3KAHA

Structure-guided design of alpha-amino acid-derived pin1 inhibitors
Total Genus 42
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
42
sequence length
157
structure length
145
Chain Sequence
LPPGWEKAMSRSSGRVYYFNHITNASQWERPSEPARVRCSHLLVKHSQSRRPSSWRQEKITRTKEEALELINGYIQKIKSGEEDFESLASQFSDCSSAKARGDLGAFSRGQMQKPFEDASFALRTGEMSGPVFTDSGIHIILRTE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure-guided design of alpha-amino acid-derived Pin1 inhibitors
pubmed doi rcsb
source organism Homo sapiens
molecule tags Isomerase
molecule keywords Peptidyl-prolyl cis-trans isomerase NIMA-interacting 1
total genus 42
structure length 145
sequence length 157
ec nomenclature ec 5.2.1.8: Peptidylprolyl isomerase.
pdb deposition date 2009-10-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00397 WW WW domain
A PF00639 Rotamase PPIC-type PPIASE domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.20.70.10 Mainly Beta Single Sheet Ubiquitin Ligase Nedd4; Chain: W; Ubiquitin Ligase Nedd4; Chain: W; 3kahA01
3.10.50.40 Alpha Beta Roll Chitinase A; domain 3 Chitinase A; domain 3 3kahA02
1EG3A 2Q5AA 3KCEA 4DRHA 3OOBA 1FKJA 1FKSA 2RURA 4GIVA 4JFLA 4BF8A 1FKGA 4DRKA 3NRKA 2RQSA 3O5RA 3PA7A 4ODLA 1T11A 4W9OA 3O5GA 3UQIA 1D7HA 1F40A 1EG4A 1QPLA 3KADA 4GGQA 2YSFA 3ODKA 2M08A 3O5EA 4TX0A 4C02B 2LGOA 1ZCNA 1J4RA 2D9FA 4TYOA 2JMFA 2ZR4A 2DK7A 5HKGA 1ZK6A 1W26A 2PBCA 2MNTA 3IK8A 1PINA 4MSPA 3TCZA 2ZR5A 2XP9A 1I5HW 3GPKA 4ODQA 4TW6A 3NTPA 5CQ2A 5HWCA 2LJ4A 2F4EA 1JVWA 2PV2A 2DG3A 2KE0A 2LPVA 1KT0A 3RFWA 4DRQA 3B7XA 4JFIA 3KAGA 5HW6A 2RUCA 1R9HA 4QT3A 1J4IA 3O5MA 2DMVA 1JMQA 4ODNA 5GPGA 4LAWA 2DG4A 3CGNA 5HTGA 2MLXA 1FKDA 1JNTA 2MF9A 1TCOC 3CGMA 2MLYA 5D75A 1FKFA 1FKTA 4JYSA 2YSBA 1Q6HA 4R0XA 2KGJA 3O5PA 1D7JA 2JV4A 2RSEA 1FJDA 4IPXA 1Q6IA 1TK7A 1F8AB 4ODKA 4QIBA 1NMVA 2FAPA 1L1PA 2LKNA 3I6CA 3LE4A 5HWBA 5HW8A 2L2SA 2PPNA 4TW7A 3JYMA 4FN2A 2RUDA 3TC5A 4U86A 3KAHA 2N87A 3RGCA 4JFKA 2ZQUA 2YSHA 3VAWA 5DIUA 3NI6A 5I98A 4ODMA 2DG9A 5HUAA 1FKRA 3M85A 1FKHA 2UZ5A 1Y0OA 3O5DA 1U79A 4TW8A 4G50A 2M1IA 4DROA 1EYMA 1O6WA 2DK1A 3O5JA 4NNRA 4W9QA 5DIVA 3LUOA 3JXVA 4J4NA 2M3OW 4DH0A 1BKFA 2RE3A 4IQCA 1JNSA 2YSGA 2M8IA 2XPBA 2ZQTA 2DWVA 2XP3A 2XP8A 1K9QA 1FKBA 2KFWA 2ZQVA 1C9HA 4LAXA 4DIPA 5J6EA 1NMWA 3UQAA 1HXVA 2ZAJA 1ROTA 4LAYA 4JFJA 2JXWA 2KO7A 2KR7A 1J6YA 1QZ2A 2PV3A 1Q6UA 2AWGA 2PV1A 4ODRA 3PRDA 2PPOA 1PBKA 4DRMA 1FAPA 1EQ3A 5AHTA 1FKLA 2ZR6A 3UI6A 1KT1A 4G2PA 2XPAA 3MDYB 2XP5A 4DRJA 4TNSA 1N1AA 2MPHA 4IQ2A 4W9PA 3KACA 4J4OA 3CNGA 1Q1CA 4QT2A 4JFMA 2MDIA 3O5OA 3UI4A 2L4JA 1FKKA 1FKIA 3IHZA 3UF8A 1FD9A 2ZQSA 2BA1A 1J4HA 1P5QA 3L4HA 4E5RA 1A7XA 1YATA 3IKDA 2Y78A 4DRIA 1D7IA 4U84A 1ROUA 3M7NA 2KI3A 2VCDA 4REXA 2DJYA 3O5LA 3O5QA 2FKEA 2JZVA 4DRNA 2M8JA 1WMVA 2XP4A 3O5FA 4O2TA 2JX8A 4DT4A 2ITKA 4N19A 3O5KA 2PPPA 2RUQA 3O5IA 2KXQA 3TDBA 1QPFA 1YW5A 3FAPA 4ITZA 2XP6A 3UI5A 4DRPA 2YSIA 2EZ5W 2VN1A 4U85A 4ODPA 3KAFA 4LAVA 1B6CA 1M5YA 1NSGA 2K8IA 2MLZA 2OFNA 4DZ3A 5BXJA 5B8IC 3KABA 2F21A 1K9RA 3WH0A 4FAPA 3H9RB 1D6OA 5HW7A 5DITA 2IF4A 1BL4A 3KZ7A 4MGVA 5HT1A 4ODOA 2XP7A 2E45A 2F2DA 3IKGA 2M2AA 4DZ2A 3UQBA 3JYJA 3EY6A 2LAJA 1WR7A 3PRBA 3KAIA
chains in the Genus database with same CATH superfamily
3OOBA 1FKJA 2DSWA 2RURA 4GIVA 1OGGA 3UQBA 4DRKA 4ODLA 1D7HA 1QPLA 4GGQA 2YSFA 4C02B 3CHCA 2DK7A 1W1YA 1W9VA 1PINA 4Z2KA 1I5HW 1W1VA 2FDMA 3AS0A 1NWRA 1KT0A 3RFWA 2P4VA 2RUCA 4QT3A 1J4IA 2DMVA 2Y8NB 1OWQA 1E44A 2MF9A 4ZS6A 1FKFA 4R0XA 4A0UA 3G6LA 1Q6IA 5E62A 3KAIA 3PQHA 1D2KA 4U86A 3CHFA 1ZBVA 1FFRA 2IUZA 2ZQUA 2YSHA 3WKZA 5DIUA 5I98A 4ODMA 3M85A 3O5DA 4TW8A 1U79A 2A3EA 2YBUA 1GRJA 1XHGA 4DH0A 2RE3A 4IQCA 2ZQTA 2XPBA 2KFWA 4LAXA 2ZQVA 1C9HA 1JNDA 2ZAJA 1TFVA 3CHEA 2KR7A 2WAEA 4JFJA 3RM9A 2AWGA 3PRDA 2PPOA 5GPRA 4DRMA 3B9EA 2YBTA 2ZR6A 3MDYB 1H0IA 1HJXA 5E66A 4DRJA 4TNSA 4Z2IA 2MPHA 1HJWA 3FSCA 4W9PA 4S3JA 3CNGA 3O5OA 2YAJB 4WIWA 1J4HA 4E5RA 3IKDA 2Y78A 4HARA 1HKKA 4REXA 2DJYA 3O5QA 4KR0B 1WMVA 4DT4A 1LG2A 4ZPWR 1ZU8A 1QPFA 3FY1A 4ITZA 4MNJA 4U85A 4ODPA 3KAFA 4LAVA 2QF8A 1NSGA 1E9LA 3KABA 2F21A 3WH0A 1IX5A 5HW7A 1LJYA 2IF4A 2XP7A 2E45A 4DZ2A 5E64A 3JYJA 1O6IA 3EY6A 2LAJA 1WR7A 1EG3A 4MNLA 2Q5AA 3KCEA 1FKSA 4BF8A 1JCHB 2RQSA 3O5RA 3PA7A 3UQIA 3ARUA 1F40A 1K9TA 3ARSA 4TX0A 2DSUA 3O5EA 1ZCNA 1J4RA 3ARWA 4TYOA 2JMFA 1ZK6A 3RM8A 5HBFA 4MSPA 4DWSB 2XP9A 4ODQA 4TW6A 5CQ2A 2ETNA 2PV2A 4R5EA 3W4RA 2KE0A 3B7XA 4JFIA 1R9HA 2DT0A 4MNMA 1ZB5A 4WKAA 5GPGA 3FXYA 2DG4A 5HTGA 5D75A 3RMEA 3FS8A 1FKTA 3ARZA 3RM4A 3AS2A 3O5PA 4LGXA 2RSEA 1FJDA 1TK7A 2WK2A 1NMVA 5E5WA 1EHNA 3LE4A 5HW8A 1NWTA 2AOSA 2RUDA 1RP5A 3KAHA 3ARVA 5DO2A 4Q7NA 1VF8A 2DT1A 3ARTA 1Y0OA 2WADA 4G50A 2M1IA 3WL0A 1O6WA 3JXVA 4J4NA 1BKFA 4W5UA 2YSGA 2XP3A 4DIPA 1ITXA 1W9UA 3GTYX 2OLHA 3WD1A 1GPFA 1QZ2A 3WD4A 1EQ3A 1KT1A 2XPAA 2XP5A 4WK9A 1N1AA 3KACA 3ARQA 4WKFA 5DF0A 4JFMA 2L4JA 1FKKA 1FKIA 4PTMA 3LKXA 1E15A 1HKMA 2ZQSA 4URIA 3L4HA 4DRIA 1YATA 2DSVA 2KI3A 3CH9A 3M7NA 3MQHA 4DRNA 4O2TA 5E65A 3WQWA 4N19A 1E6RA 2RUQA 3O5IA 2KXQA 4HBOA 2DSZA 1M5YA 2MLZA 5BXJA 4DZ3A 5B8IC 4FAPA 3H9RB 5DITA 1BL4A 3MQGA 3KZ7A 4MGVA 3WL1A 4ODOA 3IKGA 2F2DA 2G8ZA 2OWOA 4MTVA 1E6PA 4W9OA 1GOIA 3KADA 2D9FA 2WM0A 2ZR4A 1OGBA 3PRAA 2DT2A 1W26A 5HKGA 2MNTA 3IK8A 3TCZA 2ZR5A 4MNKA 3GPKA 3BXWA 4L72B 3NTPA 2LJ4A 4ZPTR 2PN0A 3CZ8A 4DRQA 1WAWA 5HW6A 4DWSD 3LKXB 3O5MA 4KQZA 3AROA 1XRVA 1LG1A 2MLYA 5GQBA 2KGJA 3B9AA 1D7JA 3ALFA 4IPXA 1LL7A 2WLYA 1F8AB 4QIBA 2FAPA 1EIBA 1L1PA 3I6CA 2PPNA 4TW7A 3AQUA 3JYMA 4QZVB 4FN2A 3TC5A 4MAVA 2N87A 1H0GA 1HKIA 4JFKA 3VAWA 2A3CA 3NI6A 2DG9A 1FKRA 1FKHA 3AS3A 3GU0A 1HKJA 1X6LA 4NNRA 3O5JA 1ZBWA 2M3OW 2M8IA 3CHDA 2EULA 1ROTA 2JXWA 1J6YA 1Q6UA 4ML4A 4ODRA 3BMBA 2O92A 1FAPA 3B9DA 4GLXA 4IQ2A 3B8SA 3UI4A 1KFWA 3WQVA 2BA1A 1P5QA 3ARPA 2B31A 5HUAA 1D7IA 1ROUA 1UR9A 3O5LA 2F23A 2FKEA 2JZVA 2XP4A 1TR8A 3O5FA 4NZCA 3O5KA 2PPPA 3MCBA 1GUVA 4Z2HA 3TDBA 4Z2JA 1YW5A 1E6NA 2PI6A 2YSIA 4AY1A 1X6NA 1B6CA 5U47A 3QOKA 4IT4A 1D6OA 5HT1A 1W1TA 2QRVA 4DRHA 4JFLA 1FKGA 2WLZA 3NRKA 1T11A 3O5GA 1EG4A 3ODKA 2M08A 1WNOA 1HJVA 2LGOA 3PR9A 4NSBA 2PBCA 1W1PA 4A0TA 5HWCA 4DWSC 4S3KA 2F4EA 1JVWA 1EDQA 2DG3A 1FLCA 2LPVA 3KAGA 1SR0A 1JMQA 3ARYA 4ODNA 4P8WA 4LAWA 3CGNA 1LL4A 2MLXA 1FKDA 1JNTA 4Q22A 1TCOC 3CGMA 5JH8A 2ESCA 4JYSA 2YSBA 1Q6HA 4HBEA 2JV4A 3WD0A 3WD3A 4ODKA 1ZBCA 3ALGA 4DWSA 2LKNA 5HWBA 1NH6A 2L2SA 1ZL1A 1WB0A 4XAKA 2G41A 3FSBA 3RGCA 4L3NA 4ZPVR 3WD2A 2UZ5A 4WKHA 4P8VA 4DROA 1EYMA 2DK1A 4W9QA 5DIVA 3LUOA 1JNSA 2DWVA 2XP8A 1K9QA 1CTNA 1FKBA 5J6EA 3MCBB 1NMWA 3UQAA 1HXVA 1NWSA 4LAYA 2KO7A 1LL6A 2PV3A 4P8UA 2PV1A 5AHTA 1FKLA 1W9PA 3UI6A 4G2PA 4IT6A 2A3AA 2DPEA 2O9OA 2B5UB 4J4OA 1Q1CA 4QT2A 4UDMA 2MDIA 4Z2GA 1UR8A 3IHZA 1NWUA 3UF8A 1FD9A 3WIJA 2DT3A 1LQ0A 1A7XA 4U84A 2VCDA 3AS1A 1SYTA 2M8JA 2JX8A 2ITKA 1ZBKA 1RD6A 1JNEA 2A3BA 3FAPA 3UI5A 2XP6A 4DRPA 2EZ5W 2VN1A 1FFQA 2K8IA 2OFNA 4Z2LA 1K9RA 3OA5A 3G6MA 3EIPA 1E6ZA 4MPKA 2M2AA 5DEZA 3ARXA 3ARRA 4P8XA 3PRBA 4WJXA 1PBKA
chains in the Genus database with same CATH topology
3OOBA 1FKJA 2DSWA 2RURA 4GIVA 1OGGA 3UQBA 4DRKA 4ODLA 1D7HA 1QPLA 4GGQA 2YSFA 4C02B 3CHCA 2DK7A 1W1YA 1W9VA 1PINA 4Z2KA 1I5HW 1W1VA 2FDMA 3AS0A 1NWRA 1KT0A 3RFWA 2RUCA 4QT3A 1J4IA 2DMVA 2Y8NB 1OWQA 2MF9A 4ZS6A 1FKFA 4R0XA 4A0UA 3G6LA 1Q6IA 5E62A 3KAIA 3PQHA 1D2KA 4U86A 3CHFA 1ZBVA 1FFRA 2IUZA 2ZQUA 2YSHA 3WKZA 5DIUA 5I98A 4ODMA 3M85A 3O5DA 4TW8A 1U79A 2A3EA 2YBUA 1XHGA 4DH0A 2RE3A 4IQCA 2ZQTA 2XPBA 2KFWA 4LAXA 2ZQVA 1C9HA 1JNDA 2ZAJA 1TFVA 3CHEA 2KR7A 2WAEA 4JFJA 3RM9A 2AWGA 3PRDA 2PPOA 5GPRA 4DRMA 3B9EA 2YBTA 2ZR6A 3MDYB 1H0IA 1HJXA 5E66A 4DRJA 4TNSA 4Z2IA 2MPHA 1HJWA 3FSCA 4W9PA 4S3JA 3CNGA 3O5OA 2YAJB 4WIWA 1J4HA 4E5RA 3IKDA 2Y78A 4HARA 1HKKA 4REXA 2DJYA 3O5QA 4KR0B 1WMVA 4DT4A 1LG2A 4ZPWR 1ZU8A 1QPFA 3FY1A 4ITZA 4MNJA 4U85A 4ODPA 3KAFA 4LAVA 2QF8A 1NSGA 1E9LA 3KABA 2F21A 3WH0A 1IX5A 5HW7A 1LJYA 2IF4A 2XP7A 2E45A 4DZ2A 5E64A 3JYJA 1O6IA 3EY6A 2LAJA 1WR7A 1EG3A 4MNLA 2Q5AA 3KCEA 1FKSA 4BF8A 3O5RA 2RQSA 3PA7A 1F40A 3UQIA 3ARUA 1K9TA 3ARSA 4TX0A 2DSUA 3O5EA 1ZCNA 1J4RA 3ARWA 4TYOA 2JMFA 1ZK6A 3RM8A 5HBFA 4MSPA 4DWSB 2XP9A 4ODQA 4TW6A 5CQ2A 2PV2A 4R5EA 3W4RA 2KE0A 3B7XA 4JFIA 1R9HA 2DT0A 4MNMA 1ZB5A 4WKAA 5GPGA 3FXYA 2DG4A 5HTGA 5D75A 3RMEA 3FS8A 1FKTA 3ARZA 3RM4A 3AS2A 3O5PA 4LGXA 2RSEA 1FJDA 1TK7A 2WK2A 1NMVA 5E5WA 1EHNA 3LE4A 5HW8A 1NWTA 2AOSA 2RUDA 1RP5A 3KAHA 3ARVA 5DO2A 4Q7NA 1VF8A 2DT1A 3ARTA 1Y0OA 2WADA 4G50A 2M1IA 3WL0A 1O6WA 3JXVA 4J4NA 1BKFA 4W5UA 2YSGA 2XP3A 4DIPA 1ITXA 1W9UA 2OLHA 3WD1A 1GPFA 1QZ2A 3WD4A 1EQ3A 1KT1A 2XPAA 2XP5A 4WK9A 1N1AA 3KACA 3ARQA 4WKFA 5DF0A 4JFMA 2L4JA 1FKKA 1FKIA 4PTMA 3LKXA 1E15A 1HKMA 2ZQSA 4URIA 3L4HA 4DRIA 1YATA 2DSVA 2KI3A 3CH9A 3M7NA 3MQHA 4DRNA 4O2TA 5E65A 3WQWA 4N19A 1E6RA 2RUQA 3O5IA 2KXQA 4HBOA 2DSZA 1M5YA 2MLZA 5BXJA 4DZ3A 5B8IC 4FAPA 3H9RB 5DITA 1BL4A 3MQGA 3KZ7A 4MGVA 3WL1A 4ODOA 3IKGA 2F2DA 2G8ZA 2OWOA 4MTVA 1E6PA 4W9OA 1GOIA 3KADA 2D9FA 2WM0A 2ZR4A 1OGBA 3PRAA 2DT2A 1W26A 5HKGA 2MNTA 3IK8A 3TCZA 2ZR5A 4MNKA 3GPKA 3BXWA 4L72B 3NTPA 2LJ4A 4ZPTR 3CZ8A 4DRQA 1WAWA 5HW6A 4DWSD 3LKXB 3O5MA 4KQZA 3AROA 1XRVA 1LG1A 2MLYA 5GQBA 2KGJA 3B9AA 1D7JA 3ALFA 4IPXA 1LL7A 2WLYA 1F8AB 4QIBA 2FAPA 1EIBA 1L1PA 3I6CA 2PPNA 4TW7A 3AQUA 3JYMA 4QZVB 4FN2A 3TC5A 4MAVA 2N87A 1H0GA 1HKIA 4JFKA 3VAWA 2A3CA 3NI6A 2DG9A 1FKRA 1FKHA 3AS3A 1HKJA 1X6LA 4NNRA 3O5JA 1ZBWA 2M3OW 2M8IA 3CHDA 1ROTA 2JXWA 1J6YA 1Q6UA 4ML4A 4ODRA 2O92A 1FAPA 3B9DA 4GLXA 4IQ2A 3B8SA 3UI4A 1KFWA 3WQVA 2BA1A 1P5QA 3ARPA 2B31A 5HUAA 1D7IA 1ROUA 1UR9A 3O5LA 2FKEA 2JZVA 2XP4A 1TR8A 3O5FA 4NZCA 3O5KA 2PPPA 3MCBA 1GUVA 4Z2HA 3TDBA 4Z2JA 1YW5A 1E6NA 2PI6A 2YSIA 4AY1A 1X6NA 1B6CA 5U47A 3QOKA 4IT4A 1D6OA 5HT1A 1W1TA 2QRVA 4DRHA 4JFLA 1FKGA 2WLZA 3NRKA 1T11A 3O5GA 1EG4A 3ODKA 2M08A 1WNOA 1HJVA 2LGOA 3PR9A 4NSBA 2PBCA 1W1PA 4A0TA 5HWCA 4DWSC 4S3KA 2F4EA 1JVWA 1EDQA 2DG3A 1FLCA 2LPVA 3KAGA 1SR0A 1JMQA 3ARYA 4ODNA 4P8WA 4LAWA 3CGNA 1LL4A 2MLXA 1FKDA 1JNTA 4Q22A 1TCOC 3CGMA 5JH8A 2ESCA 4JYSA 2YSBA 1Q6HA 4HBEA 2JV4A 3WD0A 3WD3A 4ODKA 1ZBCA 3ALGA 4DWSA 2LKNA 5HWBA 1NH6A 2L2SA 1ZL1A 1WB0A 4XAKA 2G41A 3FSBA 3RGCA 4L3NA 4ZPVR 3WD2A 2UZ5A 4WKHA 4P8VA 4DROA 1EYMA 2DK1A 4W9QA 5DIVA 3LUOA 1JNSA 2DWVA 2XP8A 1K9QA 1CTNA 1FKBA 5J6EA 3MCBB 1NMWA 3UQAA 1HXVA 1NWSA 4LAYA 2KO7A 1LL6A 2PV3A 4P8UA 2PV1A 5AHTA 1FKLA 1W9PA 3UI6A 4G2PA 4IT6A 2A3AA 2DPEA 2O9OA 4J4OA 1Q1CA 4QT2A 2MDIA 4Z2GA 1UR8A 3IHZA 1NWUA 3UF8A 1FD9A 3WIJA 2DT3A 1LQ0A 1A7XA 4U84A 2VCDA 3AS1A 1SYTA 2M8JA 2JX8A 2ITKA 1ZBKA 1RD6A 1JNEA 2A3BA 3FAPA 3UI5A 2XP6A 4DRPA 2EZ5W 2VN1A 1FFQA 2K8IA 2OFNA 4Z2LA 1K9RA 3OA5A 3G6MA 1E6ZA 4MPKA 2M2AA 5DEZA 3ARXA 3ARRA 4P8XA 3PRBA 4WJXA 1PBKA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1EG3 A;  2Q5A A;  3KCE A;  4DRH A;  3OOB A;  1FKJ A;  1FKS A;  2RUR A;  4GIV A;  4JFL A;  4BF8 A;  1FKG A;  4DRK A;  3NRK A;  2RQS A;  3O5R A;  3PA7 A;  4ODL A;  1T11 A;  4W9O A;  3O5G A;  3UQI A;  1D7H A;  1F40 A;  1EG4 A;  1QPL A;  3KAD A;  4GGQ A;  2YSF A;  3ODK A;  2M08 A;  3O5E A;  4TX0 A;  4C02 B;  2LGO A;  1ZCN A;  1J4R A;  2D9F A;  4TYO A;  2JMF A;  2ZR4 A;  2DK7 A;  5HKG A;  1ZK6 A;  1W26 A;  2PBC A;  2MNT A;  3IK8 A;  1PIN A;  4MSP A;  3TCZ A;  2ZR5 A;  2XP9 A;  1I5H W;  3GPK A;  4ODQ A;  4TW6 A;  3NTP A;  5CQ2 A;  5HWC A;  2LJ4 A;  2F4E A;  1JVW A;  2PV2 A;  2DG3 A;  2KE0 A;  2LPV A;  1KT0 A;  3RFW A;  4DRQ A;  3B7X A;  4JFI A;  3KAG A;  5HW6 A;  2RUC A;  1R9H A;  4QT3 A;  1J4I A;  3O5M A;  2DMV A;  1JMQ A;  4ODN A;  5GPG A;  4LAW A;  2DG4 A;  3CGN A;  5HTG A;  2MLX A;  1FKD A;  1JNT A;  2MF9 A;  1TCO C;  3CGM A;  2MLY A;  5D75 A;  1FKF A;  1FKT A;  4JYS A;  2YSB A;  1Q6H A;  4R0X A;  2KGJ A;  3O5P A;  1D7J A;  2JV4 A;  2RSE A;  1FJD A;  4IPX A;  1Q6I A;  1TK7 A;  1F8A B;  4ODK A;  4QIB A;  1NMV A;  2FAP A;  1L1P A;  2LKN A;  3I6C A;  3LE4 A;  5HWB A;  5HW8 A;  2L2S A;  2PPN A;  4TW7 A;  3JYM A;  4FN2 A;  2RUD A;  3TC5 A;  4U86 A;  3KAH A;  2N87 A;  3RGC A;  4JFK A;  2ZQU A;  2YSH A;  3VAW A;  5DIU A;  3NI6 A;  5I98 A;  4ODM A;  2DG9 A;  5HUA A;  1FKR A;  3M85 A;  1FKH A;  2UZ5 A;  1Y0O A;  3O5D A;  1U79 A;  4TW8 A;  4G50 A;  2M1I A;  4DRO A;  1EYM A;  1O6W A;  2DK1 A;  3O5J A;  4NNR A;  4W9Q A;  5DIV A;  3LUO A;  3JXV A;  4J4N A;  2M3O W;  4DH0 A;  1BKF A;  2RE3 A;  4IQC A;  1JNS A;  2YSG A;  2M8I A;  2XPB A;  2ZQT A;  2DWV A;  2XP3 A;  2XP8 A;  1K9Q A;  1FKB A;  2KFW A;  2ZQV A;  1C9H A;  4LAX A;  4DIP A;  5J6E A;  1NMW A;  3UQA A;  1HXV A;  2ZAJ A;  1ROT A;  4LAY A;  4JFJ A;  2JXW A;  2KO7 A;  2KR7 A;  1J6Y A;  1QZ2 A;  2PV3 A;  1Q6U A;  2AWG A;  2PV1 A;  4ODR A;  3PRD A;  2PPO A;  1PBK A;  4DRM A;  1FAP A;  1EQ3 A;  5AHT A;  1FKL A;  2ZR6 A;  3UI6 A;  1KT1 A;  4G2P A;  2XPA A;  3MDY B;  2XP5 A;  4DRJ A;  4TNS A;  1N1A A;  2MPH A;  4IQ2 A;  4W9P A;  3KAC A;  4J4O A;  3CNG A;  1Q1C A;  4QT2 A;  4JFM A;  2MDI A;  3O5O A;  3UI4 A;  2L4J A;  1FKK A;  1FKI A;  3IHZ A;  3UF8 A;  1FD9 A;  2ZQS A;  2BA1 A;  1J4H A;  1P5Q A;  3L4H A;  4E5R A;  1A7X A;  1YAT A;  3IKD A;  2Y78 A;  4DRI A;  1D7I A;  4U84 A;  1ROU A;  3M7N A;  2KI3 A;  2VCD A;  4REX A;  2DJY A;  3O5L A;  3O5Q A;  2FKE A;  2JZV A;  4DRN A;  2M8J A;  1WMV A;  2XP4 A;  3O5F A;  4O2T A;  2JX8 A;  4DT4 A;  2ITK A;  4N19 A;  3O5K A;  2PPP A;  2RUQ A;  3O5I A;  2KXQ A;  3TDB A;  1QPF A;  1YW5 A;  3FAP A;  4ITZ A;  2XP6 A;  3UI5 A;  4DRP A;  2YSI A;  2EZ5 W;  2VN1 A;  4U85 A;  4ODP A;  3KAF A;  4LAV A;  1B6C A;  1M5Y A;  1NSG A;  2K8I A;  2MLZ A;  2OFN A;  4DZ3 A;  5BXJ A;  5B8I C;  3KAB A;  2F21 A;  1K9R A;  3WH0 A;  4FAP A;  3H9R B;  1D6O A;  5HW7 A;  5DIT A;  2IF4 A;  1BL4 A;  3KZ7 A;  4MGV A;  5HT1 A;  4ODO A;  2XP7 A;  2E45 A;  2F2D A;  3IKG A;  2M2A A;  4DZ2 A;  3UQB A;  3JYJ A;  3EY6 A;  2LAJ A;  1WR7 A;  3PRB A;  3KAI A; 
#chains in the Genus database with same CATH topology
 3OOB A;  1FKJ A;  2DSW A;  2RUR A;  4GIV A;  1OGG A;  3UQB A;  4DRK A;  4ODL A;  1D7H A;  1QPL A;  4GGQ A;  2YSF A;  4C02 B;  3CHC A;  2DK7 A;  1W1Y A;  1W9V A;  1PIN A;  4Z2K A;  1I5H W;  1W1V A;  2FDM A;  3AS0 A;  1NWR A;  1KT0 A;  3RFW A;  2P4V A;  2RUC A;  4QT3 A;  1J4I A;  2DMV A;  2Y8N B;  1OWQ A;  1E44 A;  2MF9 A;  4ZS6 A;  1FKF A;  4R0X A;  4A0U A;  3G6L A;  1Q6I A;  5E62 A;  3KAI A;  3PQH A;  1D2K A;  4U86 A;  3CHF A;  1ZBV A;  1FFR A;  2IUZ A;  2ZQU A;  2YSH A;  3WKZ A;  5DIU A;  5I98 A;  4ODM A;  3M85 A;  3O5D A;  4TW8 A;  1U79 A;  2A3E A;  2YBU A;  1GRJ A;  1XHG A;  4DH0 A;  2RE3 A;  4IQC A;  2ZQT A;  2XPB A;  2KFW A;  4LAX A;  2ZQV A;  1C9H A;  1JND A;  2ZAJ A;  1TFV A;  3CHE A;  2KR7 A;  2WAE A;  4JFJ A;  3RM9 A;  2AWG A;  3PRD A;  2PPO A;  5GPR A;  4DRM A;  3B9E A;  2YBT A;  2ZR6 A;  3MDY B;  1H0I A;  1HJX A;  5E66 A;  4DRJ A;  4TNS A;  4Z2I A;  2MPH A;  1HJW A;  3FSC A;  4W9P A;  4S3J A;  3CNG A;  3O5O A;  2YAJ B;  4WIW A;  1J4H A;  4E5R A;  3IKD A;  2Y78 A;  4HAR A;  1HKK A;  4REX A;  2DJY A;  3O5Q A;  4KR0 B;  1WMV A;  4DT4 A;  1LG2 A;  4ZPW R;  1ZU8 A;  1QPF A;  3FY1 A;  4ITZ A;  4MNJ A;  4U85 A;  4ODP A;  3KAF A;  4LAV A;  2QF8 A;  1NSG A;  1E9L A;  3KAB A;  2F21 A;  3WH0 A;  1IX5 A;  5HW7 A;  1LJY A;  2IF4 A;  2XP7 A;  2E45 A;  4DZ2 A;  5E64 A;  3JYJ A;  1O6I A;  3EY6 A;  2LAJ A;  1WR7 A;  1EG3 A;  4MNL A;  2Q5A A;  3KCE A;  1FKS A;  4BF8 A;  1JCH B;  2RQS A;  3O5R A;  3PA7 A;  3UQI A;  3ARU A;  1F40 A;  1K9T A;  3ARS A;  4TX0 A;  2DSU A;  3O5E A;  1ZCN A;  1J4R A;  3ARW A;  4TYO A;  2JMF A;  1ZK6 A;  3RM8 A;  5HBF A;  4MSP A;  4DWS B;  2XP9 A;  4ODQ A;  4TW6 A;  5CQ2 A;  2ETN A;  2PV2 A;  4R5E A;  3W4R A;  2KE0 A;  3B7X A;  4JFI A;  1R9H A;  2DT0 A;  4MNM A;  1ZB5 A;  4WKA A;  5GPG A;  3FXY A;  2DG4 A;  5HTG A;  5D75 A;  3RME A;  3FS8 A;  1FKT A;  3ARZ A;  3RM4 A;  3AS2 A;  3O5P A;  4LGX A;  2RSE A;  1FJD A;  1TK7 A;  2WK2 A;  1NMV A;  5E5W A;  1EHN A;  3LE4 A;  5HW8 A;  1NWT A;  2AOS A;  2RUD A;  1RP5 A;  3KAH A;  3ARV A;  5DO2 A;  4Q7N A;  1VF8 A;  2DT1 A;  3ART A;  1Y0O A;  2WAD A;  4G50 A;  2M1I A;  3WL0 A;  1O6W A;  3JXV A;  4J4N A;  1BKF A;  4W5U A;  2YSG A;  2XP3 A;  4DIP A;  1ITX A;  1W9U A;  3GTY X;  2OLH A;  3WD1 A;  1GPF A;  1QZ2 A;  3WD4 A;  1EQ3 A;  1KT1 A;  2XPA A;  2XP5 A;  4WK9 A;  1N1A A;  3KAC A;  3ARQ A;  4WKF A;  5DF0 A;  4JFM A;  2L4J A;  1FKK A;  1FKI A;  4PTM A;  3LKX A;  1E15 A;  1HKM A;  2ZQS A;  4URI A;  3L4H A;  4DRI A;  1YAT A;  2DSV A;  2KI3 A;  3CH9 A;  3M7N A;  3MQH A;  4DRN A;  4O2T A;  5E65 A;  3WQW A;  4N19 A;  1E6R A;  2RUQ A;  3O5I A;  2KXQ A;  4HBO A;  2DSZ A;  1M5Y A;  2MLZ A;  5BXJ A;  4DZ3 A;  5B8I C;  4FAP A;  3H9R B;  5DIT A;  1BL4 A;  3MQG A;  3KZ7 A;  4MGV A;  3WL1 A;  4ODO A;  3IKG A;  2F2D A;  2G8Z A;  2OWO A;  4MTV A;  1E6P A;  4W9O A;  1GOI A;  3KAD A;  2D9F A;  2WM0 A;  2ZR4 A;  1OGB A;  3PRA A;  2DT2 A;  1W26 A;  5HKG A;  2MNT A;  3IK8 A;  3TCZ A;  2ZR5 A;  4MNK A;  3GPK A;  3BXW A;  4L72 B;  3NTP A;  2LJ4 A;  4ZPT R;  2PN0 A;  3CZ8 A;  4DRQ A;  1WAW A;  5HW6 A;  4DWS D;  3LKX B;  3O5M A;  4KQZ A;  3ARO A;  1XRV A;  1LG1 A;  2MLY A;  5GQB A;  2KGJ A;  3B9A A;  1D7J A;  3ALF A;  4IPX A;  1LL7 A;  2WLY A;  1F8A B;  4QIB A;  2FAP A;  1EIB A;  1L1P A;  3I6C A;  2PPN A;  4TW7 A;  3AQU A;  3JYM A;  4QZV B;  4FN2 A;  3TC5 A;  4MAV A;  2N87 A;  1H0G A;  1HKI A;  4JFK A;  3VAW A;  2A3C A;  3NI6 A;  2DG9 A;  1FKR A;  1FKH A;  3AS3 A;  3GU0 A;  1HKJ A;  1X6L A;  4NNR A;  3O5J A;  1ZBW A;  2M3O W;  2M8I A;  3CHD A;  2EUL A;  1ROT A;  2JXW A;  1J6Y A;  1Q6U A;  4ML4 A;  4ODR A;  3BMB A;  2O92 A;  1FAP A;  3B9D A;  4GLX A;  4IQ2 A;  3B8S A;  3UI4 A;  1KFW A;  3WQV A;  2BA1 A;  1P5Q A;  3ARP A;  2B31 A;  5HUA A;  1D7I A;  1ROU A;  1UR9 A;  3O5L A;  2F23 A;  2FKE A;  2JZV A;  2XP4 A;  1TR8 A;  3O5F A;  4NZC A;  3O5K A;  2PPP A;  3MCB A;  1GUV A;  4Z2H A;  3TDB A;  4Z2J A;  1YW5 A;  1E6N A;  2PI6 A;  2YSI A;  4AY1 A;  1X6N A;  1B6C A;  5U47 A;  3QOK A;  4IT4 A;  1D6O A;  5HT1 A;  1W1T A;  2QRV A;  4DRH A;  4JFL A;  1FKG A;  2WLZ A;  3NRK A;  1T11 A;  3O5G A;  1EG4 A;  3ODK A;  2M08 A;  1WNO A;  1HJV A;  2LGO A;  3PR9 A;  4NSB A;  2PBC A;  1W1P A;  4A0T A;  5HWC A;  4DWS C;  4S3K A;  2F4E A;  1JVW A;  1EDQ A;  2DG3 A;  1FLC A;  2LPV A;  3KAG A;  1SR0 A;  1JMQ A;  3ARY A;  4ODN A;  4P8W A;  4LAW A;  3CGN A;  1LL4 A;  2MLX A;  1FKD A;  1JNT A;  4Q22 A;  1TCO C;  3CGM A;  5JH8 A;  2ESC A;  4JYS A;  2YSB A;  1Q6H A;  4HBE A;  2JV4 A;  3WD0 A;  3WD3 A;  4ODK A;  1ZBC A;  3ALG A;  4DWS A;  2LKN A;  5HWB A;  1NH6 A;  2L2S A;  1ZL1 A;  1WB0 A;  4XAK A;  2G41 A;  3FSB A;  3RGC A;  4L3N A;  4ZPV R;  3WD2 A;  2UZ5 A;  4WKH A;  4P8V A;  4DRO A;  1EYM A;  2DK1 A;  4W9Q A;  5DIV A;  3LUO A;  1JNS A;  2DWV A;  2XP8 A;  1K9Q A;  1CTN A;  1FKB A;  5J6E A;  3MCB B;  1NMW A;  3UQA A;  1HXV A;  1NWS A;  4LAY A;  2KO7 A;  1LL6 A;  2PV3 A;  4P8U A;  2PV1 A;  5AHT A;  1FKL A;  1W9P A;  3UI6 A;  4G2P A;  4IT6 A;  2A3A A;  2DPE A;  2O9O A;  2B5U B;  4J4O A;  1Q1C A;  4QT2 A;  4UDM A;  2MDI A;  4Z2G A;  1UR8 A;  3IHZ A;  1NWU A;  3UF8 A;  1FD9 A;  3WIJ A;  2DT3 A;  1LQ0 A;  1A7X A;  4U84 A;  2VCD A;  3AS1 A;  1SYT A;  2M8J A;  2JX8 A;  2ITK A;  1ZBK A;  1RD6 A;  1JNE A;  2A3B A;  3FAP A;  3UI5 A;  2XP6 A;  4DRP A;  2EZ5 W;  2VN1 A;  1FFQ A;  2K8I A;  2OFN A;  4Z2L A;  1K9R A;  3OA5 A;  3G6M A;  3EIP A;  1E6Z A;  4MPK A;  2M2A A;  5DEZ A;  3ARX A;  3ARR A;  4P8X A;  3PRB A;  4WJX A;  1PBK A; 
#chains in the Genus database with same CATH homology
 3OOB A;  1FKJ A;  2DSW A;  2RUR A;  4GIV A;  1OGG A;  3UQB A;  4DRK A;  4ODL A;  1D7H A;  1QPL A;  4GGQ A;  2YSF A;  4C02 B;  3CHC A;  2DK7 A;  1W1Y A;  1W9V A;  1PIN A;  4Z2K A;  1I5H W;  1W1V A;  2FDM A;  3AS0 A;  1NWR A;  1KT0 A;  3RFW A;  2RUC A;  4QT3 A;  1J4I A;  2DMV A;  2Y8N B;  1OWQ A;  2MF9 A;  4ZS6 A;  1FKF A;  4R0X A;  4A0U A;  3G6L A;  1Q6I A;  5E62 A;  3KAI A;  3PQH A;  1D2K A;  4U86 A;  3CHF A;  1ZBV A;  1FFR A;  2IUZ A;  2ZQU A;  2YSH A;  3WKZ A;  5DIU A;  5I98 A;  4ODM A;  3M85 A;  3O5D A;  4TW8 A;  1U79 A;  2A3E A;  2YBU A;  1XHG A;  4DH0 A;  2RE3 A;  4IQC A;  2ZQT A;  2XPB A;  2KFW A;  4LAX A;  2ZQV A;  1C9H A;  1JND A;  2ZAJ A;  1TFV A;  3CHE A;  2KR7 A;  2WAE A;  4JFJ A;  3RM9 A;  2AWG A;  3PRD A;  2PPO A;  5GPR A;  4DRM A;  3B9E A;  2YBT A;  2ZR6 A;  3MDY B;  1H0I A;  1HJX A;  5E66 A;  4DRJ A;  4TNS A;  4Z2I A;  2MPH A;  1HJW A;  3FSC A;  4W9P A;  4S3J A;  3CNG A;  3O5O A;  2YAJ B;  4WIW A;  1J4H A;  4E5R A;  3IKD A;  2Y78 A;  4HAR A;  1HKK A;  4REX A;  2DJY A;  3O5Q A;  4KR0 B;  1WMV A;  4DT4 A;  1LG2 A;  4ZPW R;  1ZU8 A;  1QPF A;  3FY1 A;  4ITZ A;  4MNJ A;  4U85 A;  4ODP A;  3KAF A;  4LAV A;  2QF8 A;  1NSG A;  1E9L A;  3KAB A;  2F21 A;  3WH0 A;  1IX5 A;  5HW7 A;  1LJY A;  2IF4 A;  2XP7 A;  2E45 A;  4DZ2 A;  5E64 A;  3JYJ A;  1O6I A;  3EY6 A;  2LAJ A;  1WR7 A;  1EG3 A;  4MNL A;  2Q5A A;  3KCE A;  1FKS A;  4BF8 A;  3O5R A;  2RQS A;  3PA7 A;  1F40 A;  3UQI A;  3ARU A;  1K9T A;  3ARS A;  4TX0 A;  2DSU A;  3O5E A;  1ZCN A;  1J4R A;  3ARW A;  4TYO A;  2JMF A;  1ZK6 A;  3RM8 A;  5HBF A;  4MSP A;  4DWS B;  2XP9 A;  4ODQ A;  4TW6 A;  5CQ2 A;  2PV2 A;  4R5E A;  3W4R A;  2KE0 A;  3B7X A;  4JFI A;  1R9H A;  2DT0 A;  4MNM A;  1ZB5 A;  4WKA A;  5GPG A;  3FXY A;  2DG4 A;  5HTG A;  5D75 A;  3RME A;  3FS8 A;  1FKT A;  3ARZ A;  3RM4 A;  3AS2 A;  3O5P A;  4LGX A;  2RSE A;  1FJD A;  1TK7 A;  2WK2 A;  1NMV A;  5E5W A;  1EHN A;  3LE4 A;  5HW8 A;  1NWT A;  2AOS A;  2RUD A;  1RP5 A;  3KAH A;  3ARV A;  5DO2 A;  4Q7N A;  1VF8 A;  2DT1 A;  3ART A;  1Y0O A;  2WAD A;  4G50 A;  2M1I A;  3WL0 A;  1O6W A;  3JXV A;  4J4N A;  1BKF A;  4W5U A;  2YSG A;  2XP3 A;  4DIP A;  1ITX A;  1W9U A;  2OLH A;  3WD1 A;  1GPF A;  1QZ2 A;  3WD4 A;  1EQ3 A;  1KT1 A;  2XPA A;  2XP5 A;  4WK9 A;  1N1A A;  3KAC A;  3ARQ A;  4WKF A;  5DF0 A;  4JFM A;  2L4J A;  1FKK A;  1FKI A;  4PTM A;  3LKX A;  1E15 A;  1HKM A;  2ZQS A;  4URI A;  3L4H A;  4DRI A;  1YAT A;  2DSV A;  2KI3 A;  3CH9 A;  3M7N A;  3MQH A;  4DRN A;  4O2T A;  5E65 A;  3WQW A;  4N19 A;  1E6R A;  2RUQ A;  3O5I A;  2KXQ A;  4HBO A;  2DSZ A;  1M5Y A;  2MLZ A;  5BXJ A;  4DZ3 A;  5B8I C;  4FAP A;  3H9R B;  5DIT A;  1BL4 A;  3MQG A;  3KZ7 A;  4MGV A;  3WL1 A;  4ODO A;  3IKG A;  2F2D A;  2G8Z A;  2OWO A;  4MTV A;  1E6P A;  4W9O A;  1GOI A;  3KAD A;  2D9F A;  2WM0 A;  2ZR4 A;  1OGB A;  3PRA A;  2DT2 A;  1W26 A;  5HKG A;  2MNT A;  3IK8 A;  3TCZ A;  2ZR5 A;  4MNK A;  3GPK A;  3BXW A;  4L72 B;  3NTP A;  2LJ4 A;  4ZPT R;  3CZ8 A;  4DRQ A;  1WAW A;  5HW6 A;  4DWS D;  3LKX B;  3O5M A;  4KQZ A;  3ARO A;  1XRV A;  1LG1 A;  2MLY A;  5GQB A;  2KGJ A;  3B9A A;  1D7J A;  3ALF A;  4IPX A;  1LL7 A;  2WLY A;  1F8A B;  4QIB A;  2FAP A;  1EIB A;  1L1P A;  3I6C A;  2PPN A;  4TW7 A;  3AQU A;  3JYM A;  4QZV B;  4FN2 A;  3TC5 A;  4MAV A;  2N87 A;  1H0G A;  1HKI A;  4JFK A;  3VAW A;  2A3C A;  3NI6 A;  2DG9 A;  1FKR A;  1FKH A;  3AS3 A;  1HKJ A;  1X6L A;  4NNR A;  3O5J A;  1ZBW A;  2M3O W;  2M8I A;  3CHD A;  1ROT A;  2JXW A;  1J6Y A;  1Q6U A;  4ML4 A;  4ODR A;  2O92 A;  1FAP A;  3B9D A;  4GLX A;  4IQ2 A;  3B8S A;  3UI4 A;  1KFW A;  3WQV A;  2BA1 A;  1P5Q A;  3ARP A;  2B31 A;  5HUA A;  1D7I A;  1ROU A;  1UR9 A;  3O5L A;  2FKE A;  2JZV A;  2XP4 A;  1TR8 A;  3O5F A;  4NZC A;  3O5K A;  2PPP A;  3MCB A;  1GUV A;  4Z2H A;  3TDB A;  4Z2J A;  1YW5 A;  1E6N A;  2PI6 A;  2YSI A;  4AY1 A;  1X6N A;  1B6C A;  5U47 A;  3QOK A;  4IT4 A;  1D6O A;  5HT1 A;  1W1T A;  2QRV A;  4DRH A;  4JFL A;  1FKG A;  2WLZ A;  3NRK A;  1T11 A;  3O5G A;  1EG4 A;  3ODK A;  2M08 A;  1WNO A;  1HJV A;  2LGO A;  3PR9 A;  4NSB A;  2PBC A;  1W1P A;  4A0T A;  5HWC A;  4DWS C;  4S3K A;  2F4E A;  1JVW A;  1EDQ A;  2DG3 A;  1FLC A;  2LPV A;  3KAG A;  1SR0 A;  1JMQ A;  3ARY A;  4ODN A;  4P8W A;  4LAW A;  3CGN A;  1LL4 A;  2MLX A;  1FKD A;  1JNT A;  4Q22 A;  1TCO C;  3CGM A;  5JH8 A;  2ESC A;  4JYS A;  2YSB A;  1Q6H A;  4HBE A;  2JV4 A;  3WD0 A;  3WD3 A;  4ODK A;  1ZBC A;  3ALG A;  4DWS A;  2LKN A;  5HWB A;  1NH6 A;  2L2S A;  1ZL1 A;  1WB0 A;  4XAK A;  2G41 A;  3FSB A;  3RGC A;  4L3N A;  4ZPV R;  3WD2 A;  2UZ5 A;  4WKH A;  4P8V A;  4DRO A;  1EYM A;  2DK1 A;  4W9Q A;  5DIV A;  3LUO A;  1JNS A;  2DWV A;  2XP8 A;  1K9Q A;  1CTN A;  1FKB A;  5J6E A;  3MCB B;  1NMW A;  3UQA A;  1HXV A;  1NWS A;  4LAY A;  2KO7 A;  1LL6 A;  2PV3 A;  4P8U A;  2PV1 A;  5AHT A;  1FKL A;  1W9P A;  3UI6 A;  4G2P A;  4IT6 A;  2A3A A;  2DPE A;  2O9O A;  4J4O A;  1Q1C A;  4QT2 A;  2MDI A;  4Z2G A;  1UR8 A;  3IHZ A;  1NWU A;  3UF8 A;  1FD9 A;  3WIJ A;  2DT3 A;  1LQ0 A;  1A7X A;  4U84 A;  2VCD A;  3AS1 A;  1SYT A;  2M8J A;  2JX8 A;  2ITK A;  1ZBK A;  1RD6 A;  1JNE A;  2A3B A;  3FAP A;  3UI5 A;  2XP6 A;  4DRP A;  2EZ5 W;  2VN1 A;  1FFQ A;  2K8I A;  2OFN A;  4Z2L A;  1K9R A;  3OA5 A;  3G6M A;  1E6Z A;  4MPK A;  2M2A A;  5DEZ A;  3ARX A;  3ARR A;  4P8X A;  3PRB A;  4WJX A;  1PBK A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...