3KAHA

Structure-guided design of alpha-amino acid-derived pin1 inhibitors
Total Genus 42
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
42
sequence length
157
structure length
145
Chain Sequence
LPPGWEKAMSRSSGRVYYFNHITNASQWERPSEPARVRCSHLLVKHSQSRRPSSWRQEKITRTKEEALELINGYIQKIKSGEEDFESLASQFSDCSSAKARGDLGAFSRGQMQKPFEDASFALRTGEMSGPVFTDSGIHIILRTE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Isomerase
molecule keywords Peptidyl-prolyl cis-trans isomerase NIMA-interacting 1
publication title Structure-guided design of alpha-amino acid-derived Pin1 inhibitors
pubmed doi rcsb
source organism Homo sapiens
total genus 42
structure length 145
sequence length 157
ec nomenclature ec 5.2.1.8: Peptidylprolyl isomerase.
pdb deposition date 2009-10-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00397 WW WW domain
A PF00639 Rotamase PPIC-type PPIASE domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.20.70.10 Mainly Beta Single Sheet Ubiquitin Ligase Nedd4; Chain: W; Ubiquitin Ligase Nedd4; Chain: W; 3kahA01
3.10.50.40 Alpha Beta Roll Chitinase A; domain 3 Chitinase A; domain 3 3kahA02
2LPVA 2KI3A 4LAXA 2UZ5A 2ZR4A 3O5JA 4JFIA 2RE3A 3NI6A 4TW7A 5HW8A 2OFNA 2YSFA 3H9RB 2PPNA 1P5QA 1JMQA 1N1AA 4LAYA 1C9HA 2VN1A 4W9QA 2XPBA 1FKBA 2KFWA 4O2TA 1EG4A 5HTGA 2FKEA 4W9PA 1JNTA 1L1PA 2ZQVA 3I6CA 1YW5A 1A7XA 3UQIA 2IF4A 3LE4A 4J4NA 2XP9A 1NMWA 4DIPA 3TC5A 4DRKA 2XP8A 4W9OA 1K9RA 1J6YA 2KR7A 2RUCA 2XPAA 2XP5A 3OOBA 1U79A 3PRDA 3VAWA 3TDBA 4GGQA 1WR7A 1NSGA 2MPHA 4DRIA 2PV2A 3CGMA 2LAJA 2Q5AA 1Q6UA 2E45A 1PBKA 4MSPA 3UI4A 3IK8A 2M2AA 2MLXA 3IKGA 4IQ2A 2DK7A 1FKDA 1FKLA 2DG9A 2KE0A 4ODNA 2JV4A 4QT3A 2DMVA 2DG3A 2KO7A 1ZK6A 4ODRA 3M7NA 1B6CA 4JYSA 3O5LA 1QPFA 1FJDA 2ZQTA 1Q6IA 2F2DA 2YSGA 5AHTA 2MLYA 3IHZA 1YATA 2KXQA 2MLZA 4BF8A 1PINA 4QIBA 5J6EA 2XP6A 2YSHA 1I5HW 5DITA 1FKTA 4ITZA 4FAPA 4E5RA 2EZ5W 1FKKA 4QT2A 3O5GA 1D7IA 5B8IC 1QZ2A 2L2SA 2PBCA 2N87A 1M5YA 2MF9A 3RFWA 3O5RA 2JXWA 4LAVA 1BL4A 3CNGA 4REXA 2PPPA 3KAGA 1FKHA 1KT1A 2XP3A 1FAPA 1ROUA 2JMFA 2RSEA 4N19A 3NTPA 1HXVA 3UI6A 2YSBA 4J4OA 5DIUA 4G50A 5HW6A 1FKRA 1FKIA 2ITKA 3FAPA 3GPKA 1FKFA 2K8IA 1ZCNA 4NNRA 4GIVA 2ZR5A 3KAIA 2Y78A 3O5DA 1F40A 2F21A 5HT1A 2RUDA 2PV1A 4DRJA 3KCEA 1Y0OA 1ROTA 2M3OW 1Q1CA 2D9FA 4DT4A 2YSIA 4DZ3A 4ODKA 5HW7A 1TK7A 2LGOA 3O5MA 1FD9A 1BKFA 2L4JA 4DRNA 3JYMA 1EYMA 4R0XA 1W26A 2DWVA 2KGJA 3ODKA 1D7HA 3KADA 2PPOA 4TNSA 4U84A 1Q6HA 3RGCA 4JFLA 1QPLA 4DROA 4IQCA 3O5OA 4ODPA 5I98A 2RQSA 3UF8A 1F8AB 4JFKA 5GPGA 4TX0A 5HWBA 3PRBA 4IPXA 4FN2A 4DZ2A 1J4RA 1K9QA 3UQBA 2AWGA 4DH0A 2JZVA 2ZQSA 2RURA 3WH0A 2M8JA 4TW8A 2DK1A 1O6WA 2RUQA 2DG4A 4ODMA 4ODOA 4JFJA 1FKJA 3O5PA 3B7XA 3TCZA 3JXVA 3KAHA 1R9HA 2ZAJA 1EG3A 5HWCA 3CGNA 3JYJA 3O5EA 1FKGA 4DRHA 4DRQA 4DRPA 2LKNA 3KABA 3O5FA 4ODLA 2DJYA 3O5KA 2ZR6A 5CQ2A 1NMVA 1KT0A 2XP4A 4C02B 5HKGA 3KACA 2VCDA 3UQAA 3KZ7A 4U86A 1J4IA 2F4EA 1J4HA 3IKDA 1D7JA 3L4HA 4LAWA 2MNTA 4DRMA 3PA7A 4TYOA 5D75A 4U85A 3O5QA 2XP7A 3NRKA 2ZQUA 2FAPA 2MDIA 2M1IA 1D6OA 3LUOA 1EQ3A 3M85A 1FKSA 1T11A 1WMVA 1JNSA 4JFMA 2M8IA 5DIVA 3MDYB 4ODQA 1TCOC 3EY6A 2BA1A 5BXJA 3KAFA 4G2PA 5HUAA 4TW6A 4MGVA 2JX8A 2LJ4A 1JVWA 3UI5A 2M08A 3O5IA 2PV3A
chains in the Genus database with same CATH superfamily
4WK9A 1NWSA 2LPVA 3AS2A 2KI3A 1E6NA 4LAXA 1HKJA 4AY1A 2DT2A 1JNDA 1KFWA 2UZ5A 2ZR4A 3O5JA 4JFIA 2RE3A 3NI6A 1RD6A 4TW7A 5HW8A 3LKXA 4ZPVR 2OFNA 2YSFA 3CHEA 2A3EA 3H9RB 2PPNA 4MAVA 1P5QA 5DEZA 4Q7NA 3RM8A 1JMQA 1N1AA 1SR0A 4LAYA 1C9HA 2AOSA 2VN1A 2IUZA 1LQ0A 3ARXA 4W9QA 3ARWA 1UR9A 1H0IA 2XPBA 1FKBA 2DSZA 2KFWA 4WJXA 4LGXA 1NH6A 1ZBWA 4O2TA 5E5WA 2PI6A 1EG4A 5HTGA 2DPEA 3GU0A 2A3CA 2FKEA 4MNLA 4W9PA 1JNTA 1L1PA 4Z2KA 3FSBA 2QF8A 2WM0A 2ZQVA 3I6CA 3RMEA 2WLYA 1YW5A 1A7XA 1LG1A 2WAEA 3UQIA 2IF4A 3LE4A 4J4NA 4KQZA 4WKHA 2XP9A 1NMWA 4DIPA 3TC5A 4DRKA 2XP8A 5GQBA 4W9OA 3AS1A 1K9RA 3ARSA 1RP5A 3AQUA 1J6YA 2KR7A 2RUCA 2XPAA 1W9UA 4URIA 2XP5A 3OOBA 1U79A 3PRDA 3VAWA 3TDBA 4GGQA 1WR7A 3W4RA 1NSGA 2MPHA 4DRIA 2PV2A 3CGMA 4P8WA 1ITXA 2LAJA 4GLXA 2Q5AA 1Q6UA 2E45A 1LL4A 4KR0B 1PBKA 4MSPA 1E6RA 3UI4A 1EHNA 1ZBKA 3IK8A 2M2AA 2MLXA 3IKGA 4IQ2A 1SYTA 2DK7A 1FKDA 1FKLA 4MNJA 2DG9A 1UR8A 2KE0A 2O92A 4ODNA 2JV4A 1E15A 4QT3A 2DMVA 1K9TA 2DG3A 3WD4A 2KO7A 1ZK6A 1GPFA 3B8SA 4MTVA 5GPRA 1D2KA 1NWUA 1W1YA 3M7NA 1B6CA 4ODRA 4JYSA 5DO2A 3O5LA 2YBUA 1QPFA 4HBEA 3ARYA 1FJDA 2DSVA 2ZQTA 1Q6IA 2EULA 2WADA 3WD3A 2F2DA 2YSGA 5AHTA 2MLYA 3IHZA 1YATA 2KXQA 2MLZA 3RM9A 4BF8A 1PINA 4QIBA 3FXYA 5E65A 4ZPWR 5J6EA 4ZS6A 2XP6A 2G41A 3CHCA 2YSHA 1I5HW 5DITA 1FKTA 4ITZA 4FAPA 4Z2GA 4E5RA 2EZ5W 1FKKA 3GTYX 4QT2A 2A3BA 3O5GA 4XAKA 2P4VA 1D7IA 5B8IC 1QZ2A 1O6IA 1OGBA 2L2SA 2PBCA 1ZBVA 2N87A 1M5YA 2MF9A 3RFWA 3O5RA 3ARZA 1X6NA 2JXWA 4LAVA 1BL4A 3CNGA 4REXA 1OGGA 2PPPA 3ARPA 4P8XA 3KAGA 1FKHA 1KT1A 2XP3A 1FAPA 1ROUA 2JMFA 2RSEA 2YAJB 3B9EA 1EIBA 5E66A 2OWOA 4N19A 3NTPA 4S3JA 1HXVA 3UI6A 2YSBA 4J4OA 5DIUA 4Z2HA 2B5UB 4G50A 3WL0A 5HW6A 5U47A 1FKRA 1LL6A 1FKIA 2ITKA 3FAPA 3AROA 3GPKA 3B9DA 1FKFA 4IT4A 2K8IA 2OLHA 1ZCNA 3ARQA 1EDQA 4NNRA 3PR9A 4GIVA 2ZR5A 1E44A 3KAIA 2Y78A 2ETNA 3CHFA 1X6LA 3O5DA 3LKXB 2FDMA 4HARA 1F40A 1HKKA 2F21A 3WIJA 1JCHB 5HT1A 4S3KA 2RUDA 2PV1A 4DRJA 3KCEA 1Y0OA 4MPKA 1ROTA 2M3OW 1GUVA 2DSWA 1Q1CA 2D9FA 3WKZA 4DT4A 2YSIA 4DZ3A 4ODKA 3MQHA 1HKMA 5HW7A 4WIWA 1TK7A 2LGOA 3O5MA 1FD9A 4DWSA 1BKFA 2L4JA 3FSCA 4DRNA 3JYMA 3MCBA 1EYMA 4R0XA 1W26A 2DWVA 2KGJA 1H0GA 5E64A 4DWSD 3ODKA 1D7HA 1OWQA 3B9AA 3KADA 2PPOA 4TNSA 3WD0A 4U84A 1HJXA 4Z2IA 1Q6HA 3RGCA 4A0TA 4P8UA 4JFLA 1QPLA 4DROA 3ARTA 4IQCA 3O5OA 4ODPA 1TFVA 5I98A 2RQSA 3UF8A 1HKIA 2Y8NB 1F8AB 5E62A 3AS0A 4JFKA 5GPGA 4TX0A 5HWBA 3PRBA 2DT1A 3G6LA 4IPXA 2DT0A 4FN2A 3WQVA 1FFRA 3ARRA 2G8ZA 4DZ2A 1J4RA 1K9QA 3UQBA 2AWGA 1ZU8A 4DH0A 2JZVA 2ZQSA 2RURA 3WH0A 3G6MA 2PN0A 2YBTA 5JH8A 2M8JA 4TW8A 2ESCA 3CZ8A 2DK1A 1FLCA 1ZB5A 3WD1A 1O6WA 2RUQA 2DG4A 3BMBA 4ODMA 2A3AA 4ODOA 1W1TA 4JFJA 1FKJA 3O5PA 4W5UA 3TCZA 3B7XA 3ALFA 1HJVA 2DT3A 4R5EA 3JXVA 4IT6A 4QZVB 4MNKA 1VF8A 2F23A 3KAHA 1R9HA 4Z2JA 2ZAJA 1EG3A 5HWCA 3AS3A 1GOIA 3CGNA 2WK2A 4NSBA 3JYJA 3CH9A 3O5EA 1NWRA 4P8VA 1FKGA 1WNOA 4Q22A 4ZPTR 1W1VA 1E6ZA 4DWSC 3ALGA 4DRHA 4DRQA 4DRPA 2LKNA 3KABA 3CHDA 3FY1A 3O5FA 4ODLA 2DJYA 3O5KA 2ZR6A 4PTMA 5CQ2A 1W1PA 1NMVA 1KT0A 1W9VA 2XP4A 4C02B 4UDMA 4WKFA 2B31A 1JNEA 3MQGA 5HKGA 3KACA 5HBFA 2VCDA 1ZL1A 3EIPA 3UQAA 1XHGA 1CTNA 3FS8A 3KZ7A 4U86A 1J4IA 2F4EA 1J4HA 3IKDA 1D7JA 4L72B 4ML4A 3L4HA 4LAWA 1W9PA 2MNTA 1GRJA 1E9LA 4DRMA 3PQHA 1E6PA 4A0UA 1WAWA 3PA7A 4TYOA 1TR8A 1XRVA 4L3NA 3PRAA 5D75A 4U85A 3O5QA 2XP7A 3NRKA 2ZQUA 2FAPA 2MDIA 2M1IA 1D6OA 2DSUA 3LUOA 1EQ3A 3M85A 1FKSA 1T11A 3ARVA 3RM4A 4Z2LA 4MNMA 2O9OA 3BXWA 1WMVA 1LL7A 1LG2A 3WQWA 1JNSA 2QRVA 4JFMA 1NWTA 2M8IA 5DF0A 5DIVA 3MDYB 4HBOA 1FFQA 4ODQA 1TCOC 3EY6A 3QOKA 2BA1A 1ZBCA 3ARUA 3KAFA 5BXJA 4G2PA 4NZCA 5HUAA 1HJWA 4TW6A 4MGVA 2JX8A 2LJ4A 1LJYA 1JVWA 2WLZA 3UI5A 3OA5A 3WD2A 2M08A 4DWSB 3O5IA 4WKAA 2PV3A 3MCBB 1WB0A 3WL1A 1IX5A
chains in the Genus database with same CATH topology
4WK9A 1NWSA 2LPVA 3AS2A 2KI3A 1E6NA 4LAXA 1HKJA 4AY1A 2DT2A 1JNDA 1KFWA 2UZ5A 2ZR4A 3O5JA 4JFIA 2RE3A 3NI6A 1RD6A 4TW7A 5HW8A 3LKXA 4ZPVR 2OFNA 2YSFA 3CHEA 2A3EA 3H9RB 2PPNA 4MAVA 1P5QA 5DEZA 4Q7NA 3RM8A 1JMQA 1N1AA 1SR0A 4LAYA 1C9HA 2AOSA 2VN1A 2IUZA 1LQ0A 3ARXA 4W9QA 3ARWA 1UR9A 1H0IA 2XPBA 1FKBA 2DSZA 2KFWA 4WJXA 4LGXA 1NH6A 1ZBWA 4O2TA 5E5WA 2PI6A 1EG4A 5HTGA 2DPEA 2A3CA 2FKEA 4MNLA 4W9PA 1JNTA 1L1PA 4Z2KA 3FSBA 2QF8A 2WM0A 2ZQVA 3I6CA 3RMEA 2WLYA 1YW5A 1A7XA 1LG1A 2WAEA 3UQIA 2IF4A 3LE4A 4J4NA 4KQZA 4WKHA 2XP9A 1NMWA 4DIPA 3TC5A 4DRKA 2XP8A 5GQBA 4W9OA 3AS1A 1K9RA 3ARSA 1RP5A 3AQUA 1J6YA 2KR7A 2RUCA 2XPAA 1W9UA 4URIA 2XP5A 3OOBA 1U79A 3PRDA 3VAWA 3TDBA 4GGQA 1WR7A 3W4RA 1NSGA 2MPHA 4DRIA 2PV2A 3CGMA 4P8WA 1ITXA 2LAJA 4GLXA 2Q5AA 1Q6UA 2E45A 1LL4A 4KR0B 1PBKA 4MSPA 1E6RA 3UI4A 1EHNA 1ZBKA 3IK8A 2M2AA 2MLXA 3IKGA 4IQ2A 1SYTA 2DK7A 1FKDA 1FKLA 4MNJA 2DG9A 1UR8A 2KE0A 2O92A 4ODNA 2JV4A 1E15A 4QT3A 2DMVA 1K9TA 2DG3A 3WD4A 2KO7A 1ZK6A 1GPFA 3B8SA 4MTVA 5GPRA 1D2KA 1NWUA 1W1YA 3M7NA 1B6CA 4ODRA 4JYSA 5DO2A 3O5LA 2YBUA 1QPFA 4HBEA 3ARYA 1FJDA 2DSVA 2ZQTA 1Q6IA 2WADA 3WD3A 2F2DA 2YSGA 5AHTA 2MLYA 3IHZA 1YATA 2KXQA 2MLZA 3RM9A 4BF8A 1PINA 4QIBA 3FXYA 5E65A 4ZPWR 5J6EA 4ZS6A 2XP6A 2G41A 3CHCA 2YSHA 1I5HW 5DITA 1FKTA 4ITZA 4FAPA 4Z2GA 4E5RA 2EZ5W 1FKKA 4QT2A 2A3BA 3O5GA 4XAKA 1D7IA 5B8IC 1QZ2A 1O6IA 1OGBA 2L2SA 2PBCA 1ZBVA 2N87A 1M5YA 2MF9A 3RFWA 3O5RA 3ARZA 1X6NA 2JXWA 4LAVA 1BL4A 3CNGA 4REXA 1OGGA 2PPPA 3ARPA 4P8XA 3KAGA 1FKHA 1KT1A 2XP3A 1FAPA 1ROUA 2JMFA 2RSEA 2YAJB 3B9EA 1EIBA 5E66A 2OWOA 4N19A 3NTPA 4S3JA 1HXVA 3UI6A 2YSBA 4J4OA 5DIUA 4Z2HA 4G50A 3WL0A 5HW6A 5U47A 1FKRA 1LL6A 1FKIA 2ITKA 3FAPA 3AROA 3GPKA 3B9DA 1FKFA 4IT4A 2K8IA 2OLHA 1ZCNA 3ARQA 1EDQA 4NNRA 3PR9A 4GIVA 2ZR5A 3KAIA 2Y78A 3CHFA 3O5DA 1X6LA 3LKXB 2FDMA 4HARA 1F40A 1HKKA 2F21A 3WIJA 5HT1A 4S3KA 2RUDA 2PV1A 4DRJA 3KCEA 1Y0OA 4MPKA 1ROTA 2M3OW 1GUVA 2DSWA 1Q1CA 2D9FA 3WKZA 4DT4A 2YSIA 4DZ3A 4ODKA 3MQHA 1HKMA 5HW7A 4WIWA 1TK7A 2LGOA 3O5MA 1FD9A 4DWSA 1BKFA 2L4JA 3FSCA 4DRNA 3JYMA 3MCBA 1EYMA 4R0XA 1W26A 2DWVA 2KGJA 1H0GA 5E64A 4DWSD 3ODKA 1D7HA 1OWQA 3B9AA 3KADA 2PPOA 4TNSA 3WD0A 4U84A 1HJXA 4Z2IA 1Q6HA 3RGCA 4A0TA 4P8UA 4JFLA 1QPLA 4DROA 3ARTA 4IQCA 3O5OA 4ODPA 1TFVA 5I98A 2RQSA 3UF8A 1HKIA 2Y8NB 1F8AB 5E62A 3AS0A 4JFKA 5GPGA 4TX0A 5HWBA 3PRBA 2DT1A 3G6LA 4IPXA 2DT0A 4FN2A 3WQVA 1FFRA 3ARRA 2G8ZA 4DZ2A 1J4RA 1K9QA 3UQBA 2AWGA 1ZU8A 4DH0A 2JZVA 2ZQSA 2RURA 3WH0A 3G6MA 2YBTA 5JH8A 2M8JA 4TW8A 2ESCA 3CZ8A 2DK1A 1FLCA 1ZB5A 3WD1A 1O6WA 2RUQA 2DG4A 4ODMA 2A3AA 4ODOA 1W1TA 4JFJA 1FKJA 3O5PA 4W5UA 3TCZA 3B7XA 3ALFA 1HJVA 2DT3A 4R5EA 3JXVA 4IT6A 4QZVB 4MNKA 1VF8A 3KAHA 1R9HA 4Z2JA 2ZAJA 1EG3A 5HWCA 3AS3A 1GOIA 3CGNA 2WK2A 4NSBA 3JYJA 3CH9A 3O5EA 1NWRA 4P8VA 1FKGA 1WNOA 4Q22A 4ZPTR 1W1VA 1E6ZA 4DWSC 3ALGA 4DRHA 4DRQA 4DRPA 2LKNA 3KABA 3CHDA 3FY1A 3O5FA 4ODLA 2DJYA 3O5KA 2ZR6A 4PTMA 5CQ2A 1W1PA 1NMVA 1KT0A 1W9VA 2XP4A 4C02B 4WKFA 2B31A 1JNEA 3MQGA 5HKGA 3KACA 5HBFA 2VCDA 1ZL1A 3UQAA 1XHGA 1CTNA 3FS8A 3KZ7A 4U86A 1J4IA 2F4EA 1J4HA 3IKDA 1D7JA 4L72B 4ML4A 3L4HA 4LAWA 1W9PA 2MNTA 1E9LA 4DRMA 3PQHA 1E6PA 4A0UA 1WAWA 3PA7A 4TYOA 1TR8A 1XRVA 4L3NA 3PRAA 5D75A 4U85A 3O5QA 2XP7A 3NRKA 2ZQUA 2FAPA 2MDIA 2M1IA 1D6OA 2DSUA 3LUOA 1EQ3A 3M85A 1FKSA 1T11A 3ARVA 3RM4A 4Z2LA 4MNMA 2O9OA 3BXWA 1WMVA 1LL7A 1LG2A 3WQWA 1JNSA 2QRVA 4JFMA 1NWTA 2M8IA 5DF0A 5DIVA 3MDYB 4HBOA 1FFQA 4ODQA 1TCOC 3EY6A 3QOKA 2BA1A 1ZBCA 3ARUA 3KAFA 5BXJA 4G2PA 4NZCA 5HUAA 1HJWA 4TW6A 4MGVA 2JX8A 2LJ4A 1LJYA 1JVWA 2WLZA 3UI5A 3OA5A 3WD2A 2M08A 4DWSB 3O5IA 4WKAA 2PV3A 3MCBB 1WB0A 3WL1A 1IX5A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2LPV A;  2KI3 A;  4LAX A;  2UZ5 A;  2ZR4 A;  3O5J A;  4JFI A;  2RE3 A;  3NI6 A;  4TW7 A;  5HW8 A;  2OFN A;  2YSF A;  3H9R B;  2PPN A;  1P5Q A;  1JMQ A;  1N1A A;  4LAY A;  1C9H A;  2VN1 A;  4W9Q A;  2XPB A;  1FKB A;  2KFW A;  4O2T A;  1EG4 A;  5HTG A;  2FKE A;  4W9P A;  1JNT A;  1L1P A;  2ZQV A;  3I6C A;  1YW5 A;  1A7X A;  3UQI A;  2IF4 A;  3LE4 A;  4J4N A;  2XP9 A;  1NMW A;  4DIP A;  3TC5 A;  4DRK A;  2XP8 A;  4W9O A;  1K9R A;  1J6Y A;  2KR7 A;  2RUC A;  2XPA A;  2XP5 A;  3OOB A;  1U79 A;  3PRD A;  3VAW A;  3TDB A;  4GGQ A;  1WR7 A;  1NSG A;  2MPH A;  4DRI A;  2PV2 A;  3CGM A;  2LAJ A;  2Q5A A;  1Q6U A;  2E45 A;  1PBK A;  4MSP A;  3UI4 A;  3IK8 A;  2M2A A;  2MLX A;  3IKG A;  4IQ2 A;  2DK7 A;  1FKD A;  1FKL A;  2DG9 A;  2KE0 A;  4ODN A;  2JV4 A;  4QT3 A;  2DMV A;  2DG3 A;  2KO7 A;  1ZK6 A;  4ODR A;  3M7N A;  1B6C A;  4JYS A;  3O5L A;  1QPF A;  1FJD A;  2ZQT A;  1Q6I A;  2F2D A;  2YSG A;  5AHT A;  2MLY A;  3IHZ A;  1YAT A;  2KXQ A;  2MLZ A;  4BF8 A;  1PIN A;  4QIB A;  5J6E A;  2XP6 A;  2YSH A;  1I5H W;  5DIT A;  1FKT A;  4ITZ A;  4FAP A;  4E5R A;  2EZ5 W;  1FKK A;  4QT2 A;  3O5G A;  1D7I A;  5B8I C;  1QZ2 A;  2L2S A;  2PBC A;  2N87 A;  1M5Y A;  2MF9 A;  3RFW A;  3O5R A;  2JXW A;  4LAV A;  1BL4 A;  3CNG A;  4REX A;  2PPP A;  3KAG A;  1FKH A;  1KT1 A;  2XP3 A;  1FAP A;  1ROU A;  2JMF A;  2RSE A;  4N19 A;  3NTP A;  1HXV A;  3UI6 A;  2YSB A;  4J4O A;  5DIU A;  4G50 A;  5HW6 A;  1FKR A;  1FKI A;  2ITK A;  3FAP A;  3GPK A;  1FKF A;  2K8I A;  1ZCN A;  4NNR A;  4GIV A;  2ZR5 A;  3KAI A;  2Y78 A;  3O5D A;  1F40 A;  2F21 A;  5HT1 A;  2RUD A;  2PV1 A;  4DRJ A;  3KCE A;  1Y0O A;  1ROT A;  2M3O W;  1Q1C A;  2D9F A;  4DT4 A;  2YSI A;  4DZ3 A;  4ODK A;  5HW7 A;  1TK7 A;  2LGO A;  3O5M A;  1FD9 A;  1BKF A;  2L4J A;  4DRN A;  3JYM A;  1EYM A;  4R0X A;  1W26 A;  2DWV A;  2KGJ A;  3ODK A;  1D7H A;  3KAD A;  2PPO A;  4TNS A;  4U84 A;  1Q6H A;  3RGC A;  4JFL A;  1QPL A;  4DRO A;  4IQC A;  3O5O A;  4ODP A;  5I98 A;  2RQS A;  3UF8 A;  1F8A B;  4JFK A;  5GPG A;  4TX0 A;  5HWB A;  3PRB A;  4IPX A;  4FN2 A;  4DZ2 A;  1J4R A;  1K9Q A;  3UQB A;  2AWG A;  4DH0 A;  2JZV A;  2ZQS A;  2RUR A;  3WH0 A;  2M8J A;  4TW8 A;  2DK1 A;  1O6W A;  2RUQ A;  2DG4 A;  4ODM A;  4ODO A;  4JFJ A;  1FKJ A;  3O5P A;  3B7X A;  3TCZ A;  3JXV A;  3KAH A;  1R9H A;  2ZAJ A;  1EG3 A;  5HWC A;  3CGN A;  3JYJ A;  3O5E A;  1FKG A;  4DRH A;  4DRQ A;  4DRP A;  2LKN A;  3KAB A;  3O5F A;  4ODL A;  2DJY A;  3O5K A;  2ZR6 A;  5CQ2 A;  1NMV A;  1KT0 A;  2XP4 A;  4C02 B;  5HKG A;  3KAC A;  2VCD A;  3UQA A;  3KZ7 A;  4U86 A;  1J4I A;  2F4E A;  1J4H A;  3IKD A;  1D7J A;  3L4H A;  4LAW A;  2MNT A;  4DRM A;  3PA7 A;  4TYO A;  5D75 A;  4U85 A;  3O5Q A;  2XP7 A;  3NRK A;  2ZQU A;  2FAP A;  2MDI A;  2M1I A;  1D6O A;  3LUO A;  1EQ3 A;  3M85 A;  1FKS A;  1T11 A;  1WMV A;  1JNS A;  4JFM A;  2M8I A;  5DIV A;  3MDY B;  4ODQ A;  1TCO C;  3EY6 A;  2BA1 A;  5BXJ A;  3KAF A;  4G2P A;  5HUA A;  4TW6 A;  4MGV A;  2JX8 A;  2LJ4 A;  1JVW A;  3UI5 A;  2M08 A;  3O5I A;  2PV3 A; 
#chains in the Genus database with same CATH topology
 4WK9 A;  1NWS A;  2LPV A;  3AS2 A;  2KI3 A;  1E6N A;  4LAX A;  1HKJ A;  4AY1 A;  2DT2 A;  1JND A;  1KFW A;  2UZ5 A;  2ZR4 A;  3O5J A;  4JFI A;  2RE3 A;  3NI6 A;  1RD6 A;  4TW7 A;  5HW8 A;  3LKX A;  4ZPV R;  2OFN A;  2YSF A;  3CHE A;  2A3E A;  3H9R B;  2PPN A;  4MAV A;  1P5Q A;  5DEZ A;  4Q7N A;  3RM8 A;  1JMQ A;  1N1A A;  1SR0 A;  4LAY A;  1C9H A;  2AOS A;  2VN1 A;  2IUZ A;  1LQ0 A;  3ARX A;  4W9Q A;  3ARW A;  1UR9 A;  1H0I A;  2XPB A;  1FKB A;  2DSZ A;  2KFW A;  4WJX A;  4LGX A;  1NH6 A;  1ZBW A;  4O2T A;  5E5W A;  2PI6 A;  1EG4 A;  5HTG A;  2DPE A;  3GU0 A;  2A3C A;  2FKE A;  4MNL A;  4W9P A;  1JNT A;  1L1P A;  4Z2K A;  3FSB A;  2QF8 A;  2WM0 A;  2ZQV A;  3I6C A;  3RME A;  2WLY A;  1YW5 A;  1A7X A;  1LG1 A;  2WAE A;  3UQI A;  2IF4 A;  3LE4 A;  4J4N A;  4KQZ A;  4WKH A;  2XP9 A;  1NMW A;  4DIP A;  3TC5 A;  4DRK A;  2XP8 A;  5GQB A;  4W9O A;  3AS1 A;  1K9R A;  3ARS A;  1RP5 A;  3AQU A;  1J6Y A;  2KR7 A;  2RUC A;  2XPA A;  1W9U A;  4URI A;  2XP5 A;  3OOB A;  1U79 A;  3PRD A;  3VAW A;  3TDB A;  4GGQ A;  1WR7 A;  3W4R A;  1NSG A;  2MPH A;  4DRI A;  2PV2 A;  3CGM A;  4P8W A;  1ITX A;  2LAJ A;  4GLX A;  2Q5A A;  1Q6U A;  2E45 A;  1LL4 A;  4KR0 B;  1PBK A;  4MSP A;  1E6R A;  3UI4 A;  1EHN A;  1ZBK A;  3IK8 A;  2M2A A;  2MLX A;  3IKG A;  4IQ2 A;  1SYT A;  2DK7 A;  1FKD A;  1FKL A;  4MNJ A;  2DG9 A;  1UR8 A;  2KE0 A;  2O92 A;  4ODN A;  2JV4 A;  1E15 A;  4QT3 A;  2DMV A;  1K9T A;  2DG3 A;  3WD4 A;  2KO7 A;  1ZK6 A;  1GPF A;  3B8S A;  4MTV A;  5GPR A;  1D2K A;  1NWU A;  1W1Y A;  3M7N A;  1B6C A;  4ODR A;  4JYS A;  5DO2 A;  3O5L A;  2YBU A;  1QPF A;  4HBE A;  3ARY A;  1FJD A;  2DSV A;  2ZQT A;  1Q6I A;  2EUL A;  2WAD A;  3WD3 A;  2F2D A;  2YSG A;  5AHT A;  2MLY A;  3IHZ A;  1YAT A;  2KXQ A;  2MLZ A;  3RM9 A;  4BF8 A;  1PIN A;  4QIB A;  3FXY A;  5E65 A;  4ZPW R;  5J6E A;  4ZS6 A;  2XP6 A;  2G41 A;  3CHC A;  2YSH A;  1I5H W;  5DIT A;  1FKT A;  4ITZ A;  4FAP A;  4Z2G A;  4E5R A;  2EZ5 W;  1FKK A;  3GTY X;  4QT2 A;  2A3B A;  3O5G A;  4XAK A;  2P4V A;  1D7I A;  5B8I C;  1QZ2 A;  1O6I A;  1OGB A;  2L2S A;  2PBC A;  1ZBV A;  2N87 A;  1M5Y A;  2MF9 A;  3RFW A;  3O5R A;  3ARZ A;  1X6N A;  2JXW A;  4LAV A;  1BL4 A;  3CNG A;  4REX A;  1OGG A;  2PPP A;  3ARP A;  4P8X A;  3KAG A;  1FKH A;  1KT1 A;  2XP3 A;  1FAP A;  1ROU A;  2JMF A;  2RSE A;  2YAJ B;  3B9E A;  1EIB A;  5E66 A;  2OWO A;  4N19 A;  3NTP A;  4S3J A;  1HXV A;  3UI6 A;  2YSB A;  4J4O A;  5DIU A;  4Z2H A;  2B5U B;  4G50 A;  3WL0 A;  5HW6 A;  5U47 A;  1FKR A;  1LL6 A;  1FKI A;  2ITK A;  3FAP A;  3ARO A;  3GPK A;  3B9D A;  1FKF A;  4IT4 A;  2K8I A;  2OLH A;  1ZCN A;  3ARQ A;  1EDQ A;  4NNR A;  3PR9 A;  4GIV A;  2ZR5 A;  1E44 A;  3KAI A;  2Y78 A;  2ETN A;  3CHF A;  1X6L A;  3O5D A;  3LKX B;  2FDM A;  4HAR A;  1F40 A;  1HKK A;  2F21 A;  3WIJ A;  1JCH B;  5HT1 A;  4S3K A;  2RUD A;  2PV1 A;  4DRJ A;  3KCE A;  1Y0O A;  4MPK A;  1ROT A;  2M3O W;  1GUV A;  2DSW A;  1Q1C A;  2D9F A;  3WKZ A;  4DT4 A;  2YSI A;  4DZ3 A;  4ODK A;  3MQH A;  1HKM A;  5HW7 A;  4WIW A;  1TK7 A;  2LGO A;  3O5M A;  1FD9 A;  4DWS A;  1BKF A;  2L4J A;  3FSC A;  4DRN A;  3JYM A;  3MCB A;  1EYM A;  4R0X A;  1W26 A;  2DWV A;  2KGJ A;  1H0G A;  5E64 A;  4DWS D;  3ODK A;  1D7H A;  1OWQ A;  3B9A A;  3KAD A;  2PPO A;  4TNS A;  3WD0 A;  4U84 A;  1HJX A;  4Z2I A;  1Q6H A;  3RGC A;  4A0T A;  4P8U A;  4JFL A;  1QPL A;  4DRO A;  3ART A;  4IQC A;  3O5O A;  4ODP A;  1TFV A;  5I98 A;  2RQS A;  3UF8 A;  1HKI A;  2Y8N B;  1F8A B;  5E62 A;  3AS0 A;  4JFK A;  5GPG A;  4TX0 A;  5HWB A;  3PRB A;  2DT1 A;  3G6L A;  4IPX A;  2DT0 A;  4FN2 A;  3WQV A;  1FFR A;  3ARR A;  2G8Z A;  4DZ2 A;  1J4R A;  1K9Q A;  3UQB A;  2AWG A;  1ZU8 A;  4DH0 A;  2JZV A;  2ZQS A;  2RUR A;  3WH0 A;  3G6M A;  2PN0 A;  2YBT A;  5JH8 A;  2M8J A;  4TW8 A;  2ESC A;  3CZ8 A;  2DK1 A;  1FLC A;  1ZB5 A;  3WD1 A;  1O6W A;  2RUQ A;  2DG4 A;  3BMB A;  4ODM A;  2A3A A;  4ODO A;  1W1T A;  4JFJ A;  1FKJ A;  3O5P A;  4W5U A;  3TCZ A;  3B7X A;  3ALF A;  1HJV A;  2DT3 A;  4R5E A;  3JXV A;  4IT6 A;  4QZV B;  4MNK A;  1VF8 A;  2F23 A;  3KAH A;  1R9H A;  4Z2J A;  2ZAJ A;  1EG3 A;  5HWC A;  3AS3 A;  1GOI A;  3CGN A;  2WK2 A;  4NSB A;  3JYJ A;  3CH9 A;  3O5E A;  1NWR A;  4P8V A;  1FKG A;  1WNO A;  4Q22 A;  4ZPT R;  1W1V A;  1E6Z A;  4DWS C;  3ALG A;  4DRH A;  4DRQ A;  4DRP A;  2LKN A;  3KAB A;  3CHD A;  3FY1 A;  3O5F A;  4ODL A;  2DJY A;  3O5K A;  2ZR6 A;  4PTM A;  5CQ2 A;  1W1P A;  1NMV A;  1KT0 A;  1W9V A;  2XP4 A;  4C02 B;  4UDM A;  4WKF A;  2B31 A;  1JNE A;  3MQG A;  5HKG A;  3KAC A;  5HBF A;  2VCD A;  1ZL1 A;  3EIP A;  3UQA A;  1XHG A;  1CTN A;  3FS8 A;  3KZ7 A;  4U86 A;  1J4I A;  2F4E A;  1J4H A;  3IKD A;  1D7J A;  4L72 B;  4ML4 A;  3L4H A;  4LAW A;  1W9P A;  2MNT A;  1GRJ A;  1E9L A;  4DRM A;  3PQH A;  1E6P A;  4A0U A;  1WAW A;  3PA7 A;  4TYO A;  1TR8 A;  1XRV A;  4L3N A;  3PRA A;  5D75 A;  4U85 A;  3O5Q A;  2XP7 A;  3NRK A;  2ZQU A;  2FAP A;  2MDI A;  2M1I A;  1D6O A;  2DSU A;  3LUO A;  1EQ3 A;  3M85 A;  1FKS A;  1T11 A;  3ARV A;  3RM4 A;  4Z2L A;  4MNM A;  2O9O A;  3BXW A;  1WMV A;  1LL7 A;  1LG2 A;  3WQW A;  1JNS A;  2QRV A;  4JFM A;  1NWT A;  2M8I A;  5DF0 A;  5DIV A;  3MDY B;  4HBO A;  1FFQ A;  4ODQ A;  1TCO C;  3EY6 A;  3QOK A;  2BA1 A;  1ZBC A;  3ARU A;  3KAF A;  5BXJ A;  4G2P A;  4NZC A;  5HUA A;  1HJW A;  4TW6 A;  4MGV A;  2JX8 A;  2LJ4 A;  1LJY A;  1JVW A;  2WLZ A;  3UI5 A;  3OA5 A;  3WD2 A;  2M08 A;  4DWS B;  3O5I A;  4WKA A;  2PV3 A;  3MCB B;  1WB0 A;  3WL1 A;  1IX5 A; 
#chains in the Genus database with same CATH homology
 4WK9 A;  1NWS A;  2LPV A;  3AS2 A;  2KI3 A;  1E6N A;  4LAX A;  1HKJ A;  4AY1 A;  2DT2 A;  1JND A;  1KFW A;  2UZ5 A;  2ZR4 A;  3O5J A;  4JFI A;  2RE3 A;  3NI6 A;  1RD6 A;  4TW7 A;  5HW8 A;  3LKX A;  4ZPV R;  2OFN A;  2YSF A;  3CHE A;  2A3E A;  3H9R B;  2PPN A;  4MAV A;  1P5Q A;  5DEZ A;  4Q7N A;  3RM8 A;  1JMQ A;  1N1A A;  1SR0 A;  4LAY A;  1C9H A;  2AOS A;  2VN1 A;  2IUZ A;  1LQ0 A;  3ARX A;  4W9Q A;  3ARW A;  1UR9 A;  1H0I A;  2XPB A;  1FKB A;  2DSZ A;  2KFW A;  4WJX A;  4LGX A;  1NH6 A;  1ZBW A;  4O2T A;  5E5W A;  2PI6 A;  1EG4 A;  5HTG A;  2DPE A;  2A3C A;  2FKE A;  4MNL A;  4W9P A;  1JNT A;  1L1P A;  4Z2K A;  3FSB A;  2QF8 A;  2WM0 A;  2ZQV A;  3I6C A;  3RME A;  2WLY A;  1YW5 A;  1A7X A;  1LG1 A;  2WAE A;  3UQI A;  2IF4 A;  3LE4 A;  4J4N A;  4KQZ A;  4WKH A;  2XP9 A;  1NMW A;  4DIP A;  3TC5 A;  4DRK A;  2XP8 A;  5GQB A;  4W9O A;  3AS1 A;  1K9R A;  3ARS A;  1RP5 A;  3AQU A;  1J6Y A;  2KR7 A;  2RUC A;  2XPA A;  1W9U A;  4URI A;  2XP5 A;  3OOB A;  1U79 A;  3PRD A;  3VAW A;  3TDB A;  4GGQ A;  1WR7 A;  3W4R A;  1NSG A;  2MPH A;  4DRI A;  2PV2 A;  3CGM A;  4P8W A;  1ITX A;  2LAJ A;  4GLX A;  2Q5A A;  1Q6U A;  2E45 A;  1LL4 A;  4KR0 B;  1PBK A;  4MSP A;  1E6R A;  3UI4 A;  1EHN A;  1ZBK A;  3IK8 A;  2M2A A;  2MLX A;  3IKG A;  4IQ2 A;  1SYT A;  2DK7 A;  1FKD A;  1FKL A;  4MNJ A;  2DG9 A;  1UR8 A;  2KE0 A;  2O92 A;  4ODN A;  2JV4 A;  1E15 A;  4QT3 A;  2DMV A;  1K9T A;  2DG3 A;  3WD4 A;  2KO7 A;  1ZK6 A;  1GPF A;  3B8S A;  4MTV A;  5GPR A;  1D2K A;  1NWU A;  1W1Y A;  3M7N A;  1B6C A;  4ODR A;  4JYS A;  5DO2 A;  3O5L A;  2YBU A;  1QPF A;  4HBE A;  3ARY A;  1FJD A;  2DSV A;  2ZQT A;  1Q6I A;  2WAD A;  3WD3 A;  2F2D A;  2YSG A;  5AHT A;  2MLY A;  3IHZ A;  1YAT A;  2KXQ A;  2MLZ A;  3RM9 A;  4BF8 A;  1PIN A;  4QIB A;  3FXY A;  5E65 A;  4ZPW R;  5J6E A;  4ZS6 A;  2XP6 A;  2G41 A;  3CHC A;  2YSH A;  1I5H W;  5DIT A;  1FKT A;  4ITZ A;  4FAP A;  4Z2G A;  4E5R A;  2EZ5 W;  1FKK A;  4QT2 A;  2A3B A;  3O5G A;  4XAK A;  1D7I A;  5B8I C;  1QZ2 A;  1O6I A;  1OGB A;  2L2S A;  2PBC A;  1ZBV A;  2N87 A;  1M5Y A;  2MF9 A;  3RFW A;  3O5R A;  3ARZ A;  1X6N A;  2JXW A;  4LAV A;  1BL4 A;  3CNG A;  4REX A;  1OGG A;  2PPP A;  3ARP A;  4P8X A;  3KAG A;  1FKH A;  1KT1 A;  2XP3 A;  1FAP A;  1ROU A;  2JMF A;  2RSE A;  2YAJ B;  3B9E A;  1EIB A;  5E66 A;  2OWO A;  4N19 A;  3NTP A;  4S3J A;  1HXV A;  3UI6 A;  2YSB A;  4J4O A;  5DIU A;  4Z2H A;  4G50 A;  3WL0 A;  5HW6 A;  5U47 A;  1FKR A;  1LL6 A;  1FKI A;  2ITK A;  3FAP A;  3ARO A;  3GPK A;  3B9D A;  1FKF A;  4IT4 A;  2K8I A;  2OLH A;  1ZCN A;  3ARQ A;  1EDQ A;  4NNR A;  3PR9 A;  4GIV A;  2ZR5 A;  3KAI A;  2Y78 A;  3CHF A;  3O5D A;  1X6L A;  3LKX B;  2FDM A;  4HAR A;  1F40 A;  1HKK A;  2F21 A;  3WIJ A;  5HT1 A;  4S3K A;  2RUD A;  2PV1 A;  4DRJ A;  3KCE A;  1Y0O A;  4MPK A;  1ROT A;  2M3O W;  1GUV A;  2DSW A;  1Q1C A;  2D9F A;  3WKZ A;  4DT4 A;  2YSI A;  4DZ3 A;  4ODK A;  3MQH A;  1HKM A;  5HW7 A;  4WIW A;  1TK7 A;  2LGO A;  3O5M A;  1FD9 A;  4DWS A;  1BKF A;  2L4J A;  3FSC A;  4DRN A;  3JYM A;  3MCB A;  1EYM A;  4R0X A;  1W26 A;  2DWV A;  2KGJ A;  1H0G A;  5E64 A;  4DWS D;  3ODK A;  1D7H A;  1OWQ A;  3B9A A;  3KAD A;  2PPO A;  4TNS A;  3WD0 A;  4U84 A;  1HJX A;  4Z2I A;  1Q6H A;  3RGC A;  4A0T A;  4P8U A;  4JFL A;  1QPL A;  4DRO A;  3ART A;  4IQC A;  3O5O A;  4ODP A;  1TFV A;  5I98 A;  2RQS A;  3UF8 A;  1HKI A;  2Y8N B;  1F8A B;  5E62 A;  3AS0 A;  4JFK A;  5GPG A;  4TX0 A;  5HWB A;  3PRB A;  2DT1 A;  3G6L A;  4IPX A;  2DT0 A;  4FN2 A;  3WQV A;  1FFR A;  3ARR A;  2G8Z A;  4DZ2 A;  1J4R A;  1K9Q A;  3UQB A;  2AWG A;  1ZU8 A;  4DH0 A;  2JZV A;  2ZQS A;  2RUR A;  3WH0 A;  3G6M A;  2YBT A;  5JH8 A;  2M8J A;  4TW8 A;  2ESC A;  3CZ8 A;  2DK1 A;  1FLC A;  1ZB5 A;  3WD1 A;  1O6W A;  2RUQ A;  2DG4 A;  4ODM A;  2A3A A;  4ODO A;  1W1T A;  4JFJ A;  1FKJ A;  3O5P A;  4W5U A;  3TCZ A;  3B7X A;  3ALF A;  1HJV A;  2DT3 A;  4R5E A;  3JXV A;  4IT6 A;  4QZV B;  4MNK A;  1VF8 A;  3KAH A;  1R9H A;  4Z2J A;  2ZAJ A;  1EG3 A;  5HWC A;  3AS3 A;  1GOI A;  3CGN A;  2WK2 A;  4NSB A;  3JYJ A;  3CH9 A;  3O5E A;  1NWR A;  4P8V A;  1FKG A;  1WNO A;  4Q22 A;  4ZPT R;  1W1V A;  1E6Z A;  4DWS C;  3ALG A;  4DRH A;  4DRQ A;  4DRP A;  2LKN A;  3KAB A;  3CHD A;  3FY1 A;  3O5F A;  4ODL A;  2DJY A;  3O5K A;  2ZR6 A;  4PTM A;  5CQ2 A;  1W1P A;  1NMV A;  1KT0 A;  1W9V A;  2XP4 A;  4C02 B;  4WKF A;  2B31 A;  1JNE A;  3MQG A;  5HKG A;  3KAC A;  5HBF A;  2VCD A;  1ZL1 A;  3UQA A;  1XHG A;  1CTN A;  3FS8 A;  3KZ7 A;  4U86 A;  1J4I A;  2F4E A;  1J4H A;  3IKD A;  1D7J A;  4L72 B;  4ML4 A;  3L4H A;  4LAW A;  1W9P A;  2MNT A;  1E9L A;  4DRM A;  3PQH A;  1E6P A;  4A0U A;  1WAW A;  3PA7 A;  4TYO A;  1TR8 A;  1XRV A;  4L3N A;  3PRA A;  5D75 A;  4U85 A;  3O5Q A;  2XP7 A;  3NRK A;  2ZQU A;  2FAP A;  2MDI A;  2M1I A;  1D6O A;  2DSU A;  3LUO A;  1EQ3 A;  3M85 A;  1FKS A;  1T11 A;  3ARV A;  3RM4 A;  4Z2L A;  4MNM A;  2O9O A;  3BXW A;  1WMV A;  1LL7 A;  1LG2 A;  3WQW A;  1JNS A;  2QRV A;  4JFM A;  1NWT A;  2M8I A;  5DF0 A;  5DIV A;  3MDY B;  4HBO A;  1FFQ A;  4ODQ A;  1TCO C;  3EY6 A;  3QOK A;  2BA1 A;  1ZBC A;  3ARU A;  3KAF A;  5BXJ A;  4G2P A;  4NZC A;  5HUA A;  1HJW A;  4TW6 A;  4MGV A;  2JX8 A;  2LJ4 A;  1LJY A;  1JVW A;  2WLZ A;  3UI5 A;  3OA5 A;  3WD2 A;  2M08 A;  4DWS B;  3O5I A;  4WKA A;  2PV3 A;  3MCB B;  1WB0 A;  3WL1 A;  1IX5 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...