3OOBA

Structural and functional insights of directly targeting pin1 by epigallocatechin-3-gallate
Total Genus 49
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
49
sequence length
158
structure length
146
Chain Sequence
KLPPGWEKAMSRSSGRVYYFNHITNASQWERPSEPARVRCSHLLVKHSQSRRPSSWRQEKITRTKEEALELINGYIQKIKSGEEDFESLASQFSDCSSAKARGDLGAFSRGQMQKPFEDASFALRTGEMSGPVFTDSGIHIILRTE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Peptidyl-prolyl cis-trans isomerase NIMA-interacting 1
publication title Epigallocatechin-gallate suppresses tumorigenesis by directly targeting Pin1.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Isomerase
total genus 49
structure length 146
sequence length 158
ec nomenclature ec 5.2.1.8: Peptidylprolyl isomerase.
pdb deposition date 2010-08-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00397 WW WW domain
A PF00639 Rotamase PPIC-type PPIASE domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.20.70.10 Mainly Beta Single Sheet Ubiquitin Ligase Nedd4; Chain: W; Ubiquitin Ligase Nedd4; Chain: W; 3oobA01
3.10.50.40 Alpha Beta Roll Chitinase A; domain 3 Chitinase A; domain 3 3oobA02
3RGCA 3O5DA 1ROTA 2FAPA 3IKDA 4QT3A 3TDBA 2VCDA 4J4NA 5D75A 3KZ7A 1QZ2A 2KO7A 2PPOA 3KAIA 1Q1CA 4JYSA 3CGMA 3I6CA 4GGQA 4DRJA 2MPHA 4ODMA 1ZCNA 2PPPA 3M85A 2Q5AA 2KI3A 1FKTA 2KE0A 1KT0A 1D7HA 2N87A 4MSPA 3UI5A 2DJYA 5GPGA 5DIVA 3O5EA 2XP6A 1F8AB 3UF8A 3PA7A 1FKGA 1ZK6A 3KACA 2L4JA 3PRDA 4DT4A 1EG4A 4ITZA 2YSBA 4C02B 4DZ3A 2XP4A 3KAHA 2M1IA 1W26A 2JV4A 2KR7A 3GPKA 5HW8A 1T11A 4MGVA 2ITKA 2OFNA 1EQ3A 3TCZA 4IQCA 1B6CA 2LKNA 4ODOA 4DRQA 3IKGA 2UZ5A 1Q6HA 1FKRA 3VAWA 2EZ5W 1P5QA 2XP5A 1WMVA 3IHZA 2ZQSA 1FKJA 4TYOA 4GIVA 1BKFA 4R0XA 4U85A 4U86A 3O5OA 4JFKA 2XP7A 2FKEA 1N1AA 4DRPA 4TNSA 3O5JA 1JNSA 2JMFA 2BA1A 5DIUA 5BXJA 2PPNA 2F21A 2RUCA 2KGJA 4REXA 2ZR6A 3NTPA 3NI6A 1J4IA 2PV1A 2DMVA 1FKKA 2MDIA 2ZAJA 2KXQA 4W9QA 3UQIA 4JFLA 1FKFA 5HW7A 1D7JA 4G2PA 3RFWA 4DZ2A 2DG9A 4N19A 2K8IA 2PV2A 2F2DA 1NSGA 1J4HA 3O5FA 2MLZA 4FAPA 4U84A 4O2TA 1EYMA 3H9RB 2RSEA 4LAYA 3B7XA 1BL4A 1M5YA 2M3OW 4DRKA 4FN2A 3O5GA 4DRIA 2YSGA 4E5RA 1JVWA 1JNTA 2M08A 4DRNA 1Q6UA 1I5HW 5DITA 1HXVA 2MF9A 2LGOA 2RUDA 3O5IA 3CNGA 2ZQUA 4W9OA 1D6OA 5HTGA 3O5QA 2YSFA 3CGNA 5I98A 2LPVA 4ODKA 2JX8A 5B8IC 1FKLA 2PV3A 1R9HA 4ODPA 3KABA 4JFJA 2LJ4A 2DG4A 5CQ2A 4ODLA 3TC5A 4TW6A 4ODRA 4LAVA 2RUQA 2F4EA 3LE4A 3MDYB 1K9QA 5HW6A 3WH0A 1TK7A 3ODKA 2D9FA 4NNRA 3O5LA 4JFMA 4JFIA 1Y0OA 2XP9A 2E45A 3JXVA 4BF8A 4W9PA 2XPAA 3LUOA 1L1PA 2ZR4A 2M2AA 2DK1A 4IPXA 1WR7A 2DWVA 5J6EA 4DRHA 1YATA 1QPFA 2XP8A 1FKBA 3UI4A 2DG3A 2L2SA 1JMQA 2MLYA 2YSIA 3L4HA 1J4RA 2PBCA 2VN1A 2M8JA 2ZQVA 1D7IA 3M7NA 1FKSA 3O5PA 1O6WA 3UQAA 3KAFA 4DIPA 1NMVA 2AWGA 1TCOC 2DK7A 2JXWA 1A7XA 1U79A 2XPBA 3O5RA 4DRMA 1EG3A 3O5MA 2Y78A 3NRKA 1PINA 2YSHA 3KCEA 4G50A 1PBKA 4IQ2A 1F40A 4ODQA 1YW5A 1FAPA 1FKIA 1ROUA 1FJDA 4DROA 4ODNA 3FAPA 3KAGA 3PRBA 1K9RA 4TW8A 2JZVA 4DH0A 4QIBA 5HWCA 5HKGA 2IF4A 1NMWA 1J6YA 2ZQTA 3EY6A 1KT1A 2XP3A 2LAJA 3UQBA 3JYMA 4QT2A 2KFWA 1QPLA 4J4OA 4TW7A 2ZR5A 5AHTA 4TX0A 5HT1A 2MNTA 4LAWA 3JYJA 3OOBA 2M8IA 1FKHA 2RURA 5HWBA 3KADA 2RQSA 3IK8A 1C9HA 3UI6A 1FKDA 1FD9A 5HUAA 4LAXA 3O5KA 1Q6IA 2RE3A 2MLXA
chains in the Genus database with same CATH superfamily
3RGCA 3MCBB 3O5DA 1ROTA 2FAPA 3FXYA 4Z2LA 3IKDA 4QT3A 3TDBA 2VCDA 1RP5A 1TR8A 4J4NA 5D75A 2WLZA 3KZ7A 2DPEA 2YBUA 1E15A 1QZ2A 2KO7A 2PPOA 2OLHA 3AS3A 3KAIA 3AROA 1Q1CA 5E66A 2DSZA 4JYSA 3CGMA 1W9UA 3I6CA 1HJWA 4GGQA 2WADA 4DRJA 4S3JA 2MPHA 4ODMA 1ZCNA 2DSWA 2PPPA 1JNEA 3M85A 2Q5AA 2O92A 2KI3A 1FKTA 2DT2A 4Z2IA 2KE0A 1KT0A 4MPKA 1D7HA 4ZPVR 2N87A 4MSPA 3UI5A 4DWSB 4Z2HA 2DJYA 1LG1A 5GPGA 5DIVA 3G6MA 5JH8A 3O5EA 1SYTA 2XP6A 1F8AB 3UF8A 3PA7A 1FKGA 5E65A 4WJXA 3ARPA 4WK9A 1ZK6A 3ALFA 4MNKA 1E6NA 2L4JA 3KACA 4HBOA 3PRDA 4DT4A 1EG4A 1FFRA 2YAJB 4NZCA 3WD2A 4ITZA 2YSBA 4C02B 4DZ3A 2XP4A 3KAHA 2M1IA 1W26A 1LG2A 2JV4A 2DSVA 2KR7A 4WKAA 3GPKA 1UR8A 3CZ8A 3LKXB 2DSUA 2O9OA 5HW8A 1T11A 4MGVA 1O6IA 2WM0A 2ITKA 2OFNA 1EQ3A 2A3BA 3FSBA 1E6RA 3TCZA 2WLYA 5DEZA 4IQCA 1B6CA 1E6PA 2LKNA 3AS2A 4ODOA 1GRJA 4DRQA 3IKGA 4URIA 4NSBA 4P8UA 2FDMA 2UZ5A 4ZPWR 1Q6HA 1FKRA 3VAWA 4WKHA 2EZ5W 5DF0A 1P5QA 3W4RA 2XP5A 1WMVA 3IHZA 2ZQSA 1FKJA 3QOKA 3B9EA 4Q22A 5DO2A 4TYOA 1GUVA 3ARTA 4GIVA 1BKFA 4R0XA 4U85A 4U86A 1WAWA 3O5OA 4P8WA 4JFKA 2XP7A 4ZS6A 2FKEA 1RD6A 1N1AA 2B5UB 4DRPA 4W5UA 4TNSA 3O5JA 2WAEA 1JNSA 3CHEA 1NH6A 3CHFA 2JMFA 3OA5A 3WD4A 2BA1A 5DIUA 4UDMA 5BXJA 2PPNA 2F21A 2RUCA 2KGJA 3MQHA 4REXA 2ZR6A 4ZPTR 4Z2JA 3NTPA 3NI6A 1NWTA 1FLCA 1NWUA 2G41A 1J4IA 3ARVA 4QZVB 1HKIA 2PV1A 4HBEA 2DMVA 1FKKA 4AY1A 2MDIA 2ZAJA 1W9VA 3RM8A 1UR9A 1ZBVA 1W1YA 2KXQA 3FSCA 2OWOA 4W9QA 3UQIA 4JFLA 1FKFA 3ARRA 5HW7A 2DT0A 1D7JA 3GU0A 1CTNA 4G2PA 3EIPA 3RFWA 1HKKA 4DZ2A 2DG9A 4N19A 2K8IA 2PV2A 3WQWA 2F2DA 1NSGA 1J4HA 1K9TA 1X6NA 5E64A 3PQHA 5U47A 3O5FA 2MLZA 4FAPA 1HJVA 2YBTA 4U84A 4O2TA 1EYMA 1EDQA 3H9RB 2PI6A 2RSEA 1W1VA 1ZBKA 3ARUA 3RM4A 4P8XA 4LAYA 2Y8NB 3B7XA 4KQZA 1BL4A 3PR9A 1HKJA 1M5YA 1E9LA 3AS1A 2M3OW 3MCBA 4DRKA 4FN2A 3O5GA 4DRIA 2YSGA 4E5RA 2QF8A 1JVWA 4A0TA 1JNTA 2M08A 4DRNA 1Q6UA 4HARA 1I5HW 5DITA 1HXVA 2MF9A 2LGOA 3MQGA 5E62A 2RUDA 3O5IA 2DT3A 3CNGA 2ZQUA 1H0IA 4W9OA 4Q7NA 3B8SA 1D6OA 3ARZA 5HTGA 3WD0A 3O5QA 2YSFA 3CGNA 5I98A 2LPVA 4ODKA 2JX8A 5B8IC 1LJYA 1LL7A 1FKLA 2PV3A 3ALGA 1R9HA 2QRVA 4ODPA 4GLXA 1JNDA 3KABA 4MNJA 4ML4A 4JFJA 4L3NA 1XHGA 2LJ4A 3FS8A 1OWQA 2F23A 2DG4A 5CQ2A 4ODLA 3TC5A 3WIJA 2ESCA 4TW6A 4ODRA 4LAVA 2RUQA 3G6LA 2F4EA 4Z2GA 1WB0A 3LE4A 3MDYB 2A3EA 1K9QA 2B31A 5HW6A 4KR0B 4P8VA 1KFWA 3GTYX 3WH0A 1TK7A 3ODKA 2D9FA 4IT6A 4NNRA 4XAKA 3O5LA 4JFMA 1HKMA 4JFIA 1Y0OA 2XP9A 2E45A 2A3CA 3JXVA 4BF8A 4W9PA 2XPAA 3LUOA 1L1PA 2EULA 2ZR4A 2M2AA 4MNLA 1ZB5A 2DK1A 4IPXA 3AS0A 1ITXA 1WR7A 2DWVA 5GQBA 1LL6A 1GOIA 2P4VA 5J6EA 3LKXA 4DRHA 1YATA 1QPFA 3B9AA 2XP8A 1FKBA 3B9DA 3RMEA 1VF8A 1EHNA 3UI4A 4WKFA 2DG3A 2L2SA 4Z2KA 1JMQA 1SR0A 2MLYA 1IX5A 4DWSC 1XRVA 2YSIA 3L4HA 1J4RA 1TFVA 2PBCA 2VN1A 3ARXA 4WIWA 2M8JA 1ZU8A 3WD3A 2ZQVA 1D7IA 3M7NA 1FKSA 3O5PA 1O6WA 3WKZA 1E44A 4L72B 3UQAA 3KAFA 1ZBWA 3ARWA 4DIPA 1NMVA 1W1TA 2DT1A 1LQ0A 2AWGA 3BXWA 1GPFA 1TCOC 2DK7A 4IT4A 2JXWA 1A7XA 1U79A 2XPBA 3CHCA 3O5RA 3WL0A 4DRMA 1EG3A 3O5MA 2Y78A 3NRKA 1PINA 2YSHA 3PRAA 3KCEA 4G50A 4MTVA 1PBKA 4IQ2A 4R5EA 1F40A 4ODQA 1YW5A 1FAPA 1ROUA 1FKIA 3ARQA 5GPRA 3WQVA 1NWRA 1FJDA 1ZBCA 5HBFA 4DROA 4DWSD 4ODNA 3BMBA 3FAPA 3KAGA 3PRBA 1WNOA 1K9RA 3CHDA 4TW8A 2JZVA 1W1PA 4DH0A 3CH9A 4QIBA 5HWCA 1W9PA 5HKGA 2IF4A 1NMWA 1H0GA 1J6YA 2ZQTA 3EY6A 1KT1A 2PN0A 2XP3A 3AQUA 2LAJA 3UQBA 1X6LA 3JYMA 4QT2A 2KFWA 1EIBA 1OGBA 1QPLA 4J4OA 4TW7A 3FY1A 4PTMA 2ZR5A 4MNMA 2WK2A 3ARYA 2AOSA 5AHTA 5E5WA 4LGXA 4TX0A 5HT1A 3ARSA 4A0UA 2MNTA 4LAWA 4DWSA 3JYJA 3OOBA 2M8IA 1FKHA 2RURA 1OGGA 5HWBA 1JCHB 3KADA 4S3KA 4MAVA 2RQSA 3IK8A 1C9HA 1NWSA 3UI6A 3RM9A 1FKDA 1FD9A 5HUAA 2A3AA 1E6ZA 4LAXA 1D2KA 3WD1A 3O5KA 1ZL1A 1LL4A 1Q6IA 2RE3A 2G8ZA 2IUZA 1FFQA 2ETNA 2MLXA 1HJXA 3WL1A
chains in the Genus database with same CATH topology
3RGCA 3MCBB 3O5DA 1ROTA 2FAPA 3FXYA 4Z2LA 3IKDA 4QT3A 3TDBA 2VCDA 1RP5A 1TR8A 4J4NA 5D75A 2WLZA 3KZ7A 2DPEA 2YBUA 1E15A 1QZ2A 2KO7A 2PPOA 2OLHA 3AS3A 3KAIA 3AROA 1Q1CA 5E66A 2DSZA 4JYSA 3CGMA 1W9UA 3I6CA 1HJWA 4GGQA 2WADA 4DRJA 4S3JA 2MPHA 4ODMA 1ZCNA 2DSWA 2PPPA 1JNEA 3M85A 2Q5AA 2O92A 2KI3A 1FKTA 2DT2A 4Z2IA 2KE0A 1KT0A 4MPKA 1D7HA 4ZPVR 2N87A 4MSPA 3UI5A 4DWSB 4Z2HA 2DJYA 1LG1A 5GPGA 5DIVA 3G6MA 5JH8A 3O5EA 1SYTA 2XP6A 1F8AB 3UF8A 3PA7A 1FKGA 5E65A 4WJXA 3ARPA 4WK9A 1ZK6A 3ALFA 4MNKA 1E6NA 2L4JA 3KACA 4HBOA 3PRDA 4DT4A 1EG4A 1FFRA 2YAJB 4NZCA 3WD2A 4ITZA 2YSBA 4C02B 4DZ3A 2XP4A 3KAHA 2M1IA 1W26A 1LG2A 2JV4A 2DSVA 2KR7A 4WKAA 3GPKA 1UR8A 3CZ8A 3LKXB 2DSUA 2O9OA 5HW8A 1T11A 4MGVA 1O6IA 2WM0A 2ITKA 2OFNA 1EQ3A 2A3BA 3FSBA 1E6RA 3TCZA 2WLYA 5DEZA 4IQCA 1B6CA 1E6PA 2LKNA 3AS2A 4ODOA 4DRQA 3IKGA 4URIA 4NSBA 4P8UA 2FDMA 2UZ5A 4ZPWR 1Q6HA 1FKRA 3VAWA 4WKHA 2EZ5W 5DF0A 1P5QA 3W4RA 2XP5A 1WMVA 3IHZA 2ZQSA 1FKJA 3QOKA 3B9EA 4Q22A 5DO2A 4TYOA 1GUVA 3ARTA 4GIVA 1BKFA 4R0XA 4U85A 4U86A 1WAWA 3O5OA 4P8WA 4JFKA 2XP7A 4ZS6A 2FKEA 1RD6A 1N1AA 4DRPA 4W5UA 4TNSA 3O5JA 2WAEA 1JNSA 3CHEA 1NH6A 3CHFA 2JMFA 3OA5A 3WD4A 2BA1A 5DIUA 5BXJA 2PPNA 2F21A 2RUCA 2KGJA 3MQHA 4REXA 2ZR6A 4ZPTR 4Z2JA 3NTPA 3NI6A 1NWTA 1FLCA 1NWUA 2G41A 1J4IA 3ARVA 4QZVB 1HKIA 2PV1A 4HBEA 2DMVA 1FKKA 4AY1A 2MDIA 2ZAJA 1W9VA 3RM8A 1UR9A 1ZBVA 1W1YA 2KXQA 3FSCA 2OWOA 4W9QA 3UQIA 4JFLA 1FKFA 3ARRA 5HW7A 2DT0A 1D7JA 1CTNA 4G2PA 3RFWA 1HKKA 4DZ2A 2DG9A 4N19A 2K8IA 2PV2A 3WQWA 2F2DA 1NSGA 1J4HA 1K9TA 1X6NA 5E64A 3PQHA 5U47A 3O5FA 2MLZA 4FAPA 1HJVA 2YBTA 4U84A 4O2TA 1EYMA 1EDQA 3H9RB 2PI6A 2RSEA 1W1VA 1ZBKA 3ARUA 3RM4A 4P8XA 4LAYA 2Y8NB 3B7XA 4KQZA 1BL4A 3PR9A 1HKJA 1M5YA 1E9LA 3AS1A 2M3OW 3MCBA 4DRKA 4FN2A 3O5GA 4DRIA 2YSGA 4E5RA 2QF8A 1JVWA 4A0TA 1JNTA 2M08A 4DRNA 1Q6UA 4HARA 1I5HW 5DITA 1HXVA 2MF9A 2LGOA 3MQGA 5E62A 2RUDA 3O5IA 2DT3A 3CNGA 2ZQUA 1H0IA 4W9OA 4Q7NA 3B8SA 1D6OA 3ARZA 5HTGA 3WD0A 3O5QA 2YSFA 3CGNA 5I98A 2LPVA 4ODKA 2JX8A 5B8IC 1LJYA 1LL7A 1FKLA 2PV3A 3ALGA 1R9HA 2QRVA 4ODPA 4GLXA 1JNDA 3KABA 4MNJA 4ML4A 4JFJA 4L3NA 1XHGA 2LJ4A 3FS8A 1OWQA 2DG4A 5CQ2A 4ODLA 3TC5A 3WIJA 2ESCA 4TW6A 4ODRA 4LAVA 2RUQA 3G6LA 2F4EA 4Z2GA 1WB0A 3LE4A 3MDYB 2A3EA 1K9QA 2B31A 5HW6A 4KR0B 4P8VA 1KFWA 3WH0A 1TK7A 3ODKA 2D9FA 4IT6A 4NNRA 4XAKA 3O5LA 4JFMA 1HKMA 4JFIA 1Y0OA 2XP9A 2E45A 2A3CA 3JXVA 4BF8A 4W9PA 2XPAA 3LUOA 1L1PA 2ZR4A 2M2AA 4MNLA 1ZB5A 2DK1A 4IPXA 3AS0A 1ITXA 1WR7A 2DWVA 5GQBA 1LL6A 1GOIA 5J6EA 3LKXA 4DRHA 1YATA 1QPFA 3B9AA 2XP8A 1FKBA 3B9DA 3RMEA 1VF8A 1EHNA 3UI4A 4WKFA 2DG3A 2L2SA 4Z2KA 1JMQA 1SR0A 2MLYA 1IX5A 4DWSC 1XRVA 2YSIA 3L4HA 1J4RA 1TFVA 2PBCA 2VN1A 3ARXA 4WIWA 2M8JA 1ZU8A 3WD3A 2ZQVA 1D7IA 3M7NA 1FKSA 3O5PA 1O6WA 3WKZA 4L72B 3UQAA 3KAFA 1ZBWA 3ARWA 4DIPA 1NMVA 1W1TA 2DT1A 1LQ0A 2AWGA 3BXWA 1GPFA 1TCOC 2DK7A 4IT4A 2JXWA 1A7XA 1U79A 2XPBA 3CHCA 3O5RA 3WL0A 4DRMA 1EG3A 3O5MA 2Y78A 3NRKA 1PINA 2YSHA 3PRAA 3KCEA 4G50A 4MTVA 1PBKA 4IQ2A 4R5EA 1F40A 4ODQA 1YW5A 1FAPA 1ROUA 1FKIA 3ARQA 5GPRA 3WQVA 1NWRA 1FJDA 1ZBCA 5HBFA 4DROA 4DWSD 4ODNA 3FAPA 3KAGA 3PRBA 1WNOA 1K9RA 3CHDA 4TW8A 2JZVA 1W1PA 4DH0A 3CH9A 4QIBA 5HWCA 1W9PA 5HKGA 2IF4A 1NMWA 1H0GA 1J6YA 2ZQTA 3EY6A 1KT1A 2XP3A 3AQUA 2LAJA 3UQBA 1X6LA 3JYMA 4QT2A 2KFWA 1EIBA 1OGBA 1QPLA 4J4OA 4TW7A 3FY1A 4PTMA 2ZR5A 4MNMA 2WK2A 3ARYA 2AOSA 5AHTA 5E5WA 4LGXA 4TX0A 5HT1A 3ARSA 4A0UA 2MNTA 4LAWA 4DWSA 3JYJA 3OOBA 2M8IA 1FKHA 2RURA 1OGGA 5HWBA 3KADA 4S3KA 4MAVA 2RQSA 3IK8A 1C9HA 1NWSA 3UI6A 3RM9A 1FKDA 1FD9A 5HUAA 2A3AA 1E6ZA 4LAXA 1D2KA 3WD1A 3O5KA 1ZL1A 1LL4A 1Q6IA 2RE3A 2G8ZA 2IUZA 1FFQA 2MLXA 1HJXA 3WL1A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3RGC A;  3O5D A;  1ROT A;  2FAP A;  3IKD A;  4QT3 A;  3TDB A;  2VCD A;  4J4N A;  5D75 A;  3KZ7 A;  1QZ2 A;  2KO7 A;  2PPO A;  3KAI A;  1Q1C A;  4JYS A;  3CGM A;  3I6C A;  4GGQ A;  4DRJ A;  2MPH A;  4ODM A;  1ZCN A;  2PPP A;  3M85 A;  2Q5A A;  2KI3 A;  1FKT A;  2KE0 A;  1KT0 A;  1D7H A;  2N87 A;  4MSP A;  3UI5 A;  2DJY A;  5GPG A;  5DIV A;  3O5E A;  2XP6 A;  1F8A B;  3UF8 A;  3PA7 A;  1FKG A;  1ZK6 A;  3KAC A;  2L4J A;  3PRD A;  4DT4 A;  1EG4 A;  4ITZ A;  2YSB A;  4C02 B;  4DZ3 A;  2XP4 A;  3KAH A;  2M1I A;  1W26 A;  2JV4 A;  2KR7 A;  3GPK A;  5HW8 A;  1T11 A;  4MGV A;  2ITK A;  2OFN A;  1EQ3 A;  3TCZ A;  4IQC A;  1B6C A;  2LKN A;  4ODO A;  4DRQ A;  3IKG A;  2UZ5 A;  1Q6H A;  1FKR A;  3VAW A;  2EZ5 W;  1P5Q A;  2XP5 A;  1WMV A;  3IHZ A;  2ZQS A;  1FKJ A;  4TYO A;  4GIV A;  1BKF A;  4R0X A;  4U85 A;  4U86 A;  3O5O A;  4JFK A;  2XP7 A;  2FKE A;  1N1A A;  4DRP A;  4TNS A;  3O5J A;  1JNS A;  2JMF A;  2BA1 A;  5DIU A;  5BXJ A;  2PPN A;  2F21 A;  2RUC A;  2KGJ A;  4REX A;  2ZR6 A;  3NTP A;  3NI6 A;  1J4I A;  2PV1 A;  2DMV A;  1FKK A;  2MDI A;  2ZAJ A;  2KXQ A;  4W9Q A;  3UQI A;  4JFL A;  1FKF A;  5HW7 A;  1D7J A;  4G2P A;  3RFW A;  4DZ2 A;  2DG9 A;  4N19 A;  2K8I A;  2PV2 A;  2F2D A;  1NSG A;  1J4H A;  3O5F A;  2MLZ A;  4FAP A;  4U84 A;  4O2T A;  1EYM A;  3H9R B;  2RSE A;  4LAY A;  3B7X A;  1BL4 A;  1M5Y A;  2M3O W;  4DRK A;  4FN2 A;  3O5G A;  4DRI A;  2YSG A;  4E5R A;  1JVW A;  1JNT A;  2M08 A;  4DRN A;  1Q6U A;  1I5H W;  5DIT A;  1HXV A;  2MF9 A;  2LGO A;  2RUD A;  3O5I A;  3CNG A;  2ZQU A;  4W9O A;  1D6O A;  5HTG A;  3O5Q A;  2YSF A;  3CGN A;  5I98 A;  2LPV A;  4ODK A;  2JX8 A;  5B8I C;  1FKL A;  2PV3 A;  1R9H A;  4ODP A;  3KAB A;  4JFJ A;  2LJ4 A;  2DG4 A;  5CQ2 A;  4ODL A;  3TC5 A;  4TW6 A;  4ODR A;  4LAV A;  2RUQ A;  2F4E A;  3LE4 A;  3MDY B;  1K9Q A;  5HW6 A;  3WH0 A;  1TK7 A;  3ODK A;  2D9F A;  4NNR A;  3O5L A;  4JFM A;  4JFI A;  1Y0O A;  2XP9 A;  2E45 A;  3JXV A;  4BF8 A;  4W9P A;  2XPA A;  3LUO A;  1L1P A;  2ZR4 A;  2M2A A;  2DK1 A;  4IPX A;  1WR7 A;  2DWV A;  5J6E A;  4DRH A;  1YAT A;  1QPF A;  2XP8 A;  1FKB A;  3UI4 A;  2DG3 A;  2L2S A;  1JMQ A;  2MLY A;  2YSI A;  3L4H A;  1J4R A;  2PBC A;  2VN1 A;  2M8J A;  2ZQV A;  1D7I A;  3M7N A;  1FKS A;  3O5P A;  1O6W A;  3UQA A;  3KAF A;  4DIP A;  1NMV A;  2AWG A;  1TCO C;  2DK7 A;  2JXW A;  1A7X A;  1U79 A;  2XPB A;  3O5R A;  4DRM A;  1EG3 A;  3O5M A;  2Y78 A;  3NRK A;  1PIN A;  2YSH A;  3KCE A;  4G50 A;  1PBK A;  4IQ2 A;  1F40 A;  4ODQ A;  1YW5 A;  1FAP A;  1FKI A;  1ROU A;  1FJD A;  4DRO A;  4ODN A;  3FAP A;  3KAG A;  3PRB A;  1K9R A;  4TW8 A;  2JZV A;  4DH0 A;  4QIB A;  5HWC A;  5HKG A;  2IF4 A;  1NMW A;  1J6Y A;  2ZQT A;  3EY6 A;  1KT1 A;  2XP3 A;  2LAJ A;  3UQB A;  3JYM A;  4QT2 A;  2KFW A;  1QPL A;  4J4O A;  4TW7 A;  2ZR5 A;  5AHT A;  4TX0 A;  5HT1 A;  2MNT A;  4LAW A;  3JYJ A;  3OOB A;  2M8I A;  1FKH A;  2RUR A;  5HWB A;  3KAD A;  2RQS A;  3IK8 A;  1C9H A;  3UI6 A;  1FKD A;  1FD9 A;  5HUA A;  4LAX A;  3O5K A;  1Q6I A;  2RE3 A;  2MLX A; 
#chains in the Genus database with same CATH topology
 3RGC A;  3MCB B;  3O5D A;  1ROT A;  2FAP A;  3FXY A;  4Z2L A;  3IKD A;  4QT3 A;  3TDB A;  2VCD A;  1RP5 A;  1TR8 A;  4J4N A;  5D75 A;  2WLZ A;  3KZ7 A;  2DPE A;  2YBU A;  1E15 A;  1QZ2 A;  2KO7 A;  2PPO A;  2OLH A;  3AS3 A;  3KAI A;  3ARO A;  1Q1C A;  5E66 A;  2DSZ A;  4JYS A;  3CGM A;  1W9U A;  3I6C A;  1HJW A;  4GGQ A;  2WAD A;  4DRJ A;  4S3J A;  2MPH A;  4ODM A;  1ZCN A;  2DSW A;  2PPP A;  1JNE A;  3M85 A;  2Q5A A;  2O92 A;  2KI3 A;  1FKT A;  2DT2 A;  4Z2I A;  2KE0 A;  1KT0 A;  4MPK A;  1D7H A;  4ZPV R;  2N87 A;  4MSP A;  3UI5 A;  4DWS B;  4Z2H A;  2DJY A;  1LG1 A;  5GPG A;  5DIV A;  3G6M A;  5JH8 A;  3O5E A;  1SYT A;  2XP6 A;  1F8A B;  3UF8 A;  3PA7 A;  1FKG A;  5E65 A;  4WJX A;  3ARP A;  4WK9 A;  1ZK6 A;  3ALF A;  4MNK A;  1E6N A;  2L4J A;  3KAC A;  4HBO A;  3PRD A;  4DT4 A;  1EG4 A;  1FFR A;  2YAJ B;  4NZC A;  3WD2 A;  4ITZ A;  2YSB A;  4C02 B;  4DZ3 A;  2XP4 A;  3KAH A;  2M1I A;  1W26 A;  1LG2 A;  2JV4 A;  2DSV A;  2KR7 A;  4WKA A;  3GPK A;  1UR8 A;  3CZ8 A;  3LKX B;  2DSU A;  2O9O A;  5HW8 A;  1T11 A;  4MGV A;  1O6I A;  2WM0 A;  2ITK A;  2OFN A;  1EQ3 A;  2A3B A;  3FSB A;  1E6R A;  3TCZ A;  2WLY A;  5DEZ A;  4IQC A;  1B6C A;  1E6P A;  2LKN A;  3AS2 A;  4ODO A;  1GRJ A;  4DRQ A;  3IKG A;  4URI A;  4NSB A;  4P8U A;  2FDM A;  2UZ5 A;  4ZPW R;  1Q6H A;  1FKR A;  3VAW A;  4WKH A;  2EZ5 W;  5DF0 A;  1P5Q A;  3W4R A;  2XP5 A;  1WMV A;  3IHZ A;  2ZQS A;  1FKJ A;  3QOK A;  3B9E A;  4Q22 A;  5DO2 A;  4TYO A;  1GUV A;  3ART A;  4GIV A;  1BKF A;  4R0X A;  4U85 A;  4U86 A;  1WAW A;  3O5O A;  4P8W A;  4JFK A;  2XP7 A;  4ZS6 A;  2FKE A;  1RD6 A;  1N1A A;  2B5U B;  4DRP A;  4W5U A;  4TNS A;  3O5J A;  2WAE A;  1JNS A;  3CHE A;  1NH6 A;  3CHF A;  2JMF A;  3OA5 A;  3WD4 A;  2BA1 A;  5DIU A;  4UDM A;  5BXJ A;  2PPN A;  2F21 A;  2RUC A;  2KGJ A;  3MQH A;  4REX A;  2ZR6 A;  4ZPT R;  4Z2J A;  3NTP A;  3NI6 A;  1NWT A;  1FLC A;  1NWU A;  2G41 A;  1J4I A;  3ARV A;  4QZV B;  1HKI A;  2PV1 A;  4HBE A;  2DMV A;  1FKK A;  4AY1 A;  2MDI A;  2ZAJ A;  1W9V A;  3RM8 A;  1UR9 A;  1ZBV A;  1W1Y A;  2KXQ A;  3FSC A;  2OWO A;  4W9Q A;  3UQI A;  4JFL A;  1FKF A;  3ARR A;  5HW7 A;  2DT0 A;  1D7J A;  3GU0 A;  1CTN A;  4G2P A;  3EIP A;  3RFW A;  1HKK A;  4DZ2 A;  2DG9 A;  4N19 A;  2K8I A;  2PV2 A;  3WQW A;  2F2D A;  1NSG A;  1J4H A;  1K9T A;  1X6N A;  5E64 A;  3PQH A;  5U47 A;  3O5F A;  2MLZ A;  4FAP A;  1HJV A;  2YBT A;  4U84 A;  4O2T A;  1EYM A;  1EDQ A;  3H9R B;  2PI6 A;  2RSE A;  1W1V A;  1ZBK A;  3ARU A;  3RM4 A;  4P8X A;  4LAY A;  2Y8N B;  3B7X A;  4KQZ A;  1BL4 A;  3PR9 A;  1HKJ A;  1M5Y A;  1E9L A;  3AS1 A;  2M3O W;  3MCB A;  4DRK A;  4FN2 A;  3O5G A;  4DRI A;  2YSG A;  4E5R A;  2QF8 A;  1JVW A;  4A0T A;  1JNT A;  2M08 A;  4DRN A;  1Q6U A;  4HAR A;  1I5H W;  5DIT A;  1HXV A;  2MF9 A;  2LGO A;  3MQG A;  5E62 A;  2RUD A;  3O5I A;  2DT3 A;  3CNG A;  2ZQU A;  1H0I A;  4W9O A;  4Q7N A;  3B8S A;  1D6O A;  3ARZ A;  5HTG A;  3WD0 A;  3O5Q A;  2YSF A;  3CGN A;  5I98 A;  2LPV A;  4ODK A;  2JX8 A;  5B8I C;  1LJY A;  1LL7 A;  1FKL A;  2PV3 A;  3ALG A;  1R9H A;  2QRV A;  4ODP A;  4GLX A;  1JND A;  3KAB A;  4MNJ A;  4ML4 A;  4JFJ A;  4L3N A;  1XHG A;  2LJ4 A;  3FS8 A;  1OWQ A;  2F23 A;  2DG4 A;  5CQ2 A;  4ODL A;  3TC5 A;  3WIJ A;  2ESC A;  4TW6 A;  4ODR A;  4LAV A;  2RUQ A;  3G6L A;  2F4E A;  4Z2G A;  1WB0 A;  3LE4 A;  3MDY B;  2A3E A;  1K9Q A;  2B31 A;  5HW6 A;  4KR0 B;  4P8V A;  1KFW A;  3GTY X;  3WH0 A;  1TK7 A;  3ODK A;  2D9F A;  4IT6 A;  4NNR A;  4XAK A;  3O5L A;  4JFM A;  1HKM A;  4JFI A;  1Y0O A;  2XP9 A;  2E45 A;  2A3C A;  3JXV A;  4BF8 A;  4W9P A;  2XPA A;  3LUO A;  1L1P A;  2EUL A;  2ZR4 A;  2M2A A;  4MNL A;  1ZB5 A;  2DK1 A;  4IPX A;  3AS0 A;  1ITX A;  1WR7 A;  2DWV A;  5GQB A;  1LL6 A;  1GOI A;  2P4V A;  5J6E A;  3LKX A;  4DRH A;  1YAT A;  1QPF A;  3B9A A;  2XP8 A;  1FKB A;  3B9D A;  3RME A;  1VF8 A;  1EHN A;  3UI4 A;  4WKF A;  2DG3 A;  2L2S A;  4Z2K A;  1JMQ A;  1SR0 A;  2MLY A;  1IX5 A;  4DWS C;  1XRV A;  2YSI A;  3L4H A;  1J4R A;  1TFV A;  2PBC A;  2VN1 A;  3ARX A;  4WIW A;  2M8J A;  1ZU8 A;  3WD3 A;  2ZQV A;  1D7I A;  3M7N A;  1FKS A;  3O5P A;  1O6W A;  3WKZ A;  1E44 A;  4L72 B;  3UQA A;  3KAF A;  1ZBW A;  3ARW A;  4DIP A;  1NMV A;  1W1T A;  2DT1 A;  1LQ0 A;  2AWG A;  3BXW A;  1GPF A;  1TCO C;  2DK7 A;  4IT4 A;  2JXW A;  1A7X A;  1U79 A;  2XPB A;  3CHC A;  3O5R A;  3WL0 A;  4DRM A;  1EG3 A;  3O5M A;  2Y78 A;  3NRK A;  1PIN A;  2YSH A;  3PRA A;  3KCE A;  4G50 A;  4MTV A;  1PBK A;  4IQ2 A;  4R5E A;  1F40 A;  4ODQ A;  1YW5 A;  1FAP A;  1ROU A;  1FKI A;  3ARQ A;  5GPR A;  3WQV A;  1NWR A;  1FJD A;  1ZBC A;  5HBF A;  4DRO A;  4DWS D;  4ODN A;  3BMB A;  3FAP A;  3KAG A;  3PRB A;  1WNO A;  1K9R A;  3CHD A;  4TW8 A;  2JZV A;  1W1P A;  4DH0 A;  3CH9 A;  4QIB A;  5HWC A;  1W9P A;  5HKG A;  2IF4 A;  1NMW A;  1H0G A;  1J6Y A;  2ZQT A;  3EY6 A;  1KT1 A;  2PN0 A;  2XP3 A;  3AQU A;  2LAJ A;  3UQB A;  1X6L A;  3JYM A;  4QT2 A;  2KFW A;  1EIB A;  1OGB A;  1QPL A;  4J4O A;  4TW7 A;  3FY1 A;  4PTM A;  2ZR5 A;  4MNM A;  2WK2 A;  3ARY A;  2AOS A;  5AHT A;  5E5W A;  4LGX A;  4TX0 A;  5HT1 A;  3ARS A;  4A0U A;  2MNT A;  4LAW A;  4DWS A;  3JYJ A;  3OOB A;  2M8I A;  1FKH A;  2RUR A;  1OGG A;  5HWB A;  1JCH B;  3KAD A;  4S3K A;  4MAV A;  2RQS A;  3IK8 A;  1C9H A;  1NWS A;  3UI6 A;  3RM9 A;  1FKD A;  1FD9 A;  5HUA A;  2A3A A;  1E6Z A;  4LAX A;  1D2K A;  3WD1 A;  3O5K A;  1ZL1 A;  1LL4 A;  1Q6I A;  2RE3 A;  2G8Z A;  2IUZ A;  1FFQ A;  2ETN A;  2MLX A;  1HJX A;  3WL1 A; 
#chains in the Genus database with same CATH homology
 3RGC A;  3MCB B;  3O5D A;  1ROT A;  2FAP A;  3FXY A;  4Z2L A;  3IKD A;  4QT3 A;  3TDB A;  2VCD A;  1RP5 A;  1TR8 A;  4J4N A;  5D75 A;  2WLZ A;  3KZ7 A;  2DPE A;  2YBU A;  1E15 A;  1QZ2 A;  2KO7 A;  2PPO A;  2OLH A;  3AS3 A;  3KAI A;  3ARO A;  1Q1C A;  5E66 A;  2DSZ A;  4JYS A;  3CGM A;  1W9U A;  3I6C A;  1HJW A;  4GGQ A;  2WAD A;  4DRJ A;  4S3J A;  2MPH A;  4ODM A;  1ZCN A;  2DSW A;  2PPP A;  1JNE A;  3M85 A;  2Q5A A;  2O92 A;  2KI3 A;  1FKT A;  2DT2 A;  4Z2I A;  2KE0 A;  1KT0 A;  4MPK A;  1D7H A;  4ZPV R;  2N87 A;  4MSP A;  3UI5 A;  4DWS B;  4Z2H A;  2DJY A;  1LG1 A;  5GPG A;  5DIV A;  3G6M A;  5JH8 A;  3O5E A;  1SYT A;  2XP6 A;  1F8A B;  3UF8 A;  3PA7 A;  1FKG A;  5E65 A;  4WJX A;  3ARP A;  4WK9 A;  1ZK6 A;  3ALF A;  4MNK A;  1E6N A;  2L4J A;  3KAC A;  4HBO A;  3PRD A;  4DT4 A;  1EG4 A;  1FFR A;  2YAJ B;  4NZC A;  3WD2 A;  4ITZ A;  2YSB A;  4C02 B;  4DZ3 A;  2XP4 A;  3KAH A;  2M1I A;  1W26 A;  1LG2 A;  2JV4 A;  2DSV A;  2KR7 A;  4WKA A;  3GPK A;  1UR8 A;  3CZ8 A;  3LKX B;  2DSU A;  2O9O A;  5HW8 A;  1T11 A;  4MGV A;  1O6I A;  2WM0 A;  2ITK A;  2OFN A;  1EQ3 A;  2A3B A;  3FSB A;  1E6R A;  3TCZ A;  2WLY A;  5DEZ A;  4IQC A;  1B6C A;  1E6P A;  2LKN A;  3AS2 A;  4ODO A;  4DRQ A;  3IKG A;  4URI A;  4NSB A;  4P8U A;  2FDM A;  2UZ5 A;  4ZPW R;  1Q6H A;  1FKR A;  3VAW A;  4WKH A;  2EZ5 W;  5DF0 A;  1P5Q A;  3W4R A;  2XP5 A;  1WMV A;  3IHZ A;  2ZQS A;  1FKJ A;  3QOK A;  3B9E A;  4Q22 A;  5DO2 A;  4TYO A;  1GUV A;  3ART A;  4GIV A;  1BKF A;  4R0X A;  4U85 A;  4U86 A;  1WAW A;  3O5O A;  4P8W A;  4JFK A;  2XP7 A;  4ZS6 A;  2FKE A;  1RD6 A;  1N1A A;  4DRP A;  4W5U A;  4TNS A;  3O5J A;  2WAE A;  1JNS A;  3CHE A;  1NH6 A;  3CHF A;  2JMF A;  3OA5 A;  3WD4 A;  2BA1 A;  5DIU A;  5BXJ A;  2PPN A;  2F21 A;  2RUC A;  2KGJ A;  3MQH A;  4REX A;  2ZR6 A;  4ZPT R;  4Z2J A;  3NTP A;  3NI6 A;  1NWT A;  1FLC A;  1NWU A;  2G41 A;  1J4I A;  3ARV A;  4QZV B;  1HKI A;  2PV1 A;  4HBE A;  2DMV A;  1FKK A;  4AY1 A;  2MDI A;  2ZAJ A;  1W9V A;  3RM8 A;  1UR9 A;  1ZBV A;  1W1Y A;  2KXQ A;  3FSC A;  2OWO A;  4W9Q A;  3UQI A;  4JFL A;  1FKF A;  3ARR A;  5HW7 A;  2DT0 A;  1D7J A;  1CTN A;  4G2P A;  3RFW A;  1HKK A;  4DZ2 A;  2DG9 A;  4N19 A;  2K8I A;  2PV2 A;  3WQW A;  2F2D A;  1NSG A;  1J4H A;  1K9T A;  1X6N A;  5E64 A;  3PQH A;  5U47 A;  3O5F A;  2MLZ A;  4FAP A;  1HJV A;  2YBT A;  4U84 A;  4O2T A;  1EYM A;  1EDQ A;  3H9R B;  2PI6 A;  2RSE A;  1W1V A;  1ZBK A;  3ARU A;  3RM4 A;  4P8X A;  4LAY A;  2Y8N B;  3B7X A;  4KQZ A;  1BL4 A;  3PR9 A;  1HKJ A;  1M5Y A;  1E9L A;  3AS1 A;  2M3O W;  3MCB A;  4DRK A;  4FN2 A;  3O5G A;  4DRI A;  2YSG A;  4E5R A;  2QF8 A;  1JVW A;  4A0T A;  1JNT A;  2M08 A;  4DRN A;  1Q6U A;  4HAR A;  1I5H W;  5DIT A;  1HXV A;  2MF9 A;  2LGO A;  3MQG A;  5E62 A;  2RUD A;  3O5I A;  2DT3 A;  3CNG A;  2ZQU A;  1H0I A;  4W9O A;  4Q7N A;  3B8S A;  1D6O A;  3ARZ A;  5HTG A;  3WD0 A;  3O5Q A;  2YSF A;  3CGN A;  5I98 A;  2LPV A;  4ODK A;  2JX8 A;  5B8I C;  1LJY A;  1LL7 A;  1FKL A;  2PV3 A;  3ALG A;  1R9H A;  2QRV A;  4ODP A;  4GLX A;  1JND A;  3KAB A;  4MNJ A;  4ML4 A;  4JFJ A;  4L3N A;  1XHG A;  2LJ4 A;  3FS8 A;  1OWQ A;  2DG4 A;  5CQ2 A;  4ODL A;  3TC5 A;  3WIJ A;  2ESC A;  4TW6 A;  4ODR A;  4LAV A;  2RUQ A;  3G6L A;  2F4E A;  4Z2G A;  1WB0 A;  3LE4 A;  3MDY B;  2A3E A;  1K9Q A;  2B31 A;  5HW6 A;  4KR0 B;  4P8V A;  1KFW A;  3WH0 A;  1TK7 A;  3ODK A;  2D9F A;  4IT6 A;  4NNR A;  4XAK A;  3O5L A;  4JFM A;  1HKM A;  4JFI A;  1Y0O A;  2XP9 A;  2E45 A;  2A3C A;  3JXV A;  4BF8 A;  4W9P A;  2XPA A;  3LUO A;  1L1P A;  2ZR4 A;  2M2A A;  4MNL A;  1ZB5 A;  2DK1 A;  4IPX A;  3AS0 A;  1ITX A;  1WR7 A;  2DWV A;  5GQB A;  1LL6 A;  1GOI A;  5J6E A;  3LKX A;  4DRH A;  1YAT A;  1QPF A;  3B9A A;  2XP8 A;  1FKB A;  3B9D A;  3RME A;  1VF8 A;  1EHN A;  3UI4 A;  4WKF A;  2DG3 A;  2L2S A;  4Z2K A;  1JMQ A;  1SR0 A;  2MLY A;  1IX5 A;  4DWS C;  1XRV A;  2YSI A;  3L4H A;  1J4R A;  1TFV A;  2PBC A;  2VN1 A;  3ARX A;  4WIW A;  2M8J A;  1ZU8 A;  3WD3 A;  2ZQV A;  1D7I A;  3M7N A;  1FKS A;  3O5P A;  1O6W A;  3WKZ A;  4L72 B;  3UQA A;  3KAF A;  1ZBW A;  3ARW A;  4DIP A;  1NMV A;  1W1T A;  2DT1 A;  1LQ0 A;  2AWG A;  3BXW A;  1GPF A;  1TCO C;  2DK7 A;  4IT4 A;  2JXW A;  1A7X A;  1U79 A;  2XPB A;  3CHC A;  3O5R A;  3WL0 A;  4DRM A;  1EG3 A;  3O5M A;  2Y78 A;  3NRK A;  1PIN A;  2YSH A;  3PRA A;  3KCE A;  4G50 A;  4MTV A;  1PBK A;  4IQ2 A;  4R5E A;  1F40 A;  4ODQ A;  1YW5 A;  1FAP A;  1ROU A;  1FKI A;  3ARQ A;  5GPR A;  3WQV A;  1NWR A;  1FJD A;  1ZBC A;  5HBF A;  4DRO A;  4DWS D;  4ODN A;  3FAP A;  3KAG A;  3PRB A;  1WNO A;  1K9R A;  3CHD A;  4TW8 A;  2JZV A;  1W1P A;  4DH0 A;  3CH9 A;  4QIB A;  5HWC A;  1W9P A;  5HKG A;  2IF4 A;  1NMW A;  1H0G A;  1J6Y A;  2ZQT A;  3EY6 A;  1KT1 A;  2XP3 A;  3AQU A;  2LAJ A;  3UQB A;  1X6L A;  3JYM A;  4QT2 A;  2KFW A;  1EIB A;  1OGB A;  1QPL A;  4J4O A;  4TW7 A;  3FY1 A;  4PTM A;  2ZR5 A;  4MNM A;  2WK2 A;  3ARY A;  2AOS A;  5AHT A;  5E5W A;  4LGX A;  4TX0 A;  5HT1 A;  3ARS A;  4A0U A;  2MNT A;  4LAW A;  4DWS A;  3JYJ A;  3OOB A;  2M8I A;  1FKH A;  2RUR A;  1OGG A;  5HWB A;  3KAD A;  4S3K A;  4MAV A;  2RQS A;  3IK8 A;  1C9H A;  1NWS A;  3UI6 A;  3RM9 A;  1FKD A;  1FD9 A;  5HUA A;  2A3A A;  1E6Z A;  4LAX A;  1D2K A;  3WD1 A;  3O5K A;  1ZL1 A;  1LL4 A;  1Q6I A;  2RE3 A;  2G8Z A;  2IUZ A;  1FFQ A;  2MLX A;  1HJX A;  3WL1 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...