3KAHA

Structure-guided design of alpha-amino acid-derived pin1 inhibitors
Total Genus 42
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
42
sequence length
157
structure length
145
Chain Sequence
LPPGWEKAMSRSSGRVYYFNHITNASQWERPSEPARVRCSHLLVKHSQSRRPSSWRQEKITRTKEEALELINGYIQKIKSGEEDFESLASQFSDCSSAKARGDLGAFSRGQMQKPFEDASFALRTGEMSGPVFTDSGIHIILRTE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Peptidyl-prolyl cis-trans isomerase NIMA-interacting 1
publication title Structure-guided design of alpha-amino acid-derived Pin1 inhibitors
pubmed doi rcsb
source organism Homo sapiens
molecule tags Isomerase
total genus 42
structure length 145
sequence length 157
ec nomenclature ec 5.2.1.8: Peptidylprolyl isomerase.
pdb deposition date 2009-10-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00397 WW WW domain
A PF00639 Rotamase PPIC-type PPIASE domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.20.70.10 Mainly Beta Single Sheet Ubiquitin Ligase Nedd4; Chain: W; Ubiquitin Ligase Nedd4; Chain: W; 3kahA01
3.10.50.40 Alpha Beta Roll Chitinase A; domain 3 Chitinase A; domain 3 3kahA02
3O5EA 4DH0A 3O5OA 4BF8A 1KT0A 3VAWA 1K9RA 1FD9A 1WR7A 5HUAA 1TK7A 2LPVA 4REXA 3O5DA 4ODOA 3O5MA 4DIPA 4E5RA 1J4IA 1R9HA 2AWGA 3JYJA 2FAPA 2Q5AA 3FAPA 2PV2A 3LE4A 1EYMA 4LAXA 1FKFA 1EG3A 1QZ2A 2KO7A 4DT4A 3CGMA 2DK7A 2M08A 4DRIA 2M8JA 4DRJA 2PPNA 1FJDA 1NMVA 1FKTA 3MDYB 2PPOA 2MNTA 1C9HA 3KAFA 2RURA 3KAGA 1QPFA 2ZQUA 1FKGA 2RQSA 3UI6A 1I5HW 2LKNA 1F8AB 3IK8A 4LAVA 4JFLA 4TX0A 1HXVA 4G2PA 4N19A 2RUDA 3UQIA 2M8IA 3KABA 4W9QA 1QPLA 3NTPA 4MSPA 1ZCNA 1JMQA 1FAPA 2RSEA 1U79A 1D7HA 1O6WA 2ZAJA 2DMVA 5HTGA 4ODPA 2XPBA 3O5PA 2YSHA 1JNSA 3O5FA 4DRQA 1D6OA 2DG3A 3NI6A 2MLYA 4IPXA 1JVWA 5DIVA 4C02B 2XP3A 3B7XA 4J4OA 5HT1A 3O5JA 4DRMA 2XPAA 1NSGA 1PBKA 2XP5A 1Y0OA 3KACA 2L4JA 4QT3A 1BL4A 5CQ2A 1Q6IA 3JXVA 2KR7A 5DITA 2DG4A 4U86A 4FN2A 1M5YA 2ZQVA 1Q6HA 4ODKA 1J4RA 3IHZA 2EZ5W 1FKSA 2RUCA 3UI4A 2FKEA 3TC5A 2MDIA 3O5QA 2JV4A 2D9FA 1JNTA 1J6YA 4QIBA 3EY6A 3LUOA 4DRKA 3KAHA 3GPKA 2M2AA 1FKHA 4QT2A 4IQ2A 4DROA 2XP9A 4GGQA 2E45A 4GIVA 2XP8A 4ODNA 3IKGA 3O5GA 4TW7A 2DWVA 1FKRA 1A7XA 1FKBA 2LAJA 3UF8A 4JFMA 2JMFA 4DRHA 2M1IA 1Q6UA 2LJ4A 4TW8A 3M7NA 3UQBA 2PPPA 2M3OW 4O2TA 4ODRA 4DZ2A 4ODMA 2MLXA 2RE3A 1EG4A 4U84A 2VN1A 2ZR4A 2LGOA 1FKDA 3JYMA 1KT1A 1L1PA 5HW6A 3O5KA 4U85A 5HW8A 4LAYA 3H9RB 1EQ3A 1YW5A 4ITZA 5D75A 3O5IA 4FAPA 5GPGA 3PA7A 4JFIA 3CNGA 2YSIA 5HWBA 1YATA 5HW7A 2PV1A 5I98A 3KCEA 1PINA 1NMWA 4TW6A 2BA1A 2N87A 1WMVA 5J6EA 1ZK6A 3WH0A 4ODQA 4TNSA 2UZ5A 2OFNA 2MPHA 4DRPA 2XP4A 1B6CA 3O5RA 4MGVA 3L4HA 1N1AA 3I6CA 3RGCA 4LAWA 2Y78A 2ZQTA 3IKDA 2JX8A 1J4HA 3TCZA 5AHTA 1ROUA 1T11A 3PRBA 2VCDA 2IF4A 2YSFA 3UI5A 3NRKA 4JFJA 1BKFA 2ZR6A 4G50A 1FKKA 2ZQSA 3ODKA 3OOBA 3M85A 1FKIA 3PRDA 3KZ7A 2KFWA 1W26A 2JXWA 4DZ3A 1D7JA 3RFWA 2RUQA 2PV3A 2F21A 2JZVA 4JFKA 5BXJA 1FKJA 4DRNA 1K9QA 2KI3A 4J4NA 2F2DA 2MLZA 2PBCA 1Q1CA 3UQAA 2F4EA 2KGJA 3CGNA 2DG9A 4TYOA 1F40A 3O5LA 2YSBA 2MF9A 4NNRA 2L2SA 2K8IA 4JYSA 3TDBA 5DIUA 1D7IA 5HKGA 2XP6A 1FKLA 2DJYA 2KE0A 1P5QA 2XP7A 2DK1A 2KXQA 2ZR5A 4ODLA 3KAIA 3KADA 5HWCA 4W9OA 2ITKA 1TCOC 4R0XA 2YSGA 5B8IC 4IQCA 4W9PA 1ROTA
chains in the Genus database with same CATH superfamily
1HJVA 1WAWA 1LL4A 3O5EA 4DH0A 3O5OA 5DO2A 2WAEA 4BF8A 1KT0A 4P8VA 1ZBVA 3CHDA 3VAWA 3LKXB 1K9RA 1FD9A 5U47A 4KR0B 1SR0A 4WKHA 1XHGA 1FLCA 1GPFA 1WR7A 5HUAA 1TK7A 2LPVA 3MQGA 4IT4A 4REXA 3O5DA 4ODOA 3WD2A 1W1YA 3O5MA 4DIPA 3FSBA 4E5RA 1LG2A 4DWSD 1J4IA 3G6LA 5DEZA 1R9HA 2AWGA 3JYJA 2FAPA 2Q5AA 3FAPA 1IX5A 2PV2A 1ZB5A 3LE4A 3WIJA 1EYMA 4LAXA 3RMEA 4UDMA 5E62A 3MCBA 1FKFA 1EG3A 3WD4A 5JH8A 1QZ2A 5GQBA 4MPKA 2QF8A 2KO7A 5HBFA 3RM8A 4DT4A 3CGMA 2DK7A 1ZBCA 4MTVA 4GLXA 2M08A 3WL1A 4DRIA 1HKKA 2M8JA 3B9AA 4DRJA 4HBOA 2EULA 3EIPA 1H0IA 2B5UB 2PI6A 3MCBB 2PPNA 1GUVA 1FJDA 1NMVA 1FKTA 3OA5A 1CTNA 2PPOA 2DT1A 2MNTA 3MDYB 4WJXA 1C9HA 3KAFA 2RURA 1OGBA 3KAGA 4R5EA 1QPFA 2A3CA 2ZQUA 1FKGA 2RQSA 3WL0A 3UI6A 1I5HW 1LJYA 2LKNA 3ARWA 2WLZA 1F8AB 3IK8A 4LAVA 4JFLA 4TX0A 1HKJA 1HXVA 1NWUA 4G2PA 4N19A 1GOIA 2RUDA 1KFWA 3UQIA 2M8IA 5E5WA 3KABA 4W9QA 4Z2GA 1QPLA 1ZL1A 3NTPA 3AS0A 4MSPA 1ZCNA 1JMQA 1FAPA 2RSEA 2WLYA 1NWTA 1U79A 1D7HA 1O6WA 2ZAJA 2DMVA 4Z2JA 5HTGA 4ODPA 3FXYA 4S3JA 2XPBA 3O5PA 2OWOA 2YSHA 4Z2LA 1JNSA 3O5FA 4DRQA 1D6OA 2DG3A 1NH6A 1H0GA 3NI6A 2WM0A 2MLYA 2G8ZA 4MNKA 4IPXA 1JVWA 5DIVA 4C02B 2XP3A 3B7XA 4J4OA 5HT1A 3O5JA 4S3KA 3ARZA 3FY1A 3B8SA 4DRMA 2XPAA 1HKIA 1GRJA 1W9VA 3BXWA 1NSGA 1PBKA 3B9EA 2XP5A 1Y0OA 3KACA 2L4JA 4HARA 4QT3A 5E64A 1X6NA 1BL4A 5CQ2A 1Q6IA 3JXVA 2DT2A 2KR7A 1E9LA 1O6IA 4W5UA 2OLHA 4L72B 5DITA 2DG4A 5GPRA 4U86A 1JNEA 5E66A 1M5YA 2ZQVA 3G6MA 4FN2A 1Q6HA 4ODKA 4NSBA 3PRAA 1J4RA 3PR9A 3IHZA 2EZ5W 1FKSA 3ARUA 1ZBKA 2WK2A 2DT3A 3ALGA 3BMBA 3WQWA 2RUCA 1W1TA 1LL6A 3UI4A 2DT0A 2FKEA 3TC5A 2MDIA 3AS3A 4WK9A 3O5QA 2JV4A 1X6LA 1FFRA 2D9FA 1JNTA 1J6YA 4QIBA 3EY6A 3LUOA 1XRVA 4DRKA 4WKAA 1E15A 3KAHA 4HBEA 3GPKA 1LL7A 2M2AA 1FKHA 4QT2A 4IQ2A 3WD3A 1JNDA 1WNOA 4DROA 2XP9A 4GGQA 2E45A 4GIVA 2XP8A 4ODNA 3IKGA 3O5GA 3AS2A 4TW7A 3WKZA 3GU0A 2DWVA 1FKRA 1A7XA 1FKBA 2LAJA 3UF8A 4JFMA 3PQHA 2P4VA 4DWSA 2F23A 2JMFA 2PN0A 1D2KA 4DRHA 2M1IA 1Q6UA 2LJ4A 4TW8A 3M7NA 1W9UA 3UQBA 3AS1A 3ARRA 2PPPA 2M3OW 3RM9A 4O2TA 1EHNA 2AOSA 4QZVB 1E6NA 2O92A 4ODRA 4DZ2A 3CH9A 4Z2IA 4ODMA 4DWSB 1LG1A 4XAKA 3CZ8A 2MLXA 3CHFA 2RE3A 1EG4A 4U84A 4Z2HA 2VN1A 2ZR4A 1ITXA 2LGOA 1FKDA 3JYMA 1KT1A 3ARTA 2ESCA 2WADA 1L1PA 4NZCA 4P8XA 5HW6A 3O5KA 5DF0A 4U85A 5HW8A 3FS8A 4LAYA 3H9RB 1EQ3A 1RP5A 1YW5A 4ZPTR 4ITZA 3ARPA 5D75A 3O5IA 4FAPA 4PTMA 1JCHB 5GPGA 3PA7A 4JFIA 3CNGA 1UR9A 2YSIA 5HWBA 1YATA 4MNLA 5HW7A 2PV1A 5I98A 3KCEA 1PINA 1NMWA 4TW6A 2BA1A 2N87A 4MAVA 1WMVA 5J6EA 1ZK6A 3WH0A 4LGXA 4ODQA 2FDMA 4TNSA 4URIA 4MNJA 2UZ5A 2OFNA 2MPHA 1HKMA 3W4RA 4DRPA 2XP4A 1B6CA 3O5RA 4MGVA 3L4HA 3ALFA 3AROA 1W1PA 4ZPVR 3MQHA 3WD1A 3ARVA 1N1AA 2A3EA 3I6CA 4Q7NA 4KQZA 4A0UA 4ZPWR 3RGCA 4LAWA 4ML4A 2Y78A 2ZQTA 2DSZA 3IKDA 1K9TA 4ZS6A 1E6ZA 3GTYX 2JX8A 1J4HA 3TCZA 1TR8A 1E6RA 5E65A 5AHTA 1E6PA 1ROUA 1T11A 3PRBA 1NWSA 2VCDA 2IF4A 3CHCA 2YSFA 3UI5A 3NRKA 4JFJA 1HJWA 1BKFA 4Z2KA 3RM4A 2ZR6A 4G50A 1FKKA 2ZQSA 3ARSA 1UR8A 4L3NA 3ODKA 3OOBA 3M85A 1FKIA 3CHEA 3PRDA 3KZ7A 4DWSC 2KFWA 1W26A 2JXWA 4DZ3A 1D7JA 3RFWA 2RUQA 2PV3A 3QOKA 2F21A 1NWRA 1W1VA 2JZVA 2DSUA 4JFKA 2B31A 2DPEA 4MNMA 1RD6A 3B9DA 4P8WA 5BXJA 1FKJA 4DRNA 4P8UA 1K9QA 2KI3A 1W9PA 4J4NA 2A3BA 2F2DA 2MLZA 2PBCA 2YBTA 2QRVA 1EDQA 1Q1CA 4A0TA 3UQAA 1OGGA 2F4EA 2KGJA 3CGNA 3AQUA 2IUZA 3FSCA 2DG9A 4TYOA 1F40A 1LQ0A 3O5LA 1ZBWA 2YSBA 2MF9A 4NNRA 4AY1A 1EIBA 4WIWA 2O9OA 2L2SA 2K8IA 4JYSA 3TDBA 1E44A 1SYTA 5DIUA 1D7IA 5HKGA 2XP6A 1FKLA 1FFQA 3WD0A 2DJYA 2KE0A 1P5QA 2XP7A 2DK1A 2KXQA 2YAJB 1WB0A 1ZU8A 4Q22A 2ZR5A 4ODLA 3KAIA 3KADA 3WQVA 5HWCA 3LKXA 1OWQA 3ARQA 2ITKA 4W9OA 1TCOC 4R0XA 2YSGA 1HJXA 5B8IC 2YBUA 1VF8A 2ETNA 4IT6A 2A3AA 2DSWA 1TFVA 2Y8NB 2G41A 4IQCA 2DSVA 3ARXA 4W9PA 1ROTA 3ARYA 4WKFA
chains in the Genus database with same CATH topology
1HJVA 1WAWA 1LL4A 3O5EA 4DH0A 3O5OA 5DO2A 2WAEA 4BF8A 1KT0A 4P8VA 1ZBVA 3CHDA 3VAWA 3LKXB 1K9RA 1FD9A 5U47A 4KR0B 1SR0A 4WKHA 1XHGA 1FLCA 1GPFA 1WR7A 5HUAA 1TK7A 2LPVA 3MQGA 4IT4A 4REXA 3O5DA 4ODOA 3WD2A 1W1YA 3O5MA 4DIPA 3FSBA 4E5RA 1LG2A 4DWSD 1J4IA 3G6LA 5DEZA 1R9HA 2AWGA 3JYJA 2FAPA 2Q5AA 3FAPA 1IX5A 2PV2A 1ZB5A 3LE4A 3WIJA 1EYMA 4LAXA 3RMEA 5E62A 3MCBA 1FKFA 1EG3A 3WD4A 5JH8A 1QZ2A 5GQBA 4MPKA 2QF8A 2KO7A 5HBFA 3RM8A 4DT4A 3CGMA 2DK7A 1ZBCA 4MTVA 4GLXA 2M08A 3WL1A 4DRIA 1HKKA 2M8JA 3B9AA 4DRJA 4HBOA 1H0IA 2PI6A 3MCBB 2PPNA 1GUVA 1FJDA 1NMVA 1FKTA 3OA5A 1CTNA 2PPOA 2DT1A 2MNTA 3MDYB 4WJXA 1C9HA 3KAFA 2RURA 1OGBA 3KAGA 4R5EA 1QPFA 2A3CA 2ZQUA 1FKGA 2RQSA 3WL0A 3UI6A 1I5HW 1LJYA 2LKNA 3ARWA 2WLZA 1F8AB 3IK8A 4LAVA 4JFLA 4TX0A 1HKJA 1HXVA 1NWUA 4G2PA 4N19A 1GOIA 2RUDA 1KFWA 3UQIA 2M8IA 5E5WA 3KABA 4W9QA 4Z2GA 1QPLA 1ZL1A 3NTPA 3AS0A 4MSPA 1ZCNA 1JMQA 1FAPA 2RSEA 2WLYA 1NWTA 1U79A 1D7HA 1O6WA 2ZAJA 2DMVA 4Z2JA 5HTGA 4ODPA 3FXYA 4S3JA 2XPBA 3O5PA 2OWOA 2YSHA 4Z2LA 1JNSA 3O5FA 4DRQA 1D6OA 2DG3A 1NH6A 1H0GA 3NI6A 2WM0A 2MLYA 2G8ZA 4MNKA 4IPXA 1JVWA 5DIVA 4C02B 2XP3A 3B7XA 4J4OA 5HT1A 3O5JA 4S3KA 3ARZA 3FY1A 3B8SA 4DRMA 2XPAA 1HKIA 1W9VA 3BXWA 1NSGA 1PBKA 3B9EA 2XP5A 1Y0OA 3KACA 2L4JA 4HARA 4QT3A 5E64A 1X6NA 1BL4A 5CQ2A 1Q6IA 3JXVA 2DT2A 2KR7A 1E9LA 1O6IA 4W5UA 2OLHA 4L72B 5DITA 2DG4A 5GPRA 4U86A 1JNEA 5E66A 1M5YA 2ZQVA 3G6MA 4FN2A 1Q6HA 4ODKA 4NSBA 3PRAA 1J4RA 3PR9A 3IHZA 2EZ5W 1FKSA 3ARUA 1ZBKA 2WK2A 2DT3A 3ALGA 3WQWA 2RUCA 1W1TA 1LL6A 3UI4A 2DT0A 2FKEA 3TC5A 2MDIA 3AS3A 4WK9A 3O5QA 2JV4A 1X6LA 1FFRA 2D9FA 1JNTA 1J6YA 4QIBA 3EY6A 3LUOA 1XRVA 4DRKA 4WKAA 1E15A 3KAHA 4HBEA 3GPKA 1LL7A 2M2AA 1FKHA 4QT2A 4IQ2A 3WD3A 1JNDA 1WNOA 4DROA 2XP9A 4GGQA 2E45A 4GIVA 2XP8A 4ODNA 3IKGA 3O5GA 3AS2A 4TW7A 3WKZA 2DWVA 1FKRA 1A7XA 1FKBA 2LAJA 3UF8A 4JFMA 3PQHA 4DWSA 2JMFA 1D2KA 4DRHA 2M1IA 1Q6UA 2LJ4A 4TW8A 3M7NA 1W9UA 3UQBA 3AS1A 3ARRA 2PPPA 2M3OW 3RM9A 4O2TA 1EHNA 2AOSA 4QZVB 1E6NA 2O92A 4ODRA 4DZ2A 3CH9A 4Z2IA 4ODMA 4DWSB 1LG1A 4XAKA 3CZ8A 2MLXA 3CHFA 2RE3A 1EG4A 4U84A 4Z2HA 2VN1A 2ZR4A 1ITXA 2LGOA 1FKDA 3JYMA 1KT1A 3ARTA 2ESCA 2WADA 1L1PA 4NZCA 4P8XA 5HW6A 3O5KA 5DF0A 4U85A 5HW8A 3FS8A 4LAYA 3H9RB 1EQ3A 1RP5A 1YW5A 4ZPTR 4ITZA 3ARPA 5D75A 3O5IA 4FAPA 4PTMA 5GPGA 3PA7A 4JFIA 3CNGA 1UR9A 2YSIA 5HWBA 1YATA 4MNLA 5HW7A 2PV1A 5I98A 3KCEA 1PINA 1NMWA 4TW6A 2BA1A 2N87A 4MAVA 1WMVA 5J6EA 1ZK6A 3WH0A 4LGXA 4ODQA 2FDMA 4TNSA 4URIA 4MNJA 2UZ5A 2OFNA 2MPHA 1HKMA 3W4RA 4DRPA 2XP4A 1B6CA 3O5RA 4MGVA 3L4HA 3ALFA 3AROA 1W1PA 4ZPVR 3MQHA 3WD1A 3ARVA 1N1AA 2A3EA 3I6CA 4Q7NA 4KQZA 4A0UA 4ZPWR 3RGCA 4LAWA 4ML4A 2Y78A 2ZQTA 2DSZA 3IKDA 1K9TA 4ZS6A 1E6ZA 2JX8A 1J4HA 3TCZA 1TR8A 1E6RA 5E65A 5AHTA 1E6PA 1ROUA 1T11A 3PRBA 1NWSA 2VCDA 2IF4A 3CHCA 2YSFA 3UI5A 3NRKA 4JFJA 1HJWA 1BKFA 4Z2KA 3RM4A 2ZR6A 4G50A 1FKKA 2ZQSA 3ARSA 1UR8A 4L3NA 3ODKA 3OOBA 3M85A 1FKIA 3CHEA 3PRDA 3KZ7A 4DWSC 2KFWA 1W26A 2JXWA 4DZ3A 1D7JA 3RFWA 2RUQA 2PV3A 3QOKA 2F21A 1NWRA 1W1VA 2JZVA 2DSUA 4JFKA 2B31A 2DPEA 4MNMA 1RD6A 3B9DA 4P8WA 5BXJA 1FKJA 4DRNA 4P8UA 1K9QA 2KI3A 1W9PA 4J4NA 2A3BA 2F2DA 2MLZA 2PBCA 2YBTA 2QRVA 1EDQA 1Q1CA 4A0TA 3UQAA 1OGGA 2F4EA 2KGJA 3CGNA 3AQUA 2IUZA 3FSCA 2DG9A 4TYOA 1F40A 1LQ0A 3O5LA 1ZBWA 2YSBA 2MF9A 4NNRA 4AY1A 1EIBA 4WIWA 2O9OA 2L2SA 2K8IA 4JYSA 3TDBA 1SYTA 5DIUA 1D7IA 5HKGA 2XP6A 1FKLA 1FFQA 3WD0A 2DJYA 2KE0A 1P5QA 2XP7A 2DK1A 2KXQA 2YAJB 1WB0A 1ZU8A 4Q22A 2ZR5A 4ODLA 3KAIA 3KADA 3WQVA 5HWCA 3LKXA 1OWQA 3ARQA 2ITKA 4W9OA 1TCOC 4R0XA 2YSGA 1HJXA 5B8IC 2YBUA 1VF8A 4IT6A 2A3AA 2DSWA 1TFVA 2Y8NB 2G41A 4IQCA 2DSVA 3ARXA 4W9PA 1ROTA 3ARYA 4WKFA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3O5E A;  4DH0 A;  3O5O A;  4BF8 A;  1KT0 A;  3VAW A;  1K9R A;  1FD9 A;  1WR7 A;  5HUA A;  1TK7 A;  2LPV A;  4REX A;  3O5D A;  4ODO A;  3O5M A;  4DIP A;  4E5R A;  1J4I A;  1R9H A;  2AWG A;  3JYJ A;  2FAP A;  2Q5A A;  3FAP A;  2PV2 A;  3LE4 A;  1EYM A;  4LAX A;  1FKF A;  1EG3 A;  1QZ2 A;  2KO7 A;  4DT4 A;  3CGM A;  2DK7 A;  2M08 A;  4DRI A;  2M8J A;  4DRJ A;  2PPN A;  1FJD A;  1NMV A;  1FKT A;  3MDY B;  2PPO A;  2MNT A;  1C9H A;  3KAF A;  2RUR A;  3KAG A;  1QPF A;  2ZQU A;  1FKG A;  2RQS A;  3UI6 A;  1I5H W;  2LKN A;  1F8A B;  3IK8 A;  4LAV A;  4JFL A;  4TX0 A;  1HXV A;  4G2P A;  4N19 A;  2RUD A;  3UQI A;  2M8I A;  3KAB A;  4W9Q A;  1QPL A;  3NTP A;  4MSP A;  1ZCN A;  1JMQ A;  1FAP A;  2RSE A;  1U79 A;  1D7H A;  1O6W A;  2ZAJ A;  2DMV A;  5HTG A;  4ODP A;  2XPB A;  3O5P A;  2YSH A;  1JNS A;  3O5F A;  4DRQ A;  1D6O A;  2DG3 A;  3NI6 A;  2MLY A;  4IPX A;  1JVW A;  5DIV A;  4C02 B;  2XP3 A;  3B7X A;  4J4O A;  5HT1 A;  3O5J A;  4DRM A;  2XPA A;  1NSG A;  1PBK A;  2XP5 A;  1Y0O A;  3KAC A;  2L4J A;  4QT3 A;  1BL4 A;  5CQ2 A;  1Q6I A;  3JXV A;  2KR7 A;  5DIT A;  2DG4 A;  4U86 A;  4FN2 A;  1M5Y A;  2ZQV A;  1Q6H A;  4ODK A;  1J4R A;  3IHZ A;  2EZ5 W;  1FKS A;  2RUC A;  3UI4 A;  2FKE A;  3TC5 A;  2MDI A;  3O5Q A;  2JV4 A;  2D9F A;  1JNT A;  1J6Y A;  4QIB A;  3EY6 A;  3LUO A;  4DRK A;  3KAH A;  3GPK A;  2M2A A;  1FKH A;  4QT2 A;  4IQ2 A;  4DRO A;  2XP9 A;  4GGQ A;  2E45 A;  4GIV A;  2XP8 A;  4ODN A;  3IKG A;  3O5G A;  4TW7 A;  2DWV A;  1FKR A;  1A7X A;  1FKB A;  2LAJ A;  3UF8 A;  4JFM A;  2JMF A;  4DRH A;  2M1I A;  1Q6U A;  2LJ4 A;  4TW8 A;  3M7N A;  3UQB A;  2PPP A;  2M3O W;  4O2T A;  4ODR A;  4DZ2 A;  4ODM A;  2MLX A;  2RE3 A;  1EG4 A;  4U84 A;  2VN1 A;  2ZR4 A;  2LGO A;  1FKD A;  3JYM A;  1KT1 A;  1L1P A;  5HW6 A;  3O5K A;  4U85 A;  5HW8 A;  4LAY A;  3H9R B;  1EQ3 A;  1YW5 A;  4ITZ A;  5D75 A;  3O5I A;  4FAP A;  5GPG A;  3PA7 A;  4JFI A;  3CNG A;  2YSI A;  5HWB A;  1YAT A;  5HW7 A;  2PV1 A;  5I98 A;  3KCE A;  1PIN A;  1NMW A;  4TW6 A;  2BA1 A;  2N87 A;  1WMV A;  5J6E A;  1ZK6 A;  3WH0 A;  4ODQ A;  4TNS A;  2UZ5 A;  2OFN A;  2MPH A;  4DRP A;  2XP4 A;  1B6C A;  3O5R A;  4MGV A;  3L4H A;  1N1A A;  3I6C A;  3RGC A;  4LAW A;  2Y78 A;  2ZQT A;  3IKD A;  2JX8 A;  1J4H A;  3TCZ A;  5AHT A;  1ROU A;  1T11 A;  3PRB A;  2VCD A;  2IF4 A;  2YSF A;  3UI5 A;  3NRK A;  4JFJ A;  1BKF A;  2ZR6 A;  4G50 A;  1FKK A;  2ZQS A;  3ODK A;  3OOB A;  3M85 A;  1FKI A;  3PRD A;  3KZ7 A;  2KFW A;  1W26 A;  2JXW A;  4DZ3 A;  1D7J A;  3RFW A;  2RUQ A;  2PV3 A;  2F21 A;  2JZV A;  4JFK A;  5BXJ A;  1FKJ A;  4DRN A;  1K9Q A;  2KI3 A;  4J4N A;  2F2D A;  2MLZ A;  2PBC A;  1Q1C A;  3UQA A;  2F4E A;  2KGJ A;  3CGN A;  2DG9 A;  4TYO A;  1F40 A;  3O5L A;  2YSB A;  2MF9 A;  4NNR A;  2L2S A;  2K8I A;  4JYS A;  3TDB A;  5DIU A;  1D7I A;  5HKG A;  2XP6 A;  1FKL A;  2DJY A;  2KE0 A;  1P5Q A;  2XP7 A;  2DK1 A;  2KXQ A;  2ZR5 A;  4ODL A;  3KAI A;  3KAD A;  5HWC A;  4W9O A;  2ITK A;  1TCO C;  4R0X A;  2YSG A;  5B8I C;  4IQC A;  4W9P A;  1ROT A; 
#chains in the Genus database with same CATH topology
 1HJV A;  1WAW A;  1LL4 A;  3O5E A;  4DH0 A;  3O5O A;  5DO2 A;  2WAE A;  4BF8 A;  1KT0 A;  4P8V A;  1ZBV A;  3CHD A;  3VAW A;  3LKX B;  1K9R A;  1FD9 A;  5U47 A;  4KR0 B;  1SR0 A;  4WKH A;  1XHG A;  1FLC A;  1GPF A;  1WR7 A;  5HUA A;  1TK7 A;  2LPV A;  3MQG A;  4IT4 A;  4REX A;  3O5D A;  4ODO A;  3WD2 A;  1W1Y A;  3O5M A;  4DIP A;  3FSB A;  4E5R A;  1LG2 A;  4DWS D;  1J4I A;  3G6L A;  5DEZ A;  1R9H A;  2AWG A;  3JYJ A;  2FAP A;  2Q5A A;  3FAP A;  1IX5 A;  2PV2 A;  1ZB5 A;  3LE4 A;  3WIJ A;  1EYM A;  4LAX A;  3RME A;  4UDM A;  5E62 A;  3MCB A;  1FKF A;  1EG3 A;  3WD4 A;  5JH8 A;  1QZ2 A;  5GQB A;  4MPK A;  2QF8 A;  2KO7 A;  5HBF A;  3RM8 A;  4DT4 A;  3CGM A;  2DK7 A;  1ZBC A;  4MTV A;  4GLX A;  2M08 A;  3WL1 A;  4DRI A;  1HKK A;  2M8J A;  3B9A A;  4DRJ A;  4HBO A;  2EUL A;  3EIP A;  1H0I A;  2B5U B;  2PI6 A;  3MCB B;  2PPN A;  1GUV A;  1FJD A;  1NMV A;  1FKT A;  3OA5 A;  1CTN A;  2PPO A;  2DT1 A;  2MNT A;  3MDY B;  4WJX A;  1C9H A;  3KAF A;  2RUR A;  1OGB A;  3KAG A;  4R5E A;  1QPF A;  2A3C A;  2ZQU A;  1FKG A;  2RQS A;  3WL0 A;  3UI6 A;  1I5H W;  1LJY A;  2LKN A;  3ARW A;  2WLZ A;  1F8A B;  3IK8 A;  4LAV A;  4JFL A;  4TX0 A;  1HKJ A;  1HXV A;  1NWU A;  4G2P A;  4N19 A;  1GOI A;  2RUD A;  1KFW A;  3UQI A;  2M8I A;  5E5W A;  3KAB A;  4W9Q A;  4Z2G A;  1QPL A;  1ZL1 A;  3NTP A;  3AS0 A;  4MSP A;  1ZCN A;  1JMQ A;  1FAP A;  2RSE A;  2WLY A;  1NWT A;  1U79 A;  1D7H A;  1O6W A;  2ZAJ A;  2DMV A;  4Z2J A;  5HTG A;  4ODP A;  3FXY A;  4S3J A;  2XPB A;  3O5P A;  2OWO A;  2YSH A;  4Z2L A;  1JNS A;  3O5F A;  4DRQ A;  1D6O A;  2DG3 A;  1NH6 A;  1H0G A;  3NI6 A;  2WM0 A;  2MLY A;  2G8Z A;  4MNK A;  4IPX A;  1JVW A;  5DIV A;  4C02 B;  2XP3 A;  3B7X A;  4J4O A;  5HT1 A;  3O5J A;  4S3K A;  3ARZ A;  3FY1 A;  3B8S A;  4DRM A;  2XPA A;  1HKI A;  1GRJ A;  1W9V A;  3BXW A;  1NSG A;  1PBK A;  3B9E A;  2XP5 A;  1Y0O A;  3KAC A;  2L4J A;  4HAR A;  4QT3 A;  5E64 A;  1X6N A;  1BL4 A;  5CQ2 A;  1Q6I A;  3JXV A;  2DT2 A;  2KR7 A;  1E9L A;  1O6I A;  4W5U A;  2OLH A;  4L72 B;  5DIT A;  2DG4 A;  5GPR A;  4U86 A;  1JNE A;  5E66 A;  1M5Y A;  2ZQV A;  3G6M A;  4FN2 A;  1Q6H A;  4ODK A;  4NSB A;  3PRA A;  1J4R A;  3PR9 A;  3IHZ A;  2EZ5 W;  1FKS A;  3ARU A;  1ZBK A;  2WK2 A;  2DT3 A;  3ALG A;  3BMB A;  3WQW A;  2RUC A;  1W1T A;  1LL6 A;  3UI4 A;  2DT0 A;  2FKE A;  3TC5 A;  2MDI A;  3AS3 A;  4WK9 A;  3O5Q A;  2JV4 A;  1X6L A;  1FFR A;  2D9F A;  1JNT A;  1J6Y A;  4QIB A;  3EY6 A;  3LUO A;  1XRV A;  4DRK A;  4WKA A;  1E15 A;  3KAH A;  4HBE A;  3GPK A;  1LL7 A;  2M2A A;  1FKH A;  4QT2 A;  4IQ2 A;  3WD3 A;  1JND A;  1WNO A;  4DRO A;  2XP9 A;  4GGQ A;  2E45 A;  4GIV A;  2XP8 A;  4ODN A;  3IKG A;  3O5G A;  3AS2 A;  4TW7 A;  3WKZ A;  3GU0 A;  2DWV A;  1FKR A;  1A7X A;  1FKB A;  2LAJ A;  3UF8 A;  4JFM A;  3PQH A;  2P4V A;  4DWS A;  2F23 A;  2JMF A;  2PN0 A;  1D2K A;  4DRH A;  2M1I A;  1Q6U A;  2LJ4 A;  4TW8 A;  3M7N A;  1W9U A;  3UQB A;  3AS1 A;  3ARR A;  2PPP A;  2M3O W;  3RM9 A;  4O2T A;  1EHN A;  2AOS A;  4QZV B;  1E6N A;  2O92 A;  4ODR A;  4DZ2 A;  3CH9 A;  4Z2I A;  4ODM A;  4DWS B;  1LG1 A;  4XAK A;  3CZ8 A;  2MLX A;  3CHF A;  2RE3 A;  1EG4 A;  4U84 A;  4Z2H A;  2VN1 A;  2ZR4 A;  1ITX A;  2LGO A;  1FKD A;  3JYM A;  1KT1 A;  3ART A;  2ESC A;  2WAD A;  1L1P A;  4NZC A;  4P8X A;  5HW6 A;  3O5K A;  5DF0 A;  4U85 A;  5HW8 A;  3FS8 A;  4LAY A;  3H9R B;  1EQ3 A;  1RP5 A;  1YW5 A;  4ZPT R;  4ITZ A;  3ARP A;  5D75 A;  3O5I A;  4FAP A;  4PTM A;  1JCH B;  5GPG A;  3PA7 A;  4JFI A;  3CNG A;  1UR9 A;  2YSI A;  5HWB A;  1YAT A;  4MNL A;  5HW7 A;  2PV1 A;  5I98 A;  3KCE A;  1PIN A;  1NMW A;  4TW6 A;  2BA1 A;  2N87 A;  4MAV A;  1WMV A;  5J6E A;  1ZK6 A;  3WH0 A;  4LGX A;  4ODQ A;  2FDM A;  4TNS A;  4URI A;  4MNJ A;  2UZ5 A;  2OFN A;  2MPH A;  1HKM A;  3W4R A;  4DRP A;  2XP4 A;  1B6C A;  3O5R A;  4MGV A;  3L4H A;  3ALF A;  3ARO A;  1W1P A;  4ZPV R;  3MQH A;  3WD1 A;  3ARV A;  1N1A A;  2A3E A;  3I6C A;  4Q7N A;  4KQZ A;  4A0U A;  4ZPW R;  3RGC A;  4LAW A;  4ML4 A;  2Y78 A;  2ZQT A;  2DSZ A;  3IKD A;  1K9T A;  4ZS6 A;  1E6Z A;  3GTY X;  2JX8 A;  1J4H A;  3TCZ A;  1TR8 A;  1E6R A;  5E65 A;  5AHT A;  1E6P A;  1ROU A;  1T11 A;  3PRB A;  1NWS A;  2VCD A;  2IF4 A;  3CHC A;  2YSF A;  3UI5 A;  3NRK A;  4JFJ A;  1HJW A;  1BKF A;  4Z2K A;  3RM4 A;  2ZR6 A;  4G50 A;  1FKK A;  2ZQS A;  3ARS A;  1UR8 A;  4L3N A;  3ODK A;  3OOB A;  3M85 A;  1FKI A;  3CHE A;  3PRD A;  3KZ7 A;  4DWS C;  2KFW A;  1W26 A;  2JXW A;  4DZ3 A;  1D7J A;  3RFW A;  2RUQ A;  2PV3 A;  3QOK A;  2F21 A;  1NWR A;  1W1V A;  2JZV A;  2DSU A;  4JFK A;  2B31 A;  2DPE A;  4MNM A;  1RD6 A;  3B9D A;  4P8W A;  5BXJ A;  1FKJ A;  4DRN A;  4P8U A;  1K9Q A;  2KI3 A;  1W9P A;  4J4N A;  2A3B A;  2F2D A;  2MLZ A;  2PBC A;  2YBT A;  2QRV A;  1EDQ A;  1Q1C A;  4A0T A;  3UQA A;  1OGG A;  2F4E A;  2KGJ A;  3CGN A;  3AQU A;  2IUZ A;  3FSC A;  2DG9 A;  4TYO A;  1F40 A;  1LQ0 A;  3O5L A;  1ZBW A;  2YSB A;  2MF9 A;  4NNR A;  4AY1 A;  1EIB A;  4WIW A;  2O9O A;  2L2S A;  2K8I A;  4JYS A;  3TDB A;  1E44 A;  1SYT A;  5DIU A;  1D7I A;  5HKG A;  2XP6 A;  1FKL A;  1FFQ A;  3WD0 A;  2DJY A;  2KE0 A;  1P5Q A;  2XP7 A;  2DK1 A;  2KXQ A;  2YAJ B;  1WB0 A;  1ZU8 A;  4Q22 A;  2ZR5 A;  4ODL A;  3KAI A;  3KAD A;  3WQV A;  5HWC A;  3LKX A;  1OWQ A;  3ARQ A;  2ITK A;  4W9O A;  1TCO C;  4R0X A;  2YSG A;  1HJX A;  5B8I C;  2YBU A;  1VF8 A;  2ETN A;  4IT6 A;  2A3A A;  2DSW A;  1TFV A;  2Y8N B;  2G41 A;  4IQC A;  2DSV A;  3ARX A;  4W9P A;  1ROT A;  3ARY A;  4WKF A; 
#chains in the Genus database with same CATH homology
 1HJV A;  1WAW A;  1LL4 A;  3O5E A;  4DH0 A;  3O5O A;  5DO2 A;  2WAE A;  4BF8 A;  1KT0 A;  4P8V A;  1ZBV A;  3CHD A;  3VAW A;  3LKX B;  1K9R A;  1FD9 A;  5U47 A;  4KR0 B;  1SR0 A;  4WKH A;  1XHG A;  1FLC A;  1GPF A;  1WR7 A;  5HUA A;  1TK7 A;  2LPV A;  3MQG A;  4IT4 A;  4REX A;  3O5D A;  4ODO A;  3WD2 A;  1W1Y A;  3O5M A;  4DIP A;  3FSB A;  4E5R A;  1LG2 A;  4DWS D;  1J4I A;  3G6L A;  5DEZ A;  1R9H A;  2AWG A;  3JYJ A;  2FAP A;  2Q5A A;  3FAP A;  1IX5 A;  2PV2 A;  1ZB5 A;  3LE4 A;  3WIJ A;  1EYM A;  4LAX A;  3RME A;  5E62 A;  3MCB A;  1FKF A;  1EG3 A;  3WD4 A;  5JH8 A;  1QZ2 A;  5GQB A;  4MPK A;  2QF8 A;  2KO7 A;  5HBF A;  3RM8 A;  4DT4 A;  3CGM A;  2DK7 A;  1ZBC A;  4MTV A;  4GLX A;  2M08 A;  3WL1 A;  4DRI A;  1HKK A;  2M8J A;  3B9A A;  4DRJ A;  4HBO A;  1H0I A;  2PI6 A;  3MCB B;  2PPN A;  1GUV A;  1FJD A;  1NMV A;  1FKT A;  3OA5 A;  1CTN A;  2PPO A;  2DT1 A;  2MNT A;  3MDY B;  4WJX A;  1C9H A;  3KAF A;  2RUR A;  1OGB A;  3KAG A;  4R5E A;  1QPF A;  2A3C A;  2ZQU A;  1FKG A;  2RQS A;  3WL0 A;  3UI6 A;  1I5H W;  1LJY A;  2LKN A;  3ARW A;  2WLZ A;  1F8A B;  3IK8 A;  4LAV A;  4JFL A;  4TX0 A;  1HKJ A;  1HXV A;  1NWU A;  4G2P A;  4N19 A;  1GOI A;  2RUD A;  1KFW A;  3UQI A;  2M8I A;  5E5W A;  3KAB A;  4W9Q A;  4Z2G A;  1QPL A;  1ZL1 A;  3NTP A;  3AS0 A;  4MSP A;  1ZCN A;  1JMQ A;  1FAP A;  2RSE A;  2WLY A;  1NWT A;  1U79 A;  1D7H A;  1O6W A;  2ZAJ A;  2DMV A;  4Z2J A;  5HTG A;  4ODP A;  3FXY A;  4S3J A;  2XPB A;  3O5P A;  2OWO A;  2YSH A;  4Z2L A;  1JNS A;  3O5F A;  4DRQ A;  1D6O A;  2DG3 A;  1NH6 A;  1H0G A;  3NI6 A;  2WM0 A;  2MLY A;  2G8Z A;  4MNK A;  4IPX A;  1JVW A;  5DIV A;  4C02 B;  2XP3 A;  3B7X A;  4J4O A;  5HT1 A;  3O5J A;  4S3K A;  3ARZ A;  3FY1 A;  3B8S A;  4DRM A;  2XPA A;  1HKI A;  1W9V A;  3BXW A;  1NSG A;  1PBK A;  3B9E A;  2XP5 A;  1Y0O A;  3KAC A;  2L4J A;  4HAR A;  4QT3 A;  5E64 A;  1X6N A;  1BL4 A;  5CQ2 A;  1Q6I A;  3JXV A;  2DT2 A;  2KR7 A;  1E9L A;  1O6I A;  4W5U A;  2OLH A;  4L72 B;  5DIT A;  2DG4 A;  5GPR A;  4U86 A;  1JNE A;  5E66 A;  1M5Y A;  2ZQV A;  3G6M A;  4FN2 A;  1Q6H A;  4ODK A;  4NSB A;  3PRA A;  1J4R A;  3PR9 A;  3IHZ A;  2EZ5 W;  1FKS A;  3ARU A;  1ZBK A;  2WK2 A;  2DT3 A;  3ALG A;  3WQW A;  2RUC A;  1W1T A;  1LL6 A;  3UI4 A;  2DT0 A;  2FKE A;  3TC5 A;  2MDI A;  3AS3 A;  4WK9 A;  3O5Q A;  2JV4 A;  1X6L A;  1FFR A;  2D9F A;  1JNT A;  1J6Y A;  4QIB A;  3EY6 A;  3LUO A;  1XRV A;  4DRK A;  4WKA A;  1E15 A;  3KAH A;  4HBE A;  3GPK A;  1LL7 A;  2M2A A;  1FKH A;  4QT2 A;  4IQ2 A;  3WD3 A;  1JND A;  1WNO A;  4DRO A;  2XP9 A;  4GGQ A;  2E45 A;  4GIV A;  2XP8 A;  4ODN A;  3IKG A;  3O5G A;  3AS2 A;  4TW7 A;  3WKZ A;  2DWV A;  1FKR A;  1A7X A;  1FKB A;  2LAJ A;  3UF8 A;  4JFM A;  3PQH A;  4DWS A;  2JMF A;  1D2K A;  4DRH A;  2M1I A;  1Q6U A;  2LJ4 A;  4TW8 A;  3M7N A;  1W9U A;  3UQB A;  3AS1 A;  3ARR A;  2PPP A;  2M3O W;  3RM9 A;  4O2T A;  1EHN A;  2AOS A;  4QZV B;  1E6N A;  2O92 A;  4ODR A;  4DZ2 A;  3CH9 A;  4Z2I A;  4ODM A;  4DWS B;  1LG1 A;  4XAK A;  3CZ8 A;  2MLX A;  3CHF A;  2RE3 A;  1EG4 A;  4U84 A;  4Z2H A;  2VN1 A;  2ZR4 A;  1ITX A;  2LGO A;  1FKD A;  3JYM A;  1KT1 A;  3ART A;  2ESC A;  2WAD A;  1L1P A;  4NZC A;  4P8X A;  5HW6 A;  3O5K A;  5DF0 A;  4U85 A;  5HW8 A;  3FS8 A;  4LAY A;  3H9R B;  1EQ3 A;  1RP5 A;  1YW5 A;  4ZPT R;  4ITZ A;  3ARP A;  5D75 A;  3O5I A;  4FAP A;  4PTM A;  5GPG A;  3PA7 A;  4JFI A;  3CNG A;  1UR9 A;  2YSI A;  5HWB A;  1YAT A;  4MNL A;  5HW7 A;  2PV1 A;  5I98 A;  3KCE A;  1PIN A;  1NMW A;  4TW6 A;  2BA1 A;  2N87 A;  4MAV A;  1WMV A;  5J6E A;  1ZK6 A;  3WH0 A;  4LGX A;  4ODQ A;  2FDM A;  4TNS A;  4URI A;  4MNJ A;  2UZ5 A;  2OFN A;  2MPH A;  1HKM A;  3W4R A;  4DRP A;  2XP4 A;  1B6C A;  3O5R A;  4MGV A;  3L4H A;  3ALF A;  3ARO A;  1W1P A;  4ZPV R;  3MQH A;  3WD1 A;  3ARV A;  1N1A A;  2A3E A;  3I6C A;  4Q7N A;  4KQZ A;  4A0U A;  4ZPW R;  3RGC A;  4LAW A;  4ML4 A;  2Y78 A;  2ZQT A;  2DSZ A;  3IKD A;  1K9T A;  4ZS6 A;  1E6Z A;  2JX8 A;  1J4H A;  3TCZ A;  1TR8 A;  1E6R A;  5E65 A;  5AHT A;  1E6P A;  1ROU A;  1T11 A;  3PRB A;  1NWS A;  2VCD A;  2IF4 A;  3CHC A;  2YSF A;  3UI5 A;  3NRK A;  4JFJ A;  1HJW A;  1BKF A;  4Z2K A;  3RM4 A;  2ZR6 A;  4G50 A;  1FKK A;  2ZQS A;  3ARS A;  1UR8 A;  4L3N A;  3ODK A;  3OOB A;  3M85 A;  1FKI A;  3CHE A;  3PRD A;  3KZ7 A;  4DWS C;  2KFW A;  1W26 A;  2JXW A;  4DZ3 A;  1D7J A;  3RFW A;  2RUQ A;  2PV3 A;  3QOK A;  2F21 A;  1NWR A;  1W1V A;  2JZV A;  2DSU A;  4JFK A;  2B31 A;  2DPE A;  4MNM A;  1RD6 A;  3B9D A;  4P8W A;  5BXJ A;  1FKJ A;  4DRN A;  4P8U A;  1K9Q A;  2KI3 A;  1W9P A;  4J4N A;  2A3B A;  2F2D A;  2MLZ A;  2PBC A;  2YBT A;  2QRV A;  1EDQ A;  1Q1C A;  4A0T A;  3UQA A;  1OGG A;  2F4E A;  2KGJ A;  3CGN A;  3AQU A;  2IUZ A;  3FSC A;  2DG9 A;  4TYO A;  1F40 A;  1LQ0 A;  3O5L A;  1ZBW A;  2YSB A;  2MF9 A;  4NNR A;  4AY1 A;  1EIB A;  4WIW A;  2O9O A;  2L2S A;  2K8I A;  4JYS A;  3TDB A;  1SYT A;  5DIU A;  1D7I A;  5HKG A;  2XP6 A;  1FKL A;  1FFQ A;  3WD0 A;  2DJY A;  2KE0 A;  1P5Q A;  2XP7 A;  2DK1 A;  2KXQ A;  2YAJ B;  1WB0 A;  1ZU8 A;  4Q22 A;  2ZR5 A;  4ODL A;  3KAI A;  3KAD A;  3WQV A;  5HWC A;  3LKX A;  1OWQ A;  3ARQ A;  2ITK A;  4W9O A;  1TCO C;  4R0X A;  2YSG A;  1HJX A;  5B8I C;  2YBU A;  1VF8 A;  4IT6 A;  2A3A A;  2DSW A;  1TFV A;  2Y8N B;  2G41 A;  4IQC A;  2DSV A;  3ARX A;  4W9P A;  1ROT A;  3ARY A;  4WKF A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...