;  1FKD A;  1U79 A;  1J4I A;  3RGC A;  3OOB A;  1W9P A;  3ALF A;  1Q6H A;  4MNM A;  4LAV A;  4QT2 A;  2ZR4 A;  2JX8 A;  5DIV A;  5DO2 A;  4L72 B;  3KAF A;  2DG4 A;  1FFQ A;  4S3K A;  1GPF A;  1R9H A;  4Z2I A;  1NWT A;  5J6E A;  4P8V A;  5I98 A;  3ARY A;  4W9P A;  2RSE A;  4DT4 A;  4JFL A;  4TX0 A;  1NSG A;  2ZR5 A;  4ODR A;  1LQ0 A;  2M2A A;  4MNL A;  2FKE A;  4HBO A;  1D2K A;  1ZU8 A;  2LPV A;  1QPF A;  2PV1 A;  1JNT A;  2E45 A;  1FKJ A;  2YSI A;  2M08 A;  5HWB A;  2XP4 A;  2DJY A;  3WIJ A;  2LGO A;  2M1I A;  4KR0 B;  4PTM A;  2QRV A;  1D7H A;  3ARZ A;  1ZK6 A;  2YSB A;  1K9R A;  4W9O A;  3JYM A;  2PBC A;  1OWQ A;  3NRK A;  3MDY B;  1RD6 A;  4G2P A;  2AOS A;  2Y78 A;  3O5Q A;  4NSB A;  3CHF A;  3FY1 A;  1WR7 A;  2G8Z A;  4P8X A;  1W1V A;  1W1T A;  4WK9 A;  4P8W A;  3PRB A;  3WL1 A;  2DWV A;  2LJ4 A;  2M8I A;  1P5Q A;  4XAK A;  4TYO A;  5E66 A;  1ZBV A;  3O5K A;  1W9U A;  2WK2 A;  1J4H A;  3WD0 A;  4U84 A;  2YBT A;  3CGM A;  4U86 A;  1FKF A;  1WAW A;  3B9A A;  5D75 A;  3JYJ A;  2PI6 A;  4ZS6 A;  4ODL A;  3M85 A;  3ARS A;  2KE0 A;  1Q6I A;  2A3C A;  1LL6 A;  4DRO A;  1E6N A;  2RUD A;  2DG3 A;  5DF0 A;  5HBF A;  3WD4 A;  4DRK A;  1W1P A;  2KR7 A;  4R0X A;  2XP5 A;  3LUO A;  4IT6 A;  3AS2 A;  2RUQ A;  2DSV A;  3RME A;  3O5G A;  3B7X A;  3PA7 A;  1M5Y A;  3B8S A;  3ARO A;  4DWS A;  1FKT A;  4MSP A;  1ZB5 A;  2DT3 A;  4ITZ A;  3WKZ A;  1F8A B;  1L1P A;  4Z2H A;  4ZPW R;  1HJW A;  3O5D A;  2ZR6 A;  2O92 A;  1FKG A;  2G41 A;  3RFW A;  1A7X A;  5DIU A;  4DRN A;  1JNE A;  5GPR A;  1KT1 A;  4JFI A;  5B8I C;  2KXQ A;  1FJD A;  3UI6 A;  1PIN A;  1HXV A;  1XRV A;  4IT4 A;  3RM8 A;  1EG3 A;  2K8I A;  1ROT A;  4MAV A;  2DG9 A;  3CHE A;  4U85 A;  4WKH A;  3UF8 A;  1HJX A;  3UQB A;  1LL4 A;  1E6R A;  1O6I A;  5AHT A;  4MPK A;  4WKA A;  1JNS A;  4A0U A;  3FAP A;  1TR8 A;  3KAB A;  2YSG A;  1BL4 A;  4LAY A;  3CZ8 A;  4TW7 A;  1LL7 A;  2KFW A;  4LAW A;  4DRQ A;  2MPH A;  2DPE A;  1EG4 A;  1ZBK A;  2DT0 A;  2JMF A;  1EIB A;  2PPO A;  3IHZ A;  5U47 A;  3LKX B;  1OGG A;  2KGJ A;  3WQW A;  3ART A;  3NI6 A;  2MLX A;  4DIP A;  4J4N A;  2A3B A;  1CTN A;  3M7N A;  1EYM A;  3I6C A;  3OA5 A;  3WH0 A;  3CH9 A;  4A0T A;  1D7J A;  1TCO C;  1EQ3 A;  1E6Z A;  1FKR A;  3KAC A;  2IF4 A;  4DRP A;  2DT1 A;  3EY6 A;  2PPN A;  3H9R B;  1FLC A;  4TNS A;  1KT0 A;  3WQV A;  3ARU A;  1Y0O A;  2O9O A;  3O5O A;  3FS8 A;  2DT2 A;  2YAJ B;  2RQS A;  2FAP A;  1IX5 A;  1ZBC A;  3CHD A;  4Q7N A;  2OLH A;  2JXW A;  3CGN A;  3PRD A;  3WL0 A;  3O5P A;  4DWS C;  4QIB A;  1F40 A;  4S3J A;  2JZV A;  1FFR A;  2WAD A;  3RM9 A;  4J4O A;  2Q5A A;  3FSC A;  5E62 A;  4Z2K A;  2IUZ A;  5GPG A;  1YW5 A;  4JFK A;  3TDB A;  4JFM A;  1LJY A;  1JMQ A;  2B31 A;  1FD9 A;  4MNJ A;  2WM0 A;  4WKF A;  4NZC A;  1FKI A;  4O2T A;  5HW7 A;  2DK7 A;  4P8U A;  5HWC A;  1HJV A;  3UI4 A;  2WLZ A;  3IKD A;  1W9V A;  1ITX A;  2YBU A;  4ODO A;  4DH0 A;  1BKF A;  4QT3 A;  2YSH A;  3NTP A;  2ZQU A;  2DSZ A;  1H0I A;  3O5I A;  1GOI A;  4GIV A;  4ODM A;  1ZBW A;  2M3O W;  4DWS D;  1RP5 A;  3KAI A;  1NWR A;  1GUV A;  1LG1 A;  2LAJ A;  1JVW A;  2F4E A;  4BF8 A;  5HW8 A;  1W1Y A;  2XP9 A;  2FDM A;  1SYT A;  1PBK A;  1K9T A;  4GGQ A;  4GLX A;  2KI3 A;  3ARV A;  3ARX A;  4MGV A;  5HTG A;  1HKK A;  2Y8N B;  1VF8 A;  1FKB A;  1YAT A;  5JH8 A;  2MDI A;  2RUR A;  3O5L A;  2XP8 A;  4TW6 A;  1X6N A;  5HT1 A;  2ZQT A;  2VCD A;  3IK8 A;  4LGX A;  1H0G A;  2XPA A;  3L4H A;  3KZ7 A;  1FKH A;  2LKN A;  3WD3 A;  3GPK A;  2PV3 A;  4C02 B;  4DRH A;  4DZ3 A;  2ZQS A;  3G6L A;  5HKG A;  4LAX A;  3O5F A;  1O6W A;  3UI5 A;  2MLZ A;  2ZAJ A;  1ROU A;  3G6M A;  5E5W A;  3AQU A;  1LG2 A;  1D6O A;  3MCB B;  2MLY A;  4ML4 A;  3AS1 A;  4ODQ A;  1NH6 A;  4Z2G A;  3O5J A;  2QF8 A;  1W26 A;  1FKK A;  1Q6U A;  3UQI A;  3BXW A;  2DK1 A;  4JYS A;  4MNK A;  1NWU A;  4HAR A;  1FKS A;  1FAP A;  1E9L A;  2A3E A;  2PPP A;  2L2S A;  4URI A;  2WLY A;  4ZPV R;  2DMV A;  5E64 A;  2DSW A;  1UR8 A;  2D9F A;  4WJX A;  1UR9 A;  4DRJ A;  1ZL1 A;  2ZQV A;  3O5E A;  2M8J A;  4DZ2 A;  1NMV A;  3B9D A;  1C9H A;  3AS3 A;  2UZ5 A;  3KAH A;  2XP7 A;  2XP3 A;  2BA1 A;  3PQH A;  1HKM A;  1ZCN A;  2ITK A;  1EHN A;  2MNT A;  4TW8 A;  2WAE A;  1B6C A;  1X6L A;  2VN1 A;  3MQH A;  3PR9 A;  4W5U A;  4G50 A;  4W9Q A;  2L4J A;  2KO7 A;  1NMW A;  4WIW A;  1WMV A;  1E6P A;  4NNR A;  2OWO A;  4ODK A;  3KCE A;  5BXJ A;  3FSB A;  2RUC A;  4N19 A;  1JND A;  1TK7 A;  4Z2L A;  5CQ2 A;  1TFV A;  4DRI A;  5GQB A;  4FAP A;  2YSF A;  1WB0 A;  2AWG A;  4QZV B;  2EZ5 W;  2DSU A;  4Q22 A;  4MTV A;  3RM4 A;  1J4R A;  4ODP A;  1J6Y A;  2N87 A;  3ARQ A;  1HKJ A;  4Z2J A;  3ARW A;  4AY1 A;  4DWS B;  3B9E A;  5HUA A;  2JV4 A;  1Q1C A;  1D7I A;  1E15 A;  1I5H W;  1QPL A;  4R5E A;  2ESC A;  3KAD A;  3QOK A;  3PRA A;  2PV2 A;  1NWS A;  4DRM A;  3TC5 A;  4E5R A;  3CNG A;  3MCB A;  3ODK A;  4HBE A;  4IQ2 A;  3UQA A;  1N1A A;  3ALG A;  1OGB A;  3JXV A;  3ARP A;  4IPX A;  4IQC A;  3WD1 A;  5E65 A;  1QZ2 A;  3AS0 A;  3O5M A;  2F2D A;  2F21 A;  4REX A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...