3KAHA

Structure-guided design of alpha-amino acid-derived pin1 inhibitors
Total Genus 42
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
42
sequence length
157
structure length
145
Chain Sequence
b'LPPGWEKAMSRSSGRVYYFNHITNASQWERPSEPARVRCSHLLVKHSQSRRPSSWRQEKITRTKEEALELINGYIQKIKSGEEDFESLASQFSDCSSAKARGDLGAFSRGQMQKPFEDASFALRTGEMSGPVFTDSGIHIILRTE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Peptidyl-prolyl cis-trans isomerase NIMA-interacting 1
publication title Structure-guided design of alpha-amino acid-derived Pin1 inhibitors
pubmed doi rcsb
source organism Homo sapiens
molecule tags Isomerase
total genus 42
structure length 145
sequence length 157
ec nomenclature ec 5.2.1.8: Peptidylprolyl isomerase.
pdb deposition date 2009-10-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00397 WW WW domain
A PF00639 Rotamase PPIC-type PPIASE domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.20.70.10 Mainly Beta Single Sheet Ubiquitin Ligase Nedd4; Chain: W; Ubiquitin Ligase Nedd4; Chain: W; 3kahA01
3.10.50.40 Alpha Beta Roll Chitinase A; domain 3 Chitinase A; domain 3 3kahA02
4N19A 2ZQUA 4QT3A 1TK7A 5HW7A 4ITZA 2MDIA 1JNTA 1Q6UA 3KAIA 1FKKA 4TW6A 4TW7A 2N87A 3OOBA 1D7IA 1T11A 2PPOA 2Y78A 2LAJA 2M8IA 2JX8A 1Q1CA 1D7JA 1FKTA 1FKFA 4MSPA 3O5OA 1J4RA 4TX0A 3O5DA 4DRQA 4DH0A 1FD9A 3KAGA 5HWCA 3TC5A 2XP3A 1P5QA 2M2AA 4DRHA 1PINA 5AHTA 3KADA 2M8JA 4JFLA 5DITA 2XP9A 2LJ4A 3PRBA 3UQAA 1FAPA 1QZ2A 2MF9A 2XPBA 1J4HA 4JYSA 3TCZA 2XP4A 4R0XA 1FKBA 5DIUA 3ODKA 1N1AA 3L4HA 1BKFA 1C9HA 1M5YA 2AWGA 2KI3A 2YSHA 3PRDA 3TDBA 3EY6A 4W9QA 4G50A 2RUCA 2KGJA 1WMVA 1FKHA 2RURA 3O5JA 2K8IA 3B7XA 1L1PA 4LAVA 3RGCA 1HXVA 3CNGA 2M3OW 3UQIA 4JFJA 4DRNA 2DMVA 1Q6HA 4DRMA 2MLYA 3LUOA 1NMWA 3O5MA 5HW6A 2DWVA 2PV1A 4DZ2A 4J4OA 3KAHA 3IKDA 2PV3A 1EG3A 3KZ7A 2DG4A 2JV4A 4W9PA 2RUDA 4DZ3A 5GPGA 4LAWA 3VAWA 2KO7A 1FKIA 1FKGA 1Y0OA 4G2PA 3O5PA 5BXJA 4W9OA 1FKSA 4DRIA 2OFNA 2XP7A 2ZQSA 2YSIA 1D6OA 2UZ5A 4QT2A 2XPAA 2DJYA 1F40A 2YSBA 1KT0A 1FKJA 3O5FA 4DRPA 3JXVA 2DG3A 1FJDA 3CGNA 1J4IA 3KACA 2YSGA 4REXA 2YSFA 2BA1A 1ZK6A 2LKNA 3JYJA 4E5RA 4DRJA 1KT1A 1FKDA 4U84A 3RFWA 4DIPA 2Q5AA 4GIVA 3UQBA 4IPXA 2RSEA 3GPKA 2MLZA 1K9QA 1ZCNA 1EYMA 2KR7A 5HUAA 3IKGA 2DK1A 3NI6A 4JFMA 3M85A 2F4EA 4TNSA 3KCEA 4U85A 2DG9A 1R9HA 4BF8A 1NMVA 2XP5A 1NSGA 2E45A 3PA7A 1K9RA 2XP6A 2DK7A 2ZR4A 3KAFA 5HW8A 4ODNA 4GGQA 3JYMA 5HWBA 3UI6A 1FKRA 2D9FA 2F21A 4ODLA 1Q6IA 1JVWA 4LAXA 4QIBA 2M08A 2L4JA 3LE4A 1B6CA 3FAPA 3O5GA 4TW8A 1U79A 5HT1A 5I98A 4DT4A 1I5HW 4J4NA 4U86A 3UI5A 5J6EA 3O5LA 1EQ3A 3O5QA 4O2TA 2LGOA 2KXQA 3IHZA 3IK8A 1QPFA 1YW5A 2LPVA 2FAPA 2ZR6A 2F2DA 2VN1A 4ODKA 4JFIA 2RUQA 2KFWA 2IF4A 4ODQA 4ODMA 2PV2A 1A7XA 3H9RB 1WR7A 4LAYA 1O6WA 1EG4A 5D75A 2ITKA 2ZQTA 5HKGA 4NNRA 2L2SA 1BL4A 3NTPA 3NRKA 4ODRA 3KABA 2MPHA 3MDYB 1JNSA 2ZQVA 3O5RA 1W26A 2EZ5W 1FKLA 1TCOC 2JZVA 4FAPA 4TYOA 4C02B 1F8AB 1PBKA 3O5KA 2M1IA 3M7NA 4DRKA 2FKEA 2MLXA 5CQ2A 1ROUA 1ROTA 2XP8A 4IQ2A 4ODPA 5B8IC 2JMFA 1J6YA 5HTGA 2RE3A 4MGVA 3I6CA 2PPPA 3O5IA 4ODOA 2VCDA 4JFKA 2RQSA 2PBCA 2PPNA 3UF8A 3CGMA 1YATA 2ZR5A 1D7HA 2JXWA 4FN2A 4IQCA 2MNTA 2ZAJA 1QPLA 1JMQA 3UI4A 3O5EA 3WH0A 5DIVA 2KE0A 4DROA
chains in the Genus database with same CATH superfamily
4N19A 2ZQUA 4QT3A 1TK7A 5HW7A 4ITZA 2MDIA 1E6PA 3PR9A 1JNTA 1Q6UA 3KAIA 1WB0A 1FKKA 3ARUA 4TW6A 4TW7A 2N87A 3OOBA 1HJXA 1JNEA 4UDMA 2A3EA 1D7IA 4XAKA 1T11A 2WLZA 3CH9A 2PPOA 3W4RA 2Y78A 2LAJA 2M8IA 2JX8A 1HKMA 1Q1CA 1D7JA 1HJVA 1FKTA 4WK9A 1FKFA 4MSPA 3O5OA 1J4RA 4TX0A 3O5DA 4DRQA 4DH0A 1FD9A 3KAGA 5HWCA 3TC5A 2XP3A 1GRJA 1P5QA 2M2AA 4DRHA 1PINA 3CHEA 1WAWA 5AHTA 1ZB5A 2B5UB 3RM9A 1FFRA 1TFVA 3KADA 3FY1A 2M8JA 4JFLA 5DITA 5DO2A 2XP9A 2LJ4A 3PRBA 3UQAA 1FAPA 3B9EA 1QZ2A 3ALGA 2DSZA 2MF9A 2XPBA 1J4HA 4JYSA 3TCZA 3ARSA 2XP4A 4WKHA 3FSCA 4R0XA 1FKBA 5DIUA 2PN0A 3ODKA 2YBUA 4ZPWR 1E15A 1N1AA 3L4HA 1BKFA 1NH6A 2Y8NB 1C9HA 1M5YA 1NWUA 2IUZA 2AWGA 2KI3A 3AQUA 2YSHA 3PRDA 3TDBA 3MCBB 3ARZA 3EY6A 4R5EA 4W9QA 4G50A 2DT2A 1JNDA 1FLCA 2RUCA 4ML4A 4NZCA 2KGJA 1WMVA 4P8WA 2F23A 1FKHA 1LQ0A 2RURA 5HBFA 3O5JA 2K8IA 3ARYA 3B7XA 1X6LA 1E9LA 1L1PA 4LAVA 2OWOA 3RGCA 3CNGA 2M3OW 1HXVA 1W1TA 3RM8A 3UQIA 3ARPA 2ESCA 4JFJA 4DRNA 3CHDA 4S3JA 1E44A 2DMVA 1Q6HA 5GPRA 2O92A 4DRMA 2MLYA 3LUOA 1NMWA 3O5MA 5HW6A 2WLYA 2DWVA 4AY1A 4Z2JA 2PV1A 4J4OA 4DZ2A 2YBTA 3KAHA 1XHGA 3IKDA 3WQWA 1UR8A 3WD4A 2PV3A 4Z2LA 1EG3A 2FDMA 3KZ7A 2DG4A 2JV4A 4W9PA 1HKIA 4URIA 2RUDA 4DZ3A 5GPGA 4LAWA 1H0IA 3WD3A 3GTYX 3GU0A 3VAWA 2KO7A 1FKIA 1FKGA 1Y0OA 4G2PA 3O5PA 5BXJA 4W9OA 4GLXA 1FKSA 4DRIA 4KQZA 2OFNA 4ZPVR 2DSWA 2XP7A 2ZQSA 4IT4A 3FS8A 1JCHB 2DSVA 2YSIA 3MQHA 1D6OA 2UZ5A 1W1YA 4WJXA 3EIPA 3QOKA 4QT2A 2XPAA 2DJYA 1LL7A 1GUVA 1F40A 2YSBA 1KT0A 1FKJA 3AS1A 1W9VA 3ARTA 3O5FA 1ZBCA 4DRPA 3ARRA 2WK2A 3JXVA 3B9AA 1E6RA 4NSBA 2DG3A 1FJDA 3CGNA 4MNKA 1J4IA 2QF8A 3CZ8A 3KACA 2YSGA 4REXA 1ITXA 2P4VA 5U47A 2YSFA 2BA1A 1ZK6A 2LKNA 3WL0A 4HBEA 3JYJA 4E5RA 4DWSD 4DRJA 3WD0A 2YAJB 1KT1A 1FKDA 4U84A 3RFWA 2A3BA 1SR0A 3WD1A 4DIPA 2Q5AA 4GIVA 3UQBA 1W9PA 4Q7NA 5E65A 4IPXA 1GPFA 3RMEA 3AS3A 2RSEA 3GPKA 2MLZA 1K9QA 2WAEA 1ZCNA 1EYMA 1HJWA 2KR7A 1LG2A 3IKGA 5HUAA 1E6ZA 2DK1A 2QRVA 3NI6A 1OWQA 3B8SA 1NWSA 4MNMA 4JFMA 3M85A 4P8UA 2F4EA 1EIBA 4TNSA 3KCEA 4U85A 4WIWA 4Z2KA 2DG9A 1ZBKA 1R9HA 4BF8A 1NMVA 2XP5A 1NSGA 2E45A 2DT1A 1NWRA 2DPEA 1SYTA 4KR0B 3PA7A 3BXWA 1K9RA 2XP6A 2DK7A 1H0GA 1ZL1A 2ZR4A 1CTNA 3KAFA 5HW8A 4ODNA 4GGQA 5E5WA 4P8VA 1KFWA 2WM0A 3JYMA 3UI6A 5DF0A 5HWBA 1FKRA 3WQVA 2D9FA 2F21A 1WNOA 4ODLA 4Z2HA 3AS2A 1Q6IA 4DWSA 1JVWA 4LAXA 4QIBA 4MAVA 2M08A 1LL4A 1EDQA 3ALFA 3B9DA 1XRVA 2L4JA 1W9UA 3LKXA 3G6LA 3LE4A 1B6CA 1K9TA 3FAPA 3O5GA 4TW8A 1U79A 2O9OA 5HT1A 5I98A 1HKKA 3MCBA 4A0TA 4LGXA 4Z2GA 1LJYA 4DT4A 1I5HW 4J4NA 1ZU8A 4MNLA 4U86A 2ETNA 3UI5A 5J6EA 3O5LA 4PTMA 1EQ3A 1W1VA 3ARVA 3O5QA 4O2TA 2LGOA 2KXQA 3IHZA 1D2KA 5E64A 3MQGA 3IK8A 2G8ZA 4HBOA 1QPFA 5DEZA 2DSUA 1EHNA 1YW5A 1IX5A 2LPVA 3FSBA 2FAPA 4L3NA 3WL1A 2ZR6A 2F2DA 2VN1A 4HARA 4ODKA 4JFIA 2RUQA 2KFWA 3WD2A 2IF4A 4WKAA 4ODQA 4MNJA 4ODMA 2DT0A 2PV2A 1A7XA 1W1PA 1WR7A 3H9RB 4S3KA 4ZS6A 4LAYA 3WIJA 3ARQA 1O6WA 1EG4A 5D75A 2ITKA 2ZQTA 2AOSA 3G6MA 1GOIA 4MPKA 5HKGA 4NNRA 1TR8A 1BL4A 3NTPA 2B31A 2L2SA 3FXYA 3NRKA 3OA5A 4ODRA 3KABA 1O6IA 1RP5A 1LL6A 2MPHA 3MDYB 5JH8A 1JNSA 2ZQVA 3O5RA 1W26A 2EZ5W 1FKLA 1TCOC 2A3AA 2JZVA 1FFQA 4DWSB 4FAPA 4TYOA 4C02B 2OLHA 4ZPTR 4W5UA 4L72B 1F8AB 2PI6A 3PRAA 1PBKA 3O5KA 3CHFA 1RD6A 2M1IA 3M7NA 3CHCA 4DRKA 3ARWA 2FKEA 2MLXA 1ZBVA 3LKXB 5CQ2A 1ROUA 4WKFA 1LG1A 1ROTA 2XP8A 4IQ2A 4ODPA 4QZVB 1OGBA 5E62A 2DT3A 5B8IC 2WADA 4A0UA 3PQHA 4P8XA 2JMFA 1J6YA 1VF8A 5HTGA 1HKJA 4DWSC 4IT6A 2A3CA 2RE3A 5E66A 4MGVA 3AS0A 1X6NA 3I6CA 2PPPA 3RM4A 3WKZA 4Q22A 3AROA 3O5IA 4ODOA 1OGGA 2VCDA 2G41A 4JFKA 5GQBA 2RQSA 1NWTA 2PBCA 2PPNA 3ARXA 3UF8A 3BMBA 3CGMA 1YATA 2ZR5A 1D7HA 2JXWA 4Z2IA 1E6NA 4FN2A 4IQCA 2MNTA 2ZAJA 1QPLA 1JMQA 1UR9A 3UI4A 1ZBWA 3WH0A 3O5EA 4MTVA 2EULA 5DIVA 2KE0A 4DROA
chains in the Genus database with same CATH topology
4N19A 2ZQUA 4QT3A 1TK7A 5HW7A 4ITZA 2MDIA 1E6PA 3PR9A 1JNTA 1Q6UA 3KAIA 1WB0A 1FKKA 3ARUA 4TW6A 4TW7A 2N87A 3OOBA 1HJXA 1JNEA 2A3EA 1D7IA 4XAKA 1T11A 2WLZA 3CH9A 2PPOA 3W4RA 2Y78A 2LAJA 2M8IA 2JX8A 1HKMA 1Q1CA 1D7JA 1HJVA 1FKTA 4WK9A 1FKFA 4MSPA 3O5OA 1J4RA 4TX0A 3O5DA 4DRQA 4DH0A 1FD9A 3KAGA 5HWCA 3TC5A 2XP3A 1P5QA 2M2AA 4DRHA 1PINA 3CHEA 1WAWA 5AHTA 1ZB5A 3RM9A 1FFRA 1TFVA 3KADA 3FY1A 2M8JA 4JFLA 5DITA 5DO2A 2XP9A 2LJ4A 3PRBA 3UQAA 1FAPA 3B9EA 1QZ2A 3ALGA 2DSZA 2MF9A 2XPBA 1J4HA 4JYSA 3TCZA 3ARSA 2XP4A 4WKHA 3FSCA 4R0XA 1FKBA 5DIUA 3ODKA 2YBUA 4ZPWR 1E15A 1N1AA 3L4HA 1BKFA 1NH6A 2Y8NB 1C9HA 1M5YA 1NWUA 2IUZA 2AWGA 2KI3A 3AQUA 2YSHA 3PRDA 3TDBA 3MCBB 3ARZA 3EY6A 4R5EA 4W9QA 4G50A 2DT2A 1JNDA 1FLCA 2RUCA 4ML4A 4NZCA 2KGJA 1WMVA 4P8WA 1FKHA 1LQ0A 2RURA 5HBFA 3O5JA 2K8IA 3ARYA 3B7XA 1X6LA 1E9LA 1L1PA 4LAVA 2OWOA 3RGCA 3CNGA 2M3OW 1HXVA 1W1TA 3RM8A 3UQIA 3ARPA 2ESCA 4JFJA 4DRNA 3CHDA 4S3JA 2DMVA 1Q6HA 5GPRA 2O92A 4DRMA 2MLYA 3LUOA 1NMWA 3O5MA 5HW6A 2WLYA 2DWVA 4AY1A 4Z2JA 2PV1A 4J4OA 4DZ2A 2YBTA 3KAHA 1XHGA 3IKDA 3WQWA 1UR8A 3WD4A 2PV3A 4Z2LA 1EG3A 2FDMA 3KZ7A 2DG4A 2JV4A 4W9PA 1HKIA 4URIA 2RUDA 4DZ3A 5GPGA 4LAWA 1H0IA 3WD3A 3VAWA 2KO7A 1FKIA 1FKGA 1Y0OA 4G2PA 3O5PA 5BXJA 4W9OA 4GLXA 1FKSA 4DRIA 4KQZA 2OFNA 4ZPVR 2DSWA 2XP7A 2ZQSA 4IT4A 3FS8A 2DSVA 2YSIA 3MQHA 1D6OA 2UZ5A 1W1YA 4WJXA 3QOKA 4QT2A 2XPAA 2DJYA 1LL7A 1GUVA 1F40A 2YSBA 1KT0A 1FKJA 3AS1A 1W9VA 3ARTA 3O5FA 1ZBCA 4DRPA 3ARRA 2WK2A 3JXVA 3B9AA 1E6RA 4NSBA 2DG3A 1FJDA 3CGNA 4MNKA 1J4IA 2QF8A 3CZ8A 3KACA 2YSGA 4REXA 1ITXA 5U47A 2YSFA 2BA1A 1ZK6A 2LKNA 3WL0A 4HBEA 3JYJA 4E5RA 4DWSD 4DRJA 3WD0A 2YAJB 1KT1A 1FKDA 4U84A 3RFWA 2A3BA 1SR0A 3WD1A 4DIPA 2Q5AA 4GIVA 3UQBA 1W9PA 4Q7NA 5E65A 4IPXA 1GPFA 3RMEA 3AS3A 2RSEA 3GPKA 2MLZA 1K9QA 2WAEA 1ZCNA 1EYMA 1HJWA 2KR7A 1LG2A 3IKGA 5HUAA 1E6ZA 2DK1A 2QRVA 3NI6A 1OWQA 3B8SA 1NWSA 4MNMA 4JFMA 3M85A 4P8UA 2F4EA 1EIBA 4TNSA 3KCEA 4U85A 4WIWA 4Z2KA 2DG9A 1ZBKA 1R9HA 4BF8A 1NMVA 2XP5A 1NSGA 2E45A 2DT1A 1NWRA 2DPEA 1SYTA 4KR0B 3PA7A 3BXWA 1K9RA 2XP6A 2DK7A 1H0GA 1ZL1A 2ZR4A 1CTNA 3KAFA 5HW8A 4ODNA 4GGQA 5E5WA 4P8VA 1KFWA 2WM0A 3JYMA 3UI6A 5DF0A 5HWBA 1FKRA 3WQVA 2D9FA 2F21A 1WNOA 4ODLA 4Z2HA 3AS2A 1Q6IA 4DWSA 1JVWA 4LAXA 4QIBA 4MAVA 2M08A 1LL4A 1EDQA 3ALFA 3B9DA 1XRVA 2L4JA 1W9UA 3LKXA 3G6LA 3LE4A 1B6CA 1K9TA 3FAPA 3O5GA 4TW8A 1U79A 2O9OA 5HT1A 5I98A 1HKKA 3MCBA 4A0TA 4LGXA 4Z2GA 1LJYA 4DT4A 1I5HW 4J4NA 1ZU8A 4MNLA 4U86A 3UI5A 5J6EA 3O5LA 4PTMA 1EQ3A 1W1VA 3ARVA 3O5QA 4O2TA 2LGOA 2KXQA 3IHZA 1D2KA 5E64A 3MQGA 3IK8A 2G8ZA 4HBOA 1QPFA 5DEZA 2DSUA 1EHNA 1YW5A 1IX5A 2LPVA 3FSBA 2FAPA 4L3NA 3WL1A 2ZR6A 2F2DA 2VN1A 4HARA 4ODKA 4JFIA 2RUQA 2KFWA 3WD2A 2IF4A 4WKAA 4ODQA 4MNJA 4ODMA 2DT0A 2PV2A 1A7XA 1W1PA 1WR7A 3H9RB 4S3KA 4ZS6A 4LAYA 3WIJA 3ARQA 1O6WA 1EG4A 5D75A 2ITKA 2ZQTA 2AOSA 3G6MA 1GOIA 4MPKA 5HKGA 4NNRA 1TR8A 1BL4A 3NTPA 2B31A 2L2SA 3FXYA 3NRKA 3OA5A 4ODRA 3KABA 1O6IA 1RP5A 1LL6A 2MPHA 3MDYB 5JH8A 1JNSA 2ZQVA 3O5RA 1W26A 2EZ5W 1FKLA 1TCOC 2A3AA 2JZVA 1FFQA 4DWSB 4FAPA 4TYOA 4C02B 2OLHA 4ZPTR 4W5UA 4L72B 1F8AB 2PI6A 3PRAA 1PBKA 3O5KA 3CHFA 1RD6A 2M1IA 3M7NA 3CHCA 4DRKA 3ARWA 2FKEA 2MLXA 1ZBVA 3LKXB 5CQ2A 1ROUA 4WKFA 1LG1A 1ROTA 2XP8A 4IQ2A 4ODPA 4QZVB 1OGBA 5E62A 2DT3A 5B8IC 2WADA 4A0UA 3PQHA 4P8XA 2JMFA 1J6YA 1VF8A 5HTGA 1HKJA 4DWSC 4IT6A 2A3CA 2RE3A 5E66A 4MGVA 3AS0A 1X6NA 3I6CA 2PPPA 3RM4A 3WKZA 4Q22A 3AROA 3O5IA 4ODOA 1OGGA 2VCDA 2G41A 4JFKA 5GQBA 2RQSA 1NWTA 2PBCA 2PPNA 3ARXA 3UF8A 3CGMA 1YATA 2ZR5A 1D7HA 2JXWA 4Z2IA 1E6NA 4FN2A 4IQCA 2MNTA 2ZAJA 1QPLA 1JMQA 1UR9A 3UI4A 1ZBWA 3WH0A 3O5EA 4MTVA 5DIVA 2KE0A 4DROA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4N19 A;  2ZQU A;  4QT3 A;  1TK7 A;  5HW7 A;  4ITZ A;  2MDI A;  1JNT A;  1Q6U A;  3KAI A;  1FKK A;  4TW6 A;  4TW7 A;  2N87 A;  3OOB A;  1D7I A;  1T11 A;  2PPO A;  2Y78 A;  2LAJ A;  2M8I A;  2JX8 A;  1Q1C A;  1D7J A;  1FKT A;  1FKF A;  4MSP A;  3O5O A;  1J4R A;  4TX0 A;  3O5D A;  4DRQ A;  4DH0 A;  1FD9 A;  3KAG A;  5HWC A;  3TC5 A;  2XP3 A;  1P5Q A;  2M2A A;  4DRH A;  1PIN A;  5AHT A;  3KAD A;  2M8J A;  4JFL A;  5DIT A;  2XP9 A;  2LJ4 A;  3PRB A;  3UQA A;  1FAP A;  1QZ2 A;  2MF9 A;  2XPB A;  1J4H A;  4JYS A;  3TCZ A;  2XP4 A;  4R0X A;  1FKB A;  5DIU A;  3ODK A;  1N1A A;  3L4H A;  1BKF A;  1C9H A;  1M5Y A;  2AWG A;  2KI3 A;  2YSH A;  3PRD A;  3TDB A;  3EY6 A;  4W9Q A;  4G50 A;  2RUC A;  2KGJ A;  1WMV A;  1FKH A;  2RUR A;  3O5J A;  2K8I A;  3B7X A;  1L1P A;  4LAV A;  3RGC A;  1HXV A;  3CNG A;  2M3O W;  3UQI A;  4JFJ A;  4DRN A;  2DMV A;  1Q6H A;  4DRM A;  2MLY A;  3LUO A;  1NMW A;  3O5M A;  5HW6 A;  2DWV A;  2PV1 A;  4DZ2 A;  4J4O A;  3KAH A;  3IKD A;  2PV3 A;  1EG3 A;  3KZ7 A;  2DG4 A;  2JV4 A;  4W9P A;  2RUD A;  4DZ3 A;  5GPG A;  4LAW A;  3VAW A;  2KO7 A;  1FKI A;  1FKG A;  1Y0O A;  4G2P A;  3O5P A;  5BXJ A;  4W9O A;  1FKS A;  4DRI A;  2OFN A;  2XP7 A;  2ZQS A;  2YSI A;  1D6O A;  2UZ5 A;  4QT2 A;  2XPA A;  2DJY A;  1F40 A;  2YSB A;  1KT0 A;  1FKJ A;  3O5F A;  4DRP A;  3JXV A;  2DG3 A;  1FJD A;  3CGN A;  1J4I A;  3KAC A;  2YSG A;  4REX A;  2YSF A;  2BA1 A;  1ZK6 A;  2LKN A;  3JYJ A;  4E5R A;  4DRJ A;  1KT1 A;  1FKD A;  4U84 A;  3RFW A;  4DIP A;  2Q5A A;  4GIV A;  3UQB A;  4IPX A;  2RSE A;  3GPK A;  2MLZ A;  1K9Q A;  1ZCN A;  1EYM A;  2KR7 A;  5HUA A;  3IKG A;  2DK1 A;  3NI6 A;  4JFM A;  3M85 A;  2F4E A;  4TNS A;  3KCE A;  4U85 A;  2DG9 A;  1R9H A;  4BF8 A;  1NMV A;  2XP5 A;  1NSG A;  2E45 A;  3PA7 A;  1K9R A;  2XP6 A;  2DK7 A;  2ZR4 A;  3KAF A;  5HW8 A;  4ODN A;  4GGQ A;  3JYM A;  5HWB A;  3UI6 A;  1FKR A;  2D9F A;  2F21 A;  4ODL A;  1Q6I A;  1JVW A;  4LAX A;  4QIB A;  2M08 A;  2L4J A;  3LE4 A;  1B6C A;  3FAP A;  3O5G A;  4TW8 A;  1U79 A;  5HT1 A;  5I98 A;  4DT4 A;  1I5H W;  4J4N A;  4U86 A;  3UI5 A;  5J6E A;  3O5L A;  1EQ3 A;  3O5Q A;  4O2T A;  2LGO A;  2KXQ A;  3IHZ A;  3IK8 A;  1QPF A;  1YW5 A;  2LPV A;  2FAP A;  2ZR6 A;  2F2D A;  2VN1 A;  4ODK A;  4JFI A;  2RUQ A;  2KFW A;  2IF4 A;  4ODQ A;  4ODM A;  2PV2 A;  1A7X A;  3H9R B;  1WR7 A;  4LAY A;  1O6W A;  1EG4 A;  5D75 A;  2ITK A;  2ZQT A;  5HKG A;  4NNR A;  2L2S A;  1BL4 A;  3NTP A;  3NRK A;  4ODR A;  3KAB A;  2MPH A;  3MDY B;  1JNS A;  2ZQV A;  3O5R A;  1W26 A;  2EZ5 W;  1FKL A;  1TCO C;  2JZV A;  4FAP A;  4TYO A;  4C02 B;  1F8A B;  1PBK A;  3O5K A;  2M1I A;  3M7N A;  4DRK A;  2FKE A;  2MLX A;  5CQ2 A;  1ROU A;  1ROT A;  2XP8 A;  4IQ2 A;  4ODP A;  5B8I C;  2JMF A;  1J6Y A;  5HTG A;  2RE3 A;  4MGV A;  3I6C A;  2PPP A;  3O5I A;  4ODO A;  2VCD A;  4JFK A;  2RQS A;  2PBC A;  2PPN A;  3UF8 A;  3CGM A;  1YAT A;  2ZR5 A;  1D7H A;  2JXW A;  4FN2 A;  4IQC A;  2MNT A;  2ZAJ A;  1QPL A;  1JMQ A;  3UI4 A;  3O5E A;  3WH0 A;  5DIV A;  2KE0 A;  4DRO A; 
#chains in the Genus database with same CATH topology
 4N19 A;  2ZQU A;  4QT3 A;  1TK7 A;  5HW7 A;  4ITZ A;  2MDI A;  1E6P A;  3PR9 A;  1JNT A;  1Q6U A;  3KAI A;  1WB0 A;  1FKK A;  3ARU A;  4TW6 A;  4TW7 A;  2N87 A;  3OOB A;  1HJX A;  1JNE A;  4UDM A;  2A3E A;  1D7I A;  4XAK A;  1T11 A;  2WLZ A;  3CH9 A;  2PPO A;  3W4R A;  2Y78 A;  2LAJ A;  2M8I A;  2JX8 A;  1HKM A;  1Q1C A;  1D7J A;  1HJV A;  1FKT A;  4WK9 A;  1FKF A;  4MSP A;  3O5O A;  1J4R A;  4TX0 A;  3O5D A;  4DRQ A;  4DH0 A;  1FD9 A;  3KAG A;  5HWC A;  3TC5 A;  2XP3 A;  1GRJ A;  1P5Q A;  2M2A A;  4DRH A;  1PIN A;  3CHE A;  1WAW A;  5AHT A;  1ZB5 A;  2B5U B;  3RM9 A;  1FFR A;  1TFV A;  3KAD A;  3FY1 A;  2M8J A;  4JFL A;  5DIT A;  5DO2 A;  2XP9 A;  2LJ4 A;  3PRB A;  3UQA A;  1FAP A;  3B9E A;  1QZ2 A;  3ALG A;  2DSZ A;  2MF9 A;  2XPB A;  1J4H A;  4JYS A;  3TCZ A;  3ARS A;  2XP4 A;  4WKH A;  3FSC A;  4R0X A;  1FKB A;  5DIU A;  2PN0 A;  3ODK A;  2YBU A;  4ZPW R;  1E15 A;  1N1A A;  3L4H A;  1BKF A;  1NH6 A;  2Y8N B;  1C9H A;  1M5Y A;  1NWU A;  2IUZ A;  2AWG A;  2KI3 A;  3AQU A;  2YSH A;  3PRD A;  3TDB A;  3MCB B;  3ARZ A;  3EY6 A;  4R5E A;  4W9Q A;  4G50 A;  2DT2 A;  1JND A;  1FLC A;  2RUC A;  4ML4 A;  4NZC A;  2KGJ A;  1WMV A;  4P8W A;  2F23 A;  1FKH A;  1LQ0 A;  2RUR A;  5HBF A;  3O5J A;  2K8I A;  3ARY A;  3B7X A;  1X6L A;  1E9L A;  1L1P A;  4LAV A;  2OWO A;  3RGC A;  3CNG A;  2M3O W;  1HXV A;  1W1T A;  3RM8 A;  3UQI A;  3ARP A;  2ESC A;  4JFJ A;  4DRN A;  3CHD A;  4S3J A;  1E44 A;  2DMV A;  1Q6H A;  5GPR A;  2O92 A;  4DRM A;  2MLY A;  3LUO A;  1NMW A;  3O5M A;  5HW6 A;  2WLY A;  2DWV A;  4AY1 A;  4Z2J A;  2PV1 A;  4J4O A;  4DZ2 A;  2YBT A;  3KAH A;  1XHG A;  3IKD A;  3WQW A;  1UR8 A;  3WD4 A;  2PV3 A;  4Z2L A;  1EG3 A;  2FDM A;  3KZ7 A;  2DG4 A;  2JV4 A;  4W9P A;  1HKI A;  4URI A;  2RUD A;  4DZ3 A;  5GPG A;  4LAW A;  1H0I A;  3WD3 A;  3GTY X;  3GU0 A;  3VAW A;  2KO7 A;  1FKI A;  1FKG A;  1Y0O A;  4G2P A;  3O5P A;  5BXJ A;  4W9O A;  4GLX A;  1FKS A;  4DRI A;  4KQZ A;  2OFN A;  4ZPV R;  2DSW A;  2XP7 A;  2ZQS A;  4IT4 A;  3FS8 A;  1JCH B;  2DSV A;  2YSI A;  3MQH A;  1D6O A;  2UZ5 A;  1W1Y A;  4WJX A;  3EIP A;  3QOK A;  4QT2 A;  2XPA A;  2DJY A;  1LL7 A;  1GUV A;  1F40 A;  2YSB A;  1KT0 A;  1FKJ A;  3AS1 A;  1W9V A;  3ART A;  3O5F A;  1ZBC A;  4DRP A;  3ARR A;  2WK2 A;  3JXV A;  3B9A A;  1E6R A;  4NSB A;  2DG3 A;  1FJD A;  3CGN A;  4MNK A;  1J4I A;  2QF8 A;  3CZ8 A;  3KAC A;  2YSG A;  4REX A;  1ITX A;  2P4V A;  5U47 A;  2YSF A;  2BA1 A;  1ZK6 A;  2LKN A;  3WL0 A;  4HBE A;  3JYJ A;  4E5R A;  4DWS D;  4DRJ A;  3WD0 A;  2YAJ B;  1KT1 A;  1FKD A;  4U84 A;  3RFW A;  2A3B A;  1SR0 A;  3WD1 A;  4DIP A;  2Q5A A;  4GIV A;  3UQB A;  1W9P A;  4Q7N A;  5E65 A;  4IPX A;  1GPF A;  3RME A;  3AS3 A;  2RSE A;  3GPK A;  2MLZ A;  1K9Q A;  2WAE A;  1ZCN A;  1EYM A;  1HJW A;  2KR7 A;  1LG2 A;  3IKG A;  5HUA A;  1E6Z A;  2DK1 A;  2QRV A;  3NI6 A;  1OWQ A;  3B8S A;  1NWS A;  4MNM A;  4JFM A;  3M85 A;  4P8U A;  2F4E A;  1EIB A;  4TNS A;  3KCE A;  4U85 A;  4WIW A;  4Z2K A;  2DG9 A;  1ZBK A;  1R9H A;  4BF8 A;  1NMV A;  2XP5 A;  1NSG A;  2E45 A;  2DT1 A;  1NWR A;  2DPE A;  1SYT A;  4KR0 B;  3PA7 A;  3BXW A;  1K9R A;  2XP6 A;  2DK7 A;  1H0G A;  1ZL1 A;  2ZR4 A;  1CTN A;  3KAF A;  5HW8 A;  4ODN A;  4GGQ A;  5E5W A;  4P8V A;  1KFW A;  2WM0 A;  3JYM A;  3UI6 A;  5DF0 A;  5HWB A;  1FKR A;  3WQV A;  2D9F A;  2F21 A;  1WNO A;  4ODL A;  4Z2H A;  3AS2 A;  1Q6I A;  4DWS A;  1JVW A;  4LAX A;  4QIB A;  4MAV A;  2M08 A;  1LL4 A;  1EDQ A;  3ALF A;  3B9D A;  1XRV A;  2L4J A;  1W9U A;  3LKX A;  3G6L A;  3LE4 A;  1B6C A;  1K9T A;  3FAP A;  3O5G A;  4TW8 A;  1U79 A;  2O9O A;  5HT1 A;  5I98 A;  1HKK A;  3MCB A;  4A0T A;  4LGX A;  4Z2G A;  1LJY A;  4DT4 A;  1I5H W;  4J4N A;  1ZU8 A;  4MNL A;  4U86 A;  2ETN A;  3UI5 A;  5J6E A;  3O5L A;  4PTM A;  1EQ3 A;  1W1V A;  3ARV A;  3O5Q A;  4O2T A;  2LGO A;  2KXQ A;  3IHZ A;  1D2K A;  5E64 A;  3MQG A;  3IK8 A;  2G8Z A;  4HBO A;  1QPF A;  5DEZ A;  2DSU A;  1EHN A;  1YW5 A;  1IX5 A;  2LPV A;  3FSB A;  2FAP A;  4L3N A;  3WL1 A;  2ZR6 A;  2F2D A;  2VN1 A;  4HAR A;  4ODK A;  4JFI A;  2RUQ A;  2KFW A;  3WD2 A;  2IF4 A;  4WKA A;  4ODQ A;  4MNJ A;  4ODM A;  2DT0 A;  2PV2 A;  1A7X A;  1W1P A;  1WR7 A;  3H9R B;  4S3K A;  4ZS6 A;  4LAY A;  3WIJ A;  3ARQ A;  1O6W A;  1EG4 A;  5D75 A;  2ITK A;  2ZQT A;  2AOS A;  3G6M A;  1GOI A;  4MPK A;  5HKG A;  4NNR A;  1TR8 A;  1BL4 A;  3NTP A;  2B31 A;  2L2S A;  3FXY A;  3NRK A;  3OA5 A;  4ODR A;  3KAB A;  1O6I A;  1RP5 A;  1LL6 A;  2MPH A;  3MDY B;  5JH8 A;  1JNS A;  2ZQV A;  3O5R A;  1W26 A;  2EZ5 W;  1FKL A;  1TCO C;  2A3A A;  2JZV A;  1FFQ A;  4DWS B;  4FAP A;  4TYO A;  4C02 B;  2OLH A;  4ZPT R;  4W5U A;  4L72 B;  1F8A B;  2PI6 A;  3PRA A;  1PBK A;  3O5K A;  3CHF A;  1RD6 A;  2M1I A;  3M7N A;  3CHC A;  4DRK A;  3ARW A;  2FKE A;  2MLX A;  1ZBV A;  3LKX B;  5CQ2 A;  1ROU A;  4WKF A;  1LG1 A;  1ROT A;  2XP8 A;  4IQ2 A;  4ODP A;  4QZV B;  1OGB A;  5E62 A;  2DT3 A;  5B8I C;  2WAD A;  4A0U A;  3PQH A;  4P8X A;  2JMF A;  1J6Y A;  1VF8 A;  5HTG A;  1HKJ A;  4DWS C;  4IT6 A;  2A3C A;  2RE3 A;  5E66 A;  4MGV A;  3AS0 A;  1X6N A;  3I6C A;  2PPP A;  3RM4 A;  3WKZ A;  4Q22 A;  3ARO A;  3O5I A;  4ODO A;  1OGG A;  2VCD A;  2G41 A;  4JFK A;  5GQB A;  2RQS A;  1NWT A;  2PBC A;  2PPN A;  3ARX A;  3UF8 A;  3BMB A;  3CGM A;  1YAT A;  2ZR5 A;  1D7H A;  2JXW A;  4Z2I A;  1E6N A;  4FN2 A;  4IQC A;  2MNT A;  2ZAJ A;  1QPL A;  1JMQ A;  1UR9 A;  3UI4 A;  1ZBW A;  3WH0 A;  3O5E A;  4MTV A;  2EUL A;  5DIV A;  2KE0 A;  4DRO A; 
#chains in the Genus database with same CATH homology
 4N19 A;  2ZQU A;  4QT3 A;  1TK7 A;  5HW7 A;  4ITZ A;  2MDI A;  1E6P A;  3PR9 A;  1JNT A;  1Q6U A;  3KAI A;  1WB0 A;  1FKK A;  3ARU A;  4TW6 A;  4TW7 A;  2N87 A;  3OOB A;  1HJX A;  1JNE A;  2A3E A;  1D7I A;  4XAK A;  1T11 A;  2WLZ A;  3CH9 A;  2PPO A;  3W4R A;  2Y78 A;  2LAJ A;  2M8I A;  2JX8 A;  1HKM A;  1Q1C A;  1D7J A;  1HJV A;  1FKT A;  4WK9 A;  1FKF A;  4MSP A;  3O5O A;  1J4R A;  4TX0 A;  3O5D A;  4DRQ A;  4DH0 A;  1FD9 A;  3KAG A;  5HWC A;  3TC5 A;  2XP3 A;  1P5Q A;  2M2A A;  4DRH A;  1PIN A;  3CHE A;  1WAW A;  5AHT A;  1ZB5 A;  3RM9 A;  1FFR A;  1TFV A;  3KAD A;  3FY1 A;  2M8J A;  4JFL A;  5DIT A;  5DO2 A;  2XP9 A;  2LJ4 A;  3PRB A;  3UQA A;  1FAP A;  3B9E A;  1QZ2 A;  3ALG A;  2DSZ A;  2MF9 A;  2XPB A;  1J4H A;  4JYS A;  3TCZ A;  3ARS A;  2XP4 A;  4WKH A;  3FSC A;  4R0X A;  1FKB A;  5DIU A;  3ODK A;  2YBU A;  4ZPW R;  1E15 A;  1N1A A;  3L4H A;  1BKF A;  1NH6 A;  2Y8N B;  1C9H A;  1M5Y A;  1NWU A;  2IUZ A;  2AWG A;  2KI3 A;  3AQU A;  2YSH A;  3PRD A;  3TDB A;  3MCB B;  3ARZ A;  3EY6 A;  4R5E A;  4W9Q A;  4G50 A;  2DT2 A;  1JND A;  1FLC A;  2RUC A;  4ML4 A;  4NZC A;  2KGJ A;  1WMV A;  4P8W A;  1FKH A;  1LQ0 A;  2RUR A;  5HBF A;  3O5J A;  2K8I A;  3ARY A;  3B7X A;  1X6L A;  1E9L A;  1L1P A;  4LAV A;  2OWO A;  3RGC A;  3CNG A;  2M3O W;  1HXV A;  1W1T A;  3RM8 A;  3UQI A;  3ARP A;  2ESC A;  4JFJ A;  4DRN A;  3CHD A;  4S3J A;  2DMV A;  1Q6H A;  5GPR A;  2O92 A;  4DRM A;  2MLY A;  3LUO A;  1NMW A;  3O5M A;  5HW6 A;  2WLY A;  2DWV A;  4AY1 A;  4Z2J A;  2PV1 A;  4J4O A;  4DZ2 A;  2YBT A;  3KAH A;  1XHG A;  3IKD A;  3WQW A;  1UR8 A;  3WD4 A;  2PV3 A;  4Z2L A;  1EG3 A;  2FDM A;  3KZ7 A;  2DG4 A;  2JV4 A;  4W9P A;  1HKI A;  4URI A;  2RUD A;  4DZ3 A;  5GPG A;  4LAW A;  1H0I A;  3WD3 A;  3VAW A;  2KO7 A;  1FKI A;  1FKG A;  1Y0O A;  4G2P A;  3O5P A;  5BXJ A;  4W9O A;  4GLX A;  1FKS A;  4DRI A;  4KQZ A;  2OFN A;  4ZPV R;  2DSW A;  2XP7 A;  2ZQS A;  4IT4 A;  3FS8 A;  2DSV A;  2YSI A;  3MQH A;  1D6O A;  2UZ5 A;  1W1Y A;  4WJX A;  3QOK A;  4QT2 A;  2XPA A;  2DJY A;  1LL7 A;  1GUV A;  1F40 A;  2YSB A;  1KT0 A;  1FKJ A;  3AS1 A;  1W9V A;  3ART A;  3O5F A;  1ZBC A;  4DRP A;  3ARR A;  2WK2 A;  3JXV A;  3B9A A;  1E6R A;  4NSB A;  2DG3 A;  1FJD A;  3CGN A;  4MNK A;  1J4I A;  2QF8 A;  3CZ8 A;  3KAC A;  2YSG A;  4REX A;  1ITX A;  5U47 A;  2YSF A;  2BA1 A;  1ZK6 A;  2LKN A;  3WL0 A;  4HBE A;  3JYJ A;  4E5R A;  4DWS D;  4DRJ A;  3WD0 A;  2YAJ B;  1KT1 A;  1FKD A;  4U84 A;  3RFW A;  2A3B A;  1SR0 A;  3WD1 A;  4DIP A;  2Q5A A;  4GIV A;  3UQB A;  1W9P A;  4Q7N A;  5E65 A;  4IPX A;  1GPF A;  3RME A;  3AS3 A;  2RSE A;  3GPK A;  2MLZ A;  1K9Q A;  2WAE A;  1ZCN A;  1EYM A;  1HJW A;  2KR7 A;  1LG2 A;  3IKG A;  5HUA A;  1E6Z A;  2DK1 A;  2QRV A;  3NI6 A;  1OWQ A;  3B8S A;  1NWS A;  4MNM A;  4JFM A;  3M85 A;  4P8U A;  2F4E A;  1EIB A;  4TNS A;  3KCE A;  4U85 A;  4WIW A;  4Z2K A;  2DG9 A;  1ZBK A;  1R9H A;  4BF8 A;  1NMV A;  2XP5 A;  1NSG A;  2E45 A;  2DT1 A;  1NWR A;  2DPE A;  1SYT A;  4KR0 B;  3PA7 A;  3BXW A;  1K9R A;  2XP6 A;  2DK7 A;  1H0G A;  1ZL1 A;  2ZR4 A;  1CTN A;  3KAF A;  5HW8 A;  4ODN A;  4GGQ A;  5E5W A;  4P8V A;  1KFW A;  2WM0 A;  3JYM A;  3UI6 A;  5DF0 A;  5HWB A;  1FKR A;  3WQV A;  2D9F A;  2F21 A;  1WNO A;  4ODL A;  4Z2H A;  3AS2 A;  1Q6I A;  4DWS A;  1JVW A;  4LAX A;  4QIB A;  4MAV A;  2M08 A;  1LL4 A;  1EDQ A;  3ALF A;  3B9D A;  1XRV A;  2L4J A;  1W9U A;  3LKX A;  3G6L A;  3LE4 A;  1B6C A;  1K9T A;  3FAP A;  3O5G A;  4TW8 A;  1U79 A;  2O9O A;  5HT1 A;  5I98 A;  1HKK A;  3MCB A;  4A0T A;  4LGX A;  4Z2G A;  1LJY A;  4DT4 A;  1I5H W;  4J4N A;  1ZU8 A;  4MNL A;  4U86 A;  3UI5 A;  5J6E A;  3O5L A;  4PTM A;  1EQ3 A;  1W1V A;  3ARV A;  3O5Q A;  4O2T A;  2LGO A;  2KXQ A;  3IHZ A;  1D2K A;  5E64 A;  3MQG A;  3IK8 A;  2G8Z A;  4HBO A;  1QPF A;  5DEZ A;  2DSU A;  1EHN A;  1YW5 A;  1IX5 A;  2LPV A;  3FSB A;  2FAP A;  4L3N A;  3WL1 A;  2ZR6 A;  2F2D A;  2VN1 A;  4HAR A;  4ODK A;  4JFI A;  2RUQ A;  2KFW A;  3WD2 A;  2IF4 A;  4WKA A;  4ODQ A;  4MNJ A;  4ODM A;  2DT0 A;  2PV2 A;  1A7X A;  1W1P A;  1WR7 A;  3H9R B;  4S3K A;  4ZS6 A;  4LAY A;  3WIJ A;  3ARQ A;  1O6W A;  1EG4 A;  5D75 A;  2ITK A;  2ZQT A;  2AOS A;  3G6M A;  1GOI A;  4MPK A;  5HKG A;  4NNR A;  1TR8 A;  1BL4 A;  3NTP A;  2B31 A;  2L2S A;  3FXY A;  3NRK A;  3OA5 A;  4ODR A;  3KAB A;  1O6I A;  1RP5 A;  1LL6 A;  2MPH A;  3MDY B;  5JH8 A;  1JNS A;  2ZQV A;  3O5R A;  1W26 A;  2EZ5 W;  1FKL A;  1TCO C;  2A3A A;  2JZV A;  1FFQ A;  4DWS B;  4FAP A;  4TYO A;  4C02 B;  2OLH A;  4ZPT R;  4W5U A;  4L72 B;  1F8A B;  2PI6 A;  3PRA A;  1PBK A;  3O5K A;  3CHF A;  1RD6 A;  2M1I A;  3M7N A;  3CHC A;  4DRK A;  3ARW A;  2FKE A;  2MLX A;  1ZBV A;  3LKX B;  5CQ2 A;  1ROU A;  4WKF A;  1LG1 A;  1ROT A;  2XP8 A;  4IQ2 A;  4ODP A;  4QZV B;  1OGB A;  5E62 A;  2DT3 A;  5B8I C;  2WAD A;  4A0U A;  3PQH A;  4P8X A;  2JMF A;  1J6Y A;  1VF8 A;  5HTG A;  1HKJ A;  4DWS C;  4IT6 A;  2A3C A;  2RE3 A;  5E66 A;  4MGV A;  3AS0 A;  1X6N A;  3I6C A;  2PPP A;  3RM4 A;  3WKZ A;  4Q22 A;  3ARO A;  3O5I A;  4ODO A;  1OGG A;  2VCD A;  2G41 A;  4JFK A;  5GQB A;  2RQS A;  1NWT A;  2PBC A;  2PPN A;  3ARX A;  3UF8 A;  3CGM A;  1YAT A;  2ZR5 A;  1D7H A;  2JXW A;  4Z2I A;  1E6N A;  4FN2 A;  4IQC A;  2MNT A;  2ZAJ A;  1QPL A;  1JMQ A;  1UR9 A;  3UI4 A;  1ZBW A;  3WH0 A;  3O5E A;  4MTV A;  5DIV A;  2KE0 A;  4DRO A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...