3KAHA

Structure-guided design of alpha-amino acid-derived pin1 inhibitors
Total Genus 42
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
42
sequence length
157
structure length
145
Chain Sequence
b'LPPGWEKAMSRSSGRVYYFNHITNASQWERPSEPARVRCSHLLVKHSQSRRPSSWRQEKITRTKEEALELINGYIQKIKSGEEDFESLASQFSDCSSAKARGDLGAFSRGQMQKPFEDASFALRTGEMSGPVFTDSGIHIILRTE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Peptidyl-prolyl cis-trans isomerase NIMA-interacting 1
molecule tags Isomerase
source organism Homo sapiens
publication title Structure-guided design of alpha-amino acid-derived Pin1 inhibitors
pubmed doi rcsb
total genus 42
structure length 145
sequence length 157
ec nomenclature ec 5.2.1.8: Peptidylprolyl isomerase.
pdb deposition date 2009-10-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00397 WW WW domain
A PF00639 Rotamase PPIC-type PPIASE domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.20.70.10 Mainly Beta Single Sheet Ubiquitin Ligase Nedd4; Chain: W; Ubiquitin Ligase Nedd4; Chain: W; 3kahA01
3.10.50.40 Alpha Beta Roll Chitinase A; domain 3 Chitinase A; domain 3 3kahA02
1WMVA 1T11A 2FAPA 1BL4A 3O5PA 4J4OA 4DRQA 4DT4A 4DRHA 2ZR6A 1FD9A 1O6WA 1R9HA 2K8IA 2F2DA 2M8JA 1ZCNA 1PINA 1QPLA 3UI4A 2PPPA 2KR7A 5CQ2A 2DMVA 2LGOA 5HKGA 4N19A 5J6EA 2ZQTA 3O5JA 2N87A 2DK1A 1FKSA 2XP8A 3UI5A 1J4RA 2KGJA 3PRDA 4IQ2A 4TW6A 2XP9A 3O5OA 2M08A 4JFMA 4R0XA 2YSIA 3IHZA 3IKDA 4ODKA 2L4JA 2JV4A 3CGNA 3O5MA 4DZ3A 2DG4A 5HW8A 4DRPA 2MLZA 2DK7A 2F21A 1FKFA 2D9FA 1M5YA 1Q6HA 1Q6IA 2M3OW 2VN1A 1JNSA 2DG3A 4DRNA 4QIBA 4NNRA 4MSPA 1NSGA 1QZ2A 2L2SA 2LAJA 3OOBA 3NTPA 1K9RA 1KT0A 1C9HA 2DG9A 1K9QA 1J6YA 2RE3A 1JNTA 2KI3A 2IF4A 3L4HA 3MDYB 1YATA 3M85A 1F8AB 3KAFA 4U84A 3JXVA 2KXQA 2RQSA 3B7XA 1JMQA 3UQBA 1D7JA 3O5IA 4ITZA 4ODLA 5HUAA 1ROTA 4W9OA 1W26A 2MF9A 1KT1A 2EZ5W 2UZ5A 3O5KA 1EG3A 2YSBA 1FAPA 4G50A 3UF8A 5HWCA 4LAXA 2ZR4A 2JXWA 1BKFA 3RGCA 3KAIA 1QPFA 4FN2A 3TDBA 2XP4A 4U85A 4E5RA 2MLYA 3VAWA 4U86A 2DJYA 4J4NA 1U79A 1A7XA 4REXA 3GPKA 1EG4A 1NMWA 3UI6A 1FKBA 2PPNA 2RUDA 4GGQA 3TCZA 5DIVA 1D6OA 4TW8A 2M2AA 2YSHA 1D7IA 1D7HA 1P5QA 4DRKA 5GPGA 3JYJA 4TYOA 4FAPA 1ROUA 4G2PA 3TC5A 1N1AA 4O2TA 2F4EA 5HTGA 4TX0A 3WH0A 1L1PA 1Y0OA 3O5EA 2XPBA 1FKKA 2KO7A 3I6CA 4ODNA 1PBKA 5DITA 3O5FA 2PV3A 2PV1A 2VCDA 4JFIA 2XPAA 3M7NA 2RUCA 2XP6A 2RSEA 3KADA 1FKGA 4TNSA 3KAGA 5DIUA 5HT1A 3NI6A 1WR7A 3NRKA 4TW7A 3EY6A 2JZVA 4W9PA 2ZQSA 2MPHA 4IQCA 2KFWA 1Q6UA 3O5DA 5AHTA 1HXVA 4ODMA 2PV2A 5HW7A 4MGVA 3KABA 2ITKA 1B6CA 3IKGA 1FKRA 1FKIA 1YW5A 1Q1CA 4IPXA 4ODPA 2ZQUA 3LUOA 2RUQA 2AWGA 2Y78A 4DZ2A 3LE4A 4DROA 1EQ3A 1J4HA 1FKLA 2RURA 1NMVA 3UQIA 3H9RB 2PBCA 4QT3A 1EYMA 1FKDA 2MNTA 3RFWA 5HW6A 4JFLA 4LAVA 2YSGA 2XP3A 3FAPA 4W9QA 4DIPA 4DRMA 5BXJA 2XP7A 3O5RA 4ODQA 2ZR5A 2M1IA 3JYMA 2LPVA 3CGMA 4DRIA 4JFKA 3O5LA 1JVWA 3O5GA 1FKJA 4LAWA 4DH0A 3KAHA 1I5HW 3PRBA 2ZAJA 5B8IC 4JFJA 2Q5AA 3ODKA 2JMFA 3KCEA 2KE0A 3IK8A 2BA1A 2M8IA 3CNGA 1FKTA 2YSFA 1TCOC 2XP5A 5HWBA 2LJ4A 3PA7A 4C02B 4DRJA 3O5QA 4JYSA 2DWVA 2E45A 2PPOA 2JX8A 3KZ7A 2MLXA 3UQAA 2MDIA 5D75A 1TK7A 3KACA 5I98A 4GIVA 1F40A 1J4IA 1ZK6A 2FKEA 2LKNA 2OFNA 4ODOA 4LAYA 4QT2A 2ZQVA 4BF8A 1FJDA 4ODRA 1FKHA
chains in the Genus database with same CATH superfamily
1ZBWA 4J4OA 1BL4A 3WD4A 4DRQA 2F2DA 2M8JA 1QPLA 3UI4A 2PPPA 3W4RA 4UDMA 4WK9A 2ZQTA 4S3KA 1LL4A 1FKSA 2XP8A 1TR8A 3WD1A 4IQ2A 3RMEA 3IKDA 4ODKA 2WAEA 2L4JA 1OWQA 3O5MA 3CGNA 4L3NA 4DZ3A 2MLZA 4LGXA 3WIJA 1FFRA 4DRNA 1HKMA 1FFQA 1JNTA 3MDYB 1W1PA 3KAFA 2KXQA 2RQSA 1ROTA 1H0IA 1W26A 4W9OA 3O5KA 2ZR4A 3G6MA 1NWUA 3KAIA 4FN2A 4U85A 2DJYA 1U79A 1A7XA 4REXA 1E44A 3B8SA 1EG4A 1LG2A 1FKBA 3CHCA 1D7IA 1ZU8A 3FS8A 1D7HA 4FAPA 5E65A 1GRJA 3TC5A 4MPKA 5HTGA 2F4EA 1ZL1A 1UR9A 2XPBA 4Z2JA 4DWSC 1OGGA 3O5FA 5E5WA 4JFIA 2IUZA 2XPAA 3M7NA 2XP6A 1UR8A 5E66A 3KAGA 2DT2A 5DIUA 5HT1A 2JZVA 4W9PA 2ZQSA 1ZBKA 1TFVA 1W9PA 3O5DA 4P8XA 4Q7NA 4MGVA 3KABA 1Q1CA 1HJWA 1W1TA 3LUOA 2AWGA 2Y78A 3ARUA 5E62A 1NMVA 3H9RB 1EYMA 2DPEA 4JFLA 2XP3A 1JNEA 2XP7A 3ARTA 1LQ0A 3JYMA 2LPVA 1SYTA 3GU0A 4DRIA 3O5GA 4LAWA 5GPRA 3KAHA 3AS3A 4NZCA 4JFJA 4HARA 1SR0A 2JMFA 2KE0A 3AS1A 3CNGA 2XP5A 2LJ4A 4C02B 4DRJA 1EDQA 3B9DA 3WQWA 2MDIA 1TK7A 3KACA 4GIVA 1ZK6A 4QT2A 2LKNA 2OFNA 5HWCA 1WMVA 2Y8NB 2YBTA 3LKXA 4DT4A 4ZPTR 1ZCNA 1PINA 3MCBB 4HBEA 2A3AA 5CQ2A 2DMVA 5HKGA 5J6EA 2DK1A 3ALGA 1ITXA 4DWSA 1WB0A 1O6IA 4TW6A 3O5OA 2YSIA 3IHZA 2JV4A 1NH6A 1X6NA 2A3BA 5HBFA 1LL7A 2DK7A 1M5YA 1Q6IA 2QRVA 4QIBA 4NNRA 2DSVA 1W9UA 2DG9A 1K9RA 2WADA 3NTPA 1KT0A 4AY1A 4WIWA 2IF4A 3ARRA 3M85A 3FY1A 3UQBA 1D7JA 4ODLA 3CZ8A 2EULA 1ZB5A 4QZVB 5DO2A 3ARZA 4G50A 4P8WA 2JXWA 1GUVA 2XP4A 4W5UA 4U86A 4J4NA 4Q22A 5DIVA 1D6OA 4TW8A 2M2AA 5GPGA 1ROUA 1N1AA 1Y0OA 2KO7A 3ARWA 3I6CA 3ARYA 4IT6A 3MQGA 2RSEA 3KADA 3NI6A 3NRKA 4Z2IA 2MPHA 3WD0A 4ODMA 2PV2A 3ARQA 2B31A 3QOKA 4ODPA 3WD2A 2RUQA 1W1YA 2A3CA 4DZ2A 1J4HA 4MAVA 1FKDA 2OWOA 2MNTA 3RFWA 5HW6A 5BXJA 3ARXA 4ODQA 3CGMA 3BMBA 4ML4A 1HKJA 2WLYA 2M8IA 1FKTA 4Z2GA 5HWBA 1GOIA 2DWVA 2DT3A 4Z2LA 4LAYA 2UZ5A 2ZQVA 1T11A 1W1VA 2FDMA 1R9HA 1O6WA 4DWSD 3RM8A 1E15A 2KR7A 2LGOA 4MTVA 3WQVA 4PTMA 4N19A 2N87A 1XRVA 1EIBA 1J4RA 3PRDA 4R0XA 4MNKA 5HW8A 4DRPA 2F21A 3PQHA 1FKFA 1Q6HA 1JNSA 2DG3A 2DT1A 1NSGA 2L2SA 1KFWA 2LAJA 3OOBA 1C9HA 1EHNA 1J6YA 3L4HA 2P4VA 4R5EA 4ZPWR 4U84A 1JMQA 3O5IA 1JCHB 5HUAA 2MF9A 1KT1A 2EZ5W 1EG3A 2YSBA 4LAXA 3ARSA 2MLYA 4E5RA 3VAWA 3FSBA 3EIPA 1FLCA 1NMWA 3LKXB 2PPNA 2RUDA 3TCZA 4XAKA 3AS0A 4DRKA 4TYOA 4P8VA 5U47A 2DSWA 4DWSB 4P8UA 4TX0A 3O5EA 1NWTA 1FKKA 3CHEA 2PV3A 2VCDA 5E64A 1LG1A 2YBUA 4TNSA 1WR7A 3GTYX 4IQCA 2KFWA 1Q6UA 3PR9A 1B6CA 2ITKA 3IKGA 2QF8A 2ZQUA 1RP5A 3LE4A 2RURA 4MNJA 4QT3A 2PBCA 3WKZA 2G8ZA 4LAVA 3ARPA 1XHGA 1E6NA 5DF0A 3O5RA 2ZR5A 2B5UB 3AS2A 1IX5A 1E6PA 1NWSA 3O5LA 1JVWA 4DH0A 4ZPVR 2AOSA 4Z2KA 3B9EA 4ZS6A 3KCEA 3IK8A 2BA1A 1D2KA 2YSFA 1X6LA 2E45A 1OGBA 2DSUA 4A0UA 2PPOA 4MNLA 5GQBA 1E6RA 3KZ7A 3MQHA 4GLXA 1J4IA 2FKEA 4ODOA 2ESCA 3RM9A 4IT4A 4ODRA 2FAPA 3O5PA 4HBOA 4DRHA 2DT0A 2ZR6A 1FD9A 1K9TA 1GPFA 1ZBCA 2K8IA 4URIA 3O5JA 3UI5A 2KGJA 1HXVA 2XP9A 2M08A 4JFMA 3OA5A 2A3EA 2YAJB 4KQZA 4A0TA 1E9LA 2DG4A 2D9FA 2M3OW 2VN1A 4MSPA 1QZ2A 2DSZA 4Z2HA 1K9QA 2RE3A 2KI3A 1RD6A 1VF8A 1YATA 1F8AB 3JXVA 1HKKA 3B7XA 4S3JA 4ITZA 4WKFA 3B9AA 3UF8A 1FAPA 1LJYA 1CTNA 4WKHA 3PRAA 1BKFA 3RGCA 3FSCA 1QPFA 5JH8A 4L72B 3TDBA 3WD3A 2ETNA 2O9OA 2G41A 3GPKA 3UI6A 4GGQA 2WM0A 1WAWA 3ALFA 2YSHA 4WKAA 1P5QA 3JYJA 4G2PA 2OLHA 4O2TA 3WH0A 1L1PA 5DITA 4ODNA 1PBKA 3ARVA 1E6ZA 2PV1A 2WK2A 4WJXA 3AQUA 3CHFA 2RUCA 3WL0A 1FKGA 2PN0A 4TW7A 1LL6A 3BXWA 3EY6A 1ZBVA 5AHTA 5HW7A 3FXYA 4MNMA 1FKRA 1HKIA 1FKIA 1YW5A 4IPXA 3CHDA 4KR0B 3MCBA 4DROA 1EQ3A 1FKLA 1WNOA 2WLZA 3UQIA 1W9VA 2PI6A 3G6LA 2YSGA 2F23A 3FAPA 4W9QA 1HJXA 3RM4A 4DIPA 1H0GA 4DRMA 1NWRA 2M1IA 3WL1A 4JFKA 4NSBA 1FKJA 1JNDA 3PRBA 1I5HW 2ZAJA 5B8IC 2Q5AA 3ODKA 1TCOC 3PA7A 2O92A 3O5QA 4JYSA 3CH9A 2JX8A 3AROA 2MLXA 3UQAA 1HJVA 5D75A 5I98A 1F40A 5DEZA 1FJDA 4BF8A 1FKHA
chains in the Genus database with same CATH topology
1ZBWA 4J4OA 1BL4A 3WD4A 4DRQA 2F2DA 2M8JA 1QPLA 3UI4A 2PPPA 3W4RA 4WK9A 2ZQTA 4S3KA 1LL4A 1FKSA 2XP8A 1TR8A 3WD1A 4IQ2A 3RMEA 3IKDA 4ODKA 2WAEA 2L4JA 1OWQA 3O5MA 3CGNA 4L3NA 4DZ3A 2MLZA 4LGXA 3WIJA 1FFRA 4DRNA 1HKMA 1FFQA 1JNTA 3MDYB 1W1PA 3KAFA 2KXQA 2RQSA 1ROTA 1H0IA 1W26A 4W9OA 3O5KA 2ZR4A 3G6MA 1NWUA 3KAIA 4FN2A 4U85A 2DJYA 1U79A 1A7XA 4REXA 3B8SA 1EG4A 1LG2A 1FKBA 3CHCA 1D7IA 1ZU8A 3FS8A 1D7HA 4FAPA 5E65A 4MPKA 3TC5A 5HTGA 2F4EA 1ZL1A 1UR9A 2XPBA 4Z2JA 4DWSC 1OGGA 3O5FA 5E5WA 4JFIA 2IUZA 2XPAA 3M7NA 2XP6A 1UR8A 5E66A 3KAGA 2DT2A 5DIUA 5HT1A 2JZVA 4W9PA 2ZQSA 1ZBKA 1TFVA 1W9PA 3O5DA 4P8XA 4Q7NA 4MGVA 3KABA 1Q1CA 1HJWA 1W1TA 3LUOA 2AWGA 2Y78A 3ARUA 5E62A 1NMVA 3H9RB 1EYMA 2DPEA 4JFLA 2XP3A 1JNEA 2XP7A 3ARTA 1LQ0A 3JYMA 2LPVA 1SYTA 4DRIA 3O5GA 4LAWA 5GPRA 3KAHA 3AS3A 4NZCA 4JFJA 4HARA 1SR0A 2JMFA 2KE0A 3AS1A 3CNGA 2XP5A 2LJ4A 4C02B 4DRJA 1EDQA 3B9DA 3WQWA 2MDIA 1TK7A 3KACA 4GIVA 1ZK6A 4QT2A 2LKNA 2OFNA 5HWCA 1WMVA 2Y8NB 2YBTA 3LKXA 4DT4A 4ZPTR 1ZCNA 1PINA 3MCBB 4HBEA 2A3AA 5CQ2A 2DMVA 5HKGA 5J6EA 2DK1A 3ALGA 1ITXA 4DWSA 1WB0A 1O6IA 4TW6A 3O5OA 2YSIA 3IHZA 2JV4A 1NH6A 1X6NA 2A3BA 5HBFA 1LL7A 2DK7A 1M5YA 1Q6IA 2QRVA 4QIBA 4NNRA 2DSVA 1W9UA 2DG9A 1K9RA 2WADA 3NTPA 1KT0A 4AY1A 4WIWA 2IF4A 3ARRA 3M85A 3FY1A 3UQBA 1D7JA 4ODLA 3CZ8A 1ZB5A 4QZVB 5DO2A 3ARZA 4G50A 4P8WA 2JXWA 1GUVA 2XP4A 4W5UA 4U86A 4J4NA 4Q22A 5DIVA 1D6OA 4TW8A 2M2AA 5GPGA 1ROUA 1N1AA 1Y0OA 2KO7A 3ARWA 3I6CA 3ARYA 4IT6A 3MQGA 2RSEA 3KADA 3NI6A 3NRKA 4Z2IA 2MPHA 3WD0A 4ODMA 2PV2A 3ARQA 2B31A 3QOKA 4ODPA 3WD2A 2RUQA 1W1YA 2A3CA 4DZ2A 1J4HA 4MAVA 1FKDA 2OWOA 2MNTA 3RFWA 5HW6A 5BXJA 3ARXA 4ODQA 3CGMA 4ML4A 1HKJA 2WLYA 2M8IA 1FKTA 4Z2GA 5HWBA 1GOIA 2DWVA 2DT3A 4Z2LA 4LAYA 2UZ5A 2ZQVA 1T11A 1W1VA 2FDMA 1R9HA 1O6WA 4DWSD 3RM8A 1E15A 2KR7A 2LGOA 4MTVA 3WQVA 4PTMA 4N19A 2N87A 1XRVA 1EIBA 1J4RA 3PRDA 4R0XA 4MNKA 5HW8A 4DRPA 2F21A 3PQHA 1FKFA 1Q6HA 1JNSA 2DG3A 2DT1A 1NSGA 2L2SA 1KFWA 2LAJA 3OOBA 1C9HA 1EHNA 1J6YA 3L4HA 4R5EA 4ZPWR 4U84A 1JMQA 3O5IA 5HUAA 2MF9A 1KT1A 2EZ5W 1EG3A 2YSBA 4LAXA 3ARSA 2MLYA 4E5RA 3VAWA 3FSBA 1FLCA 1NMWA 3LKXB 2PPNA 2RUDA 3TCZA 4XAKA 3AS0A 4DRKA 4TYOA 4P8VA 5U47A 2DSWA 4DWSB 4P8UA 4TX0A 3O5EA 1NWTA 1FKKA 3CHEA 2PV3A 2VCDA 5E64A 1LG1A 2YBUA 4TNSA 1WR7A 4IQCA 2KFWA 1Q6UA 3PR9A 1B6CA 2ITKA 3IKGA 2QF8A 2ZQUA 1RP5A 3LE4A 2RURA 4MNJA 4QT3A 2PBCA 3WKZA 2G8ZA 4LAVA 3ARPA 1XHGA 1E6NA 5DF0A 3O5RA 2ZR5A 3AS2A 1IX5A 1E6PA 1NWSA 3O5LA 1JVWA 4DH0A 4ZPVR 2AOSA 4Z2KA 3B9EA 4ZS6A 3KCEA 3IK8A 2BA1A 1D2KA 2YSFA 1X6LA 2E45A 1OGBA 2DSUA 4A0UA 2PPOA 4MNLA 5GQBA 1E6RA 3KZ7A 3MQHA 4GLXA 1J4IA 2FKEA 4ODOA 2ESCA 3RM9A 4IT4A 4ODRA 2FAPA 3O5PA 4HBOA 4DRHA 2DT0A 2ZR6A 1FD9A 1K9TA 1GPFA 1ZBCA 2K8IA 4URIA 3O5JA 3UI5A 2KGJA 1HXVA 2XP9A 2M08A 4JFMA 3OA5A 2A3EA 2YAJB 4KQZA 4A0TA 1E9LA 2DG4A 2D9FA 2M3OW 2VN1A 4MSPA 1QZ2A 2DSZA 4Z2HA 1K9QA 2RE3A 2KI3A 1RD6A 1VF8A 1YATA 1F8AB 3JXVA 1HKKA 3B7XA 4S3JA 4ITZA 4WKFA 3B9AA 3UF8A 1FAPA 1LJYA 1CTNA 4WKHA 3PRAA 1BKFA 3RGCA 3FSCA 1QPFA 5JH8A 4L72B 3TDBA 3WD3A 2O9OA 2G41A 3GPKA 3UI6A 4GGQA 2WM0A 1WAWA 3ALFA 2YSHA 4WKAA 1P5QA 3JYJA 4G2PA 2OLHA 4O2TA 3WH0A 1L1PA 5DITA 4ODNA 1PBKA 3ARVA 1E6ZA 2PV1A 2WK2A 4WJXA 3AQUA 3CHFA 2RUCA 3WL0A 1FKGA 4TW7A 1LL6A 3BXWA 3EY6A 1ZBVA 5AHTA 5HW7A 3FXYA 4MNMA 1FKRA 1HKIA 1FKIA 1YW5A 4IPXA 3CHDA 4KR0B 3MCBA 4DROA 1EQ3A 1FKLA 1WNOA 2WLZA 3UQIA 1W9VA 2PI6A 3G6LA 2YSGA 4DIPA 3FAPA 4W9QA 1HJXA 3RM4A 4DRMA 1H0GA 1NWRA 2M1IA 3WL1A 4JFKA 4NSBA 1FKJA 1JNDA 3PRBA 1I5HW 2ZAJA 5B8IC 2Q5AA 3ODKA 1TCOC 3PA7A 2O92A 3O5QA 4JYSA 3CH9A 2JX8A 3AROA 2MLXA 3UQAA 1HJVA 5D75A 5I98A 1F40A 5DEZA 1FJDA 4BF8A 1FKHA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1WMV A;  1T11 A;  2FAP A;  1BL4 A;  3O5P A;  4J4O A;  4DRQ A;  4DT4 A;  4DRH A;  2ZR6 A;  1FD9 A;  1O6W A;  1R9H A;  2K8I A;  2F2D A;  2M8J A;  1ZCN A;  1PIN A;  1QPL A;  3UI4 A;  2PPP A;  2KR7 A;  5CQ2 A;  2DMV A;  2LGO A;  5HKG A;  4N19 A;  5J6E A;  2ZQT A;  3O5J A;  2N87 A;  2DK1 A;  1FKS A;  2XP8 A;  3UI5 A;  1J4R A;  2KGJ A;  3PRD A;  4IQ2 A;  4TW6 A;  2XP9 A;  3O5O A;  2M08 A;  4JFM A;  4R0X A;  2YSI A;  3IHZ A;  3IKD A;  4ODK A;  2L4J A;  2JV4 A;  3CGN A;  3O5M A;  4DZ3 A;  2DG4 A;  5HW8 A;  4DRP A;  2MLZ A;  2DK7 A;  2F21 A;  1FKF A;  2D9F A;  1M5Y A;  1Q6H A;  1Q6I A;  2M3O W;  2VN1 A;  1JNS A;  2DG3 A;  4DRN A;  4QIB A;  4NNR A;  4MSP A;  1NSG A;  1QZ2 A;  2L2S A;  2LAJ A;  3OOB A;  3NTP A;  1K9R A;  1KT0 A;  1C9H A;  2DG9 A;  1K9Q A;  1J6Y A;  2RE3 A;  1JNT A;  2KI3 A;  2IF4 A;  3L4H A;  3MDY B;  1YAT A;  3M85 A;  1F8A B;  3KAF A;  4U84 A;  3JXV A;  2KXQ A;  2RQS A;  3B7X A;  1JMQ A;  3UQB A;  1D7J A;  3O5I A;  4ITZ A;  4ODL A;  5HUA A;  1ROT A;  4W9O A;  1W26 A;  2MF9 A;  1KT1 A;  2EZ5 W;  2UZ5 A;  3O5K A;  1EG3 A;  2YSB A;  1FAP A;  4G50 A;  3UF8 A;  5HWC A;  4LAX A;  2ZR4 A;  2JXW A;  1BKF A;  3RGC A;  3KAI A;  1QPF A;  4FN2 A;  3TDB A;  2XP4 A;  4U85 A;  4E5R A;  2MLY A;  3VAW A;  4U86 A;  2DJY A;  4J4N A;  1U79 A;  1A7X A;  4REX A;  3GPK A;  1EG4 A;  1NMW A;  3UI6 A;  1FKB A;  2PPN A;  2RUD A;  4GGQ A;  3TCZ A;  5DIV A;  1D6O A;  4TW8 A;  2M2A A;  2YSH A;  1D7I A;  1D7H A;  1P5Q A;  4DRK A;  5GPG A;  3JYJ A;  4TYO A;  4FAP A;  1ROU A;  4G2P A;  3TC5 A;  1N1A A;  4O2T A;  2F4E A;  5HTG A;  4TX0 A;  3WH0 A;  1L1P A;  1Y0O A;  3O5E A;  2XPB A;  1FKK A;  2KO7 A;  3I6C A;  4ODN A;  1PBK A;  5DIT A;  3O5F A;  2PV3 A;  2PV1 A;  2VCD A;  4JFI A;  2XPA A;  3M7N A;  2RUC A;  2XP6 A;  2RSE A;  3KAD A;  1FKG A;  4TNS A;  3KAG A;  5DIU A;  5HT1 A;  3NI6 A;  1WR7 A;  3NRK A;  4TW7 A;  3EY6 A;  2JZV A;  4W9P A;  2ZQS A;  2MPH A;  4IQC A;  2KFW A;  1Q6U A;  3O5D A;  5AHT A;  1HXV A;  4ODM A;  2PV2 A;  5HW7 A;  4MGV A;  3KAB A;  2ITK A;  1B6C A;  3IKG A;  1FKR A;  1FKI A;  1YW5 A;  1Q1C A;  4IPX A;  4ODP A;  2ZQU A;  3LUO A;  2RUQ A;  2AWG A;  2Y78 A;  4DZ2 A;  3LE4 A;  4DRO A;  1EQ3 A;  1J4H A;  1FKL A;  2RUR A;  1NMV A;  3UQI A;  3H9R B;  2PBC A;  4QT3 A;  1EYM A;  1FKD A;  2MNT A;  3RFW A;  5HW6 A;  4JFL A;  4LAV A;  2YSG A;  2XP3 A;  3FAP A;  4W9Q A;  4DIP A;  4DRM A;  5BXJ A;  2XP7 A;  3O5R A;  4ODQ A;  2ZR5 A;  2M1I A;  3JYM A;  2LPV A;  3CGM A;  4DRI A;  4JFK A;  3O5L A;  1JVW A;  3O5G A;  1FKJ A;  4LAW A;  4DH0 A;  3KAH A;  1I5H W;  3PRB A;  2ZAJ A;  5B8I C;  4JFJ A;  2Q5A A;  3ODK A;  2JMF A;  3KCE A;  2KE0 A;  3IK8 A;  2BA1 A;  2M8I A;  3CNG A;  1FKT A;  2YSF A;  1TCO C;  2XP5 A;  5HWB A;  2LJ4 A;  3PA7 A;  4C02 B;  4DRJ A;  3O5Q A;  4JYS A;  2DWV A;  2E45 A;  2PPO A;  2JX8 A;  3KZ7 A;  2MLX A;  3UQA A;  2MDI A;  5D75 A;  1TK7 A;  3KAC A;  5I98 A;  4GIV A;  1F40 A;  1J4I A;  1ZK6 A;  2FKE A;  2LKN A;  2OFN A;  4ODO A;  4LAY A;  4QT2 A;  2ZQV A;  4BF8 A;  1FJD A;  4ODR A;  1FKH A; 
#chains in the Genus database with same CATH topology
 1ZBW A;  4J4O A;  1BL4 A;  3WD4 A;  4DRQ A;  2F2D A;  2M8J A;  1QPL A;  3UI4 A;  2PPP A;  3W4R A;  4UDM A;  4WK9 A;  2ZQT A;  4S3K A;  1LL4 A;  1FKS A;  2XP8 A;  1TR8 A;  3WD1 A;  4IQ2 A;  3RME A;  3IKD A;  4ODK A;  2WAE A;  2L4J A;  1OWQ A;  3O5M A;  3CGN A;  4L3N A;  4DZ3 A;  2MLZ A;  4LGX A;  3WIJ A;  1FFR A;  4DRN A;  1HKM A;  1FFQ A;  1JNT A;  3MDY B;  1W1P A;  3KAF A;  2KXQ A;  2RQS A;  1ROT A;  1H0I A;  1W26 A;  4W9O A;  3O5K A;  2ZR4 A;  3G6M A;  1NWU A;  3KAI A;  4FN2 A;  4U85 A;  2DJY A;  1U79 A;  1A7X A;  4REX A;  1E44 A;  3B8S A;  1EG4 A;  1LG2 A;  1FKB A;  3CHC A;  1D7I A;  1ZU8 A;  3FS8 A;  1D7H A;  4FAP A;  5E65 A;  1GRJ A;  3TC5 A;  4MPK A;  5HTG A;  2F4E A;  1ZL1 A;  1UR9 A;  2XPB A;  4Z2J A;  4DWS C;  1OGG A;  3O5F A;  5E5W A;  4JFI A;  2IUZ A;  2XPA A;  3M7N A;  2XP6 A;  1UR8 A;  5E66 A;  3KAG A;  2DT2 A;  5DIU A;  5HT1 A;  2JZV A;  4W9P A;  2ZQS A;  1ZBK A;  1TFV A;  1W9P A;  3O5D A;  4P8X A;  4Q7N A;  4MGV A;  3KAB A;  1Q1C A;  1HJW A;  1W1T A;  3LUO A;  2AWG A;  2Y78 A;  3ARU A;  5E62 A;  1NMV A;  3H9R B;  1EYM A;  2DPE A;  4JFL A;  2XP3 A;  1JNE A;  2XP7 A;  3ART A;  1LQ0 A;  3JYM A;  2LPV A;  1SYT A;  3GU0 A;  4DRI A;  3O5G A;  4LAW A;  5GPR A;  3KAH A;  3AS3 A;  4NZC A;  4JFJ A;  4HAR A;  1SR0 A;  2JMF A;  2KE0 A;  3AS1 A;  3CNG A;  2XP5 A;  2LJ4 A;  4C02 B;  4DRJ A;  1EDQ A;  3B9D A;  3WQW A;  2MDI A;  1TK7 A;  3KAC A;  4GIV A;  1ZK6 A;  4QT2 A;  2LKN A;  2OFN A;  5HWC A;  1WMV A;  2Y8N B;  2YBT A;  3LKX A;  4DT4 A;  4ZPT R;  1ZCN A;  1PIN A;  3MCB B;  4HBE A;  2A3A A;  5CQ2 A;  2DMV A;  5HKG A;  5J6E A;  2DK1 A;  3ALG A;  1ITX A;  4DWS A;  1WB0 A;  1O6I A;  4TW6 A;  3O5O A;  2YSI A;  3IHZ A;  2JV4 A;  1NH6 A;  1X6N A;  2A3B A;  5HBF A;  1LL7 A;  2DK7 A;  1M5Y A;  1Q6I A;  2QRV A;  4QIB A;  4NNR A;  2DSV A;  1W9U A;  2DG9 A;  1K9R A;  2WAD A;  3NTP A;  1KT0 A;  4AY1 A;  4WIW A;  2IF4 A;  3ARR A;  3M85 A;  3FY1 A;  3UQB A;  1D7J A;  4ODL A;  3CZ8 A;  2EUL A;  1ZB5 A;  4QZV B;  5DO2 A;  3ARZ A;  4G50 A;  4P8W A;  2JXW A;  1GUV A;  2XP4 A;  4W5U A;  4U86 A;  4J4N A;  4Q22 A;  5DIV A;  1D6O A;  4TW8 A;  2M2A A;  5GPG A;  1ROU A;  1N1A A;  1Y0O A;  2KO7 A;  3ARW A;  3I6C A;  3ARY A;  4IT6 A;  3MQG A;  2RSE A;  3KAD A;  3NI6 A;  3NRK A;  4Z2I A;  2MPH A;  3WD0 A;  4ODM A;  2PV2 A;  3ARQ A;  2B31 A;  3QOK A;  4ODP A;  3WD2 A;  2RUQ A;  1W1Y A;  2A3C A;  4DZ2 A;  1J4H A;  4MAV A;  1FKD A;  2OWO A;  2MNT A;  3RFW A;  5HW6 A;  5BXJ A;  3ARX A;  4ODQ A;  3CGM A;  3BMB A;  4ML4 A;  1HKJ A;  2WLY A;  2M8I A;  1FKT A;  4Z2G A;  5HWB A;  1GOI A;  2DWV A;  2DT3 A;  4Z2L A;  4LAY A;  2UZ5 A;  2ZQV A;  1T11 A;  1W1V A;  2FDM A;  1R9H A;  1O6W A;  4DWS D;  3RM8 A;  1E15 A;  2KR7 A;  2LGO A;  4MTV A;  3WQV A;  4PTM A;  4N19 A;  2N87 A;  1XRV A;  1EIB A;  1J4R A;  3PRD A;  4R0X A;  4MNK A;  5HW8 A;  4DRP A;  2F21 A;  3PQH A;  1FKF A;  1Q6H A;  1JNS A;  2DG3 A;  2DT1 A;  1NSG A;  2L2S A;  1KFW A;  2LAJ A;  3OOB A;  1C9H A;  1EHN A;  1J6Y A;  3L4H A;  2P4V A;  4R5E A;  4ZPW R;  4U84 A;  1JMQ A;  3O5I A;  1JCH B;  5HUA A;  2MF9 A;  1KT1 A;  2EZ5 W;  1EG3 A;  2YSB A;  4LAX A;  3ARS A;  2MLY A;  4E5R A;  3VAW A;  3FSB A;  3EIP A;  1FLC A;  1NMW A;  3LKX B;  2PPN A;  2RUD A;  3TCZ A;  4XAK A;  3AS0 A;  4DRK A;  4TYO A;  4P8V A;  5U47 A;  2DSW A;  4DWS B;  4P8U A;  4TX0 A;  3O5E A;  1NWT A;  1FKK A;  3CHE A;  2PV3 A;  2VCD A;  5E64 A;  1LG1 A;  2YBU A;  4TNS A;  1WR7 A;  3GTY X;  4IQC A;  2KFW A;  1Q6U A;  3PR9 A;  1B6C A;  2ITK A;  3IKG A;  2QF8 A;  2ZQU A;  1RP5 A;  3LE4 A;  2RUR A;  4MNJ A;  4QT3 A;  2PBC A;  3WKZ A;  2G8Z A;  4LAV A;  3ARP A;  1XHG A;  1E6N A;  5DF0 A;  3O5R A;  2ZR5 A;  2B5U B;  3AS2 A;  1IX5 A;  1E6P A;  1NWS A;  3O5L A;  1JVW A;  4DH0 A;  4ZPV R;  2AOS A;  4Z2K A;  3B9E A;  4ZS6 A;  3KCE A;  3IK8 A;  2BA1 A;  1D2K A;  2YSF A;  1X6L A;  2E45 A;  1OGB A;  2DSU A;  4A0U A;  2PPO A;  4MNL A;  5GQB A;  1E6R A;  3KZ7 A;  3MQH A;  4GLX A;  1J4I A;  2FKE A;  4ODO A;  2ESC A;  3RM9 A;  4IT4 A;  4ODR A;  2FAP A;  3O5P A;  4HBO A;  4DRH A;  2DT0 A;  2ZR6 A;  1FD9 A;  1K9T A;  1GPF A;  1ZBC A;  2K8I A;  4URI A;  3O5J A;  3UI5 A;  2KGJ A;  1HXV A;  2XP9 A;  2M08 A;  4JFM A;  3OA5 A;  2A3E A;  2YAJ B;  4KQZ A;  4A0T A;  1E9L A;  2DG4 A;  2D9F A;  2M3O W;  2VN1 A;  4MSP A;  1QZ2 A;  2DSZ A;  4Z2H A;  1K9Q A;  2RE3 A;  2KI3 A;  1RD6 A;  1VF8 A;  1YAT A;  1F8A B;  3JXV A;  1HKK A;  3B7X A;  4S3J A;  4ITZ A;  4WKF A;  3B9A A;  3UF8 A;  1FAP A;  1LJY A;  1CTN A;  4WKH A;  3PRA A;  1BKF A;  3RGC A;  3FSC A;  1QPF A;  5JH8 A;  4L72 B;  3TDB A;  3WD3 A;  2ETN A;  2O9O A;  2G41 A;  3GPK A;  3UI6 A;  4GGQ A;  2WM0 A;  1WAW A;  3ALF A;  2YSH A;  4WKA A;  1P5Q A;  3JYJ A;  4G2P A;  2OLH A;  4O2T A;  3WH0 A;  1L1P A;  5DIT A;  4ODN A;  1PBK A;  3ARV A;  1E6Z A;  2PV1 A;  2WK2 A;  4WJX A;  3AQU A;  3CHF A;  2RUC A;  3WL0 A;  1FKG A;  2PN0 A;  4TW7 A;  1LL6 A;  3BXW A;  3EY6 A;  1ZBV A;  5AHT A;  5HW7 A;  3FXY A;  4MNM A;  1FKR A;  1HKI A;  1FKI A;  1YW5 A;  4IPX A;  3CHD A;  4KR0 B;  3MCB A;  4DRO A;  1EQ3 A;  1FKL A;  1WNO A;  2WLZ A;  3UQI A;  1W9V A;  2PI6 A;  3G6L A;  2YSG A;  2F23 A;  3FAP A;  4W9Q A;  1HJX A;  3RM4 A;  4DIP A;  1H0G A;  4DRM A;  1NWR A;  2M1I A;  3WL1 A;  4JFK A;  4NSB A;  1FKJ A;  1JND A;  3PRB A;  1I5H W;  2ZAJ A;  5B8I C;  2Q5A A;  3ODK A;  1TCO C;  3PA7 A;  2O92 A;  3O5Q A;  4JYS A;  3CH9 A;  2JX8 A;  3ARO A;  2MLX A;  3UQA A;  1HJV A;  5D75 A;  5I98 A;  1F40 A;  5DEZ A;  1FJD A;  4BF8 A;  1FKH A; 
#chains in the Genus database with same CATH homology
 1ZBW A;  4J4O A;  1BL4 A;  3WD4 A;  4DRQ A;  2F2D A;  2M8J A;  1QPL A;  3UI4 A;  2PPP A;  3W4R A;  4WK9 A;  2ZQT A;  4S3K A;  1LL4 A;  1FKS A;  2XP8 A;  1TR8 A;  3WD1 A;  4IQ2 A;  3RME A;  3IKD A;  4ODK A;  2WAE A;  2L4J A;  1OWQ A;  3O5M A;  3CGN A;  4L3N A;  4DZ3 A;  2MLZ A;  4LGX A;  3WIJ A;  1FFR A;  4DRN A;  1HKM A;  1FFQ A;  1JNT A;  3MDY B;  1W1P A;  3KAF A;  2KXQ A;  2RQS A;  1ROT A;  1H0I A;  1W26 A;  4W9O A;  3O5K A;  2ZR4 A;  3G6M A;  1NWU A;  3KAI A;  4FN2 A;  4U85 A;  2DJY A;  1U79 A;  1A7X A;  4REX A;  3B8S A;  1EG4 A;  1LG2 A;  1FKB A;  3CHC A;  1D7I A;  1ZU8 A;  3FS8 A;  1D7H A;  4FAP A;  5E65 A;  4MPK A;  3TC5 A;  5HTG A;  2F4E A;  1ZL1 A;  1UR9 A;  2XPB A;  4Z2J A;  4DWS C;  1OGG A;  3O5F A;  5E5W A;  4JFI A;  2IUZ A;  2XPA A;  3M7N A;  2XP6 A;  1UR8 A;  5E66 A;  3KAG A;  2DT2 A;  5DIU A;  5HT1 A;  2JZV A;  4W9P A;  2ZQS A;  1ZBK A;  1TFV A;  1W9P A;  3O5D A;  4P8X A;  4Q7N A;  4MGV A;  3KAB A;  1Q1C A;  1HJW A;  1W1T A;  3LUO A;  2AWG A;  2Y78 A;  3ARU A;  5E62 A;  1NMV A;  3H9R B;  1EYM A;  2DPE A;  4JFL A;  2XP3 A;  1JNE A;  2XP7 A;  3ART A;  1LQ0 A;  3JYM A;  2LPV A;  1SYT A;  4DRI A;  3O5G A;  4LAW A;  5GPR A;  3KAH A;  3AS3 A;  4NZC A;  4JFJ A;  4HAR A;  1SR0 A;  2JMF A;  2KE0 A;  3AS1 A;  3CNG A;  2XP5 A;  2LJ4 A;  4C02 B;  4DRJ A;  1EDQ A;  3B9D A;  3WQW A;  2MDI A;  1TK7 A;  3KAC A;  4GIV A;  1ZK6 A;  4QT2 A;  2LKN A;  2OFN A;  5HWC A;  1WMV A;  2Y8N B;  2YBT A;  3LKX A;  4DT4 A;  4ZPT R;  1ZCN A;  1PIN A;  3MCB B;  4HBE A;  2A3A A;  5CQ2 A;  2DMV A;  5HKG A;  5J6E A;  2DK1 A;  3ALG A;  1ITX A;  4DWS A;  1WB0 A;  1O6I A;  4TW6 A;  3O5O A;  2YSI A;  3IHZ A;  2JV4 A;  1NH6 A;  1X6N A;  2A3B A;  5HBF A;  1LL7 A;  2DK7 A;  1M5Y A;  1Q6I A;  2QRV A;  4QIB A;  4NNR A;  2DSV A;  1W9U A;  2DG9 A;  1K9R A;  2WAD A;  3NTP A;  1KT0 A;  4AY1 A;  4WIW A;  2IF4 A;  3ARR A;  3M85 A;  3FY1 A;  3UQB A;  1D7J A;  4ODL A;  3CZ8 A;  1ZB5 A;  4QZV B;  5DO2 A;  3ARZ A;  4G50 A;  4P8W A;  2JXW A;  1GUV A;  2XP4 A;  4W5U A;  4U86 A;  4J4N A;  4Q22 A;  5DIV A;  1D6O A;  4TW8 A;  2M2A A;  5GPG A;  1ROU A;  1N1A A;  1Y0O A;  2KO7 A;  3ARW A;  3I6C A;  3ARY A;  4IT6 A;  3MQG A;  2RSE A;  3KAD A;  3NI6 A;  3NRK A;  4Z2I A;  2MPH A;  3WD0 A;  4ODM A;  2PV2 A;  3ARQ A;  2B31 A;  3QOK A;  4ODP A;  3WD2 A;  2RUQ A;  1W1Y A;  2A3C A;  4DZ2 A;  1J4H A;  4MAV A;  1FKD A;  2OWO A;  2MNT A;  3RFW A;  5HW6 A;  5BXJ A;  3ARX A;  4ODQ A;  3CGM A;  4ML4 A;  1HKJ A;  2WLY A;  2M8I A;  1FKT A;  4Z2G A;  5HWB A;  1GOI A;  2DWV A;  2DT3 A;  4Z2L A;  4LAY A;  2UZ5 A;  2ZQV A;  1T11 A;  1W1V A;  2FDM A;  1R9H A;  1O6W A;  4DWS D;  3RM8 A;  1E15 A;  2KR7 A;  2LGO A;  4MTV A;  3WQV A;  4PTM A;  4N19 A;  2N87 A;  1XRV A;  1EIB A;  1J4R A;  3PRD A;  4R0X A;  4MNK A;  5HW8 A;  4DRP A;  2F21 A;  3PQH A;  1FKF A;  1Q6H A;  1JNS A;  2DG3 A;  2DT1 A;  1NSG A;  2L2S A;  1KFW A;  2LAJ A;  3OOB A;  1C9H A;  1EHN A;  1J6Y A;  3L4H A;  4R5E A;  4ZPW R;  4U84 A;  1JMQ A;  3O5I A;  5HUA A;  2MF9 A;  1KT1 A;  2EZ5 W;  1EG3 A;  2YSB A;  4LAX A;  3ARS A;  2MLY A;  4E5R A;  3VAW A;  3FSB A;  1FLC A;  1NMW A;  3LKX B;  2PPN A;  2RUD A;  3TCZ A;  4XAK A;  3AS0 A;  4DRK A;  4TYO A;  4P8V A;  5U47 A;  2DSW A;  4DWS B;  4P8U A;  4TX0 A;  3O5E A;  1NWT A;  1FKK A;  3CHE A;  2PV3 A;  2VCD A;  5E64 A;  1LG1 A;  2YBU A;  4TNS A;  1WR7 A;  4IQC A;  2KFW A;  1Q6U A;  3PR9 A;  1B6C A;  2ITK A;  3IKG A;  2QF8 A;  2ZQU A;  1RP5 A;  3LE4 A;  2RUR A;  4MNJ A;  4QT3 A;  2PBC A;  3WKZ A;  2G8Z A;  4LAV A;  3ARP A;  1XHG A;  1E6N A;  5DF0 A;  3O5R A;  2ZR5 A;  3AS2 A;  1IX5 A;  1E6P A;  1NWS A;  3O5L A;  1JVW A;  4DH0 A;  4ZPV R;  2AOS A;  4Z2K A;  3B9E A;  4ZS6 A;  3KCE A;  3IK8 A;  2BA1 A;  1D2K A;  2YSF A;  1X6L A;  2E45 A;  1OGB A;  2DSU A;  4A0U A;  2PPO A;  4MNL A;  5GQB A;  1E6R A;  3KZ7 A;  3MQH A;  4GLX A;  1J4I A;  2FKE A;  4ODO A;  2ESC A;  3RM9 A;  4IT4 A;  4ODR A;  2FAP A;  3O5P A;  4HBO A;  4DRH A;  2DT0 A;  2ZR6 A;  1FD9 A;  1K9T A;  1GPF A;  1ZBC A;  2K8I A;  4URI A;  3O5J A;  3UI5 A;  2KGJ A;  1HXV A;  2XP9 A;  2M08 A;  4JFM A;  3OA5 A;  2A3E A;  2YAJ B;  4KQZ A;  4A0T A;  1E9L A;  2DG4 A;  2D9F A;  2M3O W;  2VN1 A;  4MSP A;  1QZ2 A;  2DSZ A;  4Z2H A;  1K9Q A;  2RE3 A;  2KI3 A;  1RD6 A;  1VF8 A;  1YAT A;  1F8A B;  3JXV A;  1HKK A;  3B7X A;  4S3J A;  4ITZ A;  4WKF A;  3B9A A;  3UF8 A;  1FAP A;  1LJY A;  1CTN A;  4WKH A;  3PRA A;  1BKF A;  3RGC A;  3FSC A;  1QPF A;  5JH8 A;  4L72 B;  3TDB A;  3WD3 A;  2O9O A;  2G41 A;  3GPK A;  3UI6 A;  4GGQ A;  2WM0 A;  1WAW A;  3ALF A;  2YSH A;  4WKA A;  1P5Q A;  3JYJ A;  4G2P A;  2OLH A;  4O2T A;  3WH0 A;  1L1P A;  5DIT A;  4ODN A;  1PBK A;  3ARV A;  1E6Z A;  2PV1 A;  2WK2 A;  4WJX A;  3AQU A;  3CHF A;  2RUC A;  3WL0 A;  1FKG A;  4TW7 A;  1LL6 A;  3BXW A;  3EY6 A;  1ZBV A;  5AHT A;  5HW7 A;  3FXY A;  4MNM A;  1FKR A;  1HKI A;  1FKI A;  1YW5 A;  4IPX A;  3CHD A;  4KR0 B;  3MCB A;  4DRO A;  1EQ3 A;  1FKL A;  1WNO A;  2WLZ A;  3UQI A;  1W9V A;  2PI6 A;  3G6L A;  2YSG A;  4DIP A;  3FAP A;  4W9Q A;  1HJX A;  3RM4 A;  4DRM A;  1H0G A;  1NWR A;  2M1I A;  3WL1 A;  4JFK A;  4NSB A;  1FKJ A;  1JND A;  3PRB A;  1I5H W;  2ZAJ A;  5B8I C;  2Q5A A;  3ODK A;  1TCO C;  3PA7 A;  2O92 A;  3O5Q A;  4JYS A;  3CH9 A;  2JX8 A;  3ARO A;  2MLX A;  3UQA A;  1HJV A;  5D75 A;  5I98 A;  1F40 A;  5DEZ A;  1FJD A;  4BF8 A;  1FKH A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...