3OOBA

Structural and functional insights of directly targeting pin1 by epigallocatechin-3-gallate
Total Genus 49
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
49
sequence length
158
structure length
146
Chain Sequence
KLPPGWEKAMSRSSGRVYYFNHITNASQWERPSEPARVRCSHLLVKHSQSRRPSSWRQEKITRTKEEALELINGYIQKIKSGEEDFESLASQFSDCSSAKARGDLGAFSRGQMQKPFEDASFALRTGEMSGPVFTDSGIHIILRTE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Epigallocatechin-gallate suppresses tumorigenesis by directly targeting Pin1.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Isomerase
molecule keywords Peptidyl-prolyl cis-trans isomerase NIMA-interacting 1
total genus 49
structure length 146
sequence length 158
ec nomenclature ec 5.2.1.8: Peptidylprolyl isomerase.
pdb deposition date 2010-08-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00397 WW WW domain
A PF00639 Rotamase PPIC-type PPIASE domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.20.70.10 Mainly Beta Single Sheet Ubiquitin Ligase Nedd4; Chain: W; Ubiquitin Ligase Nedd4; Chain: W; 3oobA01
3.10.50.40 Alpha Beta Roll Chitinase A; domain 3 Chitinase A; domain 3 3oobA02
5DIUA 3GPKA 5HT1A 4JFLA 2LAJA 4TW7A 3UF8A 1QPLA 3M7NA 1PINA 3B7XA 3TDBA 2MNTA 5J6EA 4LAWA 1ROTA 3CNGA 4U84A 1D6OA 4DRIA 1FKJA 1J6YA 4DH0A 4QT3A 1FKRA 2K8IA 1F8AB 3IHZA 3O5DA 1PBKA 1Q6HA 3KAFA 4DROA 4JFMA 2XP8A 2RUDA 4ODKA 2ZQTA 1FKFA 5DIVA 1YW5A 1K9QA 2ZR5A 1J4RA 2XP9A 2DG3A 4E5RA 2KE0A 4IQ2A 4J4OA 4DRNA 5B8IC 2MDIA 1BL4A 1Q1CA 3I6CA 4BF8A 2XP4A 1ZK6A 2VCDA 2DJYA 2JMFA 5CQ2A 1ROUA 1D7JA 1K9RA 2DK1A 3IKDA 3ODKA 4MSPA 2YSIA 3UQBA 1WMVA 2UZ5A 3O5GA 3PA7A 2D9FA 4W9OA 2M8IA 1O6WA 1R9HA 1FKIA 2RE3A 4FAPA 1JMQA 1FJDA 4ODNA 2F4EA 4ODLA 4ODMA 3O5EA 5I98A 2MLYA 2L2SA 4DRHA 2KI3A 2XP6A 2JZVA 2ZR6A 4DZ3A 2DWVA 1FAPA 2DK7A 2YSHA 1JNTA 3TC5A 4N19A 4QT2A 4QIBA 1J4IA 2RUCA 3JXVA 4TW8A 4DRMA 3CGMA 3LUOA 4ODOA 2M08A 2DG4A 2F21A 2IF4A 4DRKA 1M5YA 2LGOA 1W26A 2PPNA 3JYJA 3NTPA 1FKHA 3O5OA 3O5QA 4G50A 2VN1A 2XP3A 4NNRA 4R0XA 1ZCNA 1FKDA 1FKSA 2JV4A 2PBCA 4W9PA 4DT4A 4DRPA 2Q5AA 1TCOC 3CGNA 4IPXA 2M8JA 1QPFA 5HTGA 2PV2A 2PPOA 2JXWA 2AWGA 2KXQA 3O5FA 1JVWA 2ZAJA 5HKGA 5HW6A 5HW8A 2RUQA 1EG3A 1Q6UA 4LAYA 1FKLA 3OOBA 2PPPA 4ODPA 3KABA 3VAWA 5HUAA 1B6CA 3WH0A 5GPGA 4U86A 1Y0OA 3L4HA 2LKNA 4ODQA 3RGCA 3O5JA 5BXJA 3KACA 1KT0A 2E45A 2XP7A 2L4JA 1FKBA 4U85A 4MGVA 1HXVA 2DMVA 4W9QA 1L1PA 1P5QA 2M1IA 2MF9A 2M3OW 1YATA 4ODRA 2RSEA 4TW6A 1EQ3A 1A7XA 3IK8A 2KO7A 3UI4A 1Q6IA 5HWCA 2JX8A 3UI5A 2RQSA 3TCZA 2MLZA 2YSFA 3IKGA 1EG4A 3KAIA 3KADA 3KCEA 1J4HA 3H9RB 3NRKA 4LAVA 1KT1A 2PV3A 1NMWA 1JNSA 2MLXA 3KZ7A 3O5LA 3UQAA 1T11A 4DRJA 3KAHA 1EYMA 1FKTA 3M85A 1TK7A 1NSGA 2BA1A 1U79A 2LPVA 4TX0A 3JYMA 2ZQSA 4TNSA 2KFWA 5HWBA 1I5HW 2FKEA 4JYSA 2Y78A 2ZQUA 2XP5A 2PV1A 4ITZA 1F40A 2F2DA 1BKFA 3O5IA 1FKGA 1FD9A 2OFNA 4GGQA 2ZR4A 1NMVA 2KR7A 3PRBA 4JFJA 3RFWA 3PRDA 4DZ2A 3MDYB 2LJ4A 2KGJA 5HW7A 3O5RA 2M2AA 2ITKA 2XPBA 4J4NA 4JFKA 3UQIA 2XPAA 2ZQVA 2N87A 4LAXA 2RURA 4GIVA 3FAPA 4JFIA 3UI6A 1N1AA 1C9HA 3O5KA 4FN2A 1WR7A 1D7IA 4TYOA 3EY6A 1QZ2A 1FKKA 4IQCA 2YSGA 5D75A 2EZ5W 4REXA 3KAGA 2MPHA 4C02B 2DG9A 3O5MA 3NI6A 2FAPA 4DIPA 2YSBA 4DRQA 5AHTA 4G2PA 3LE4A 5DITA 4O2TA 3O5PA 1D7HA
chains in the Genus database with same CATH superfamily
5HT1A 1H0IA 1QPLA 3M7NA 3AS2A 3B7XA 2MNTA 5J6EA 3RMEA 3CNGA 4U84A 1ZB5A 3PRAA 1D6OA 2IUZA 1HKMA 1J6YA 3BMBA 2K8IA 1F8AB 5U47A 2WLZA 1NWUA 2A3AA 2ZQTA 5DIVA 2QRVA 2KE0A 3PR9A 1ZBWA 2A3BA 5B8IC 3I6CA 1ROUA 1K9RA 1WMVA 1FFRA 3O5GA 3ARTA 2AOSA 4KQZA 2M8IA 1EDQA 1FKIA 1R9HA 1E6RA 1FJDA 4ODLA 2MLYA 4P8UA 3MQHA 4DZ3A 2DWVA 3ARUA 2DK7A 4TW8A 1X6LA 2IF4A 1HJWA 4NNRA 2VN1A 1ZCNA 1FKSA 2JV4A 4DRPA 1WAWA 4IPXA 2DSWA 1KFWA 4S3KA 4DWSB 2AWGA 3O5FA 1FFQA 1RP5A 1EG3A 4ODPA 3VAWA 1OGGA 2PI6A 2DSVA 1FKBA 4U85A 4MGVA 3G6LA 1P5QA 4UDMA 5DEZA 3WD3A 3IK8A 2KO7A 1Q6IA 2JX8A 4NSBA 3ARYA 4LAVA 3H9RB 2FDMA 4MAVA 1JNSA 1ZU8A 3WIJA 3KZ7A 1JNEA 3UQAA 3AQUA 4DRJA 4R5EA 2ESCA 4PTMA 2KFWA 3WD2A 4Z2LA 4GGQA 2ZR4A 1NMVA 2KR7A 2WK2A 3PRDA 2LJ4A 2KGJA 2ITKA 2XPBA 5DO2A 3ARRA 4L3NA 2RURA 3MCBB 3AS3A 3FAPA 3OA5A 4JFIA 4URIA 3FY1A 4FN2A 1D7IA 1QZ2A 2P4VA 1FKKA 4IQCA 2YSGA 3KAGA 3CHEA 1ZL1A 2FAPA 4A0UA 2YSBA 5AHTA 1NWSA 5DITA 3O5PA 5DIUA 3GPKA 1LG2A 4LGXA 4QT3A 1VF8A 4JFMA 2XP8A 2RUDA 1FKFA 2B5UB 2XP9A 4E5RA 2MDIA 1GOIA 4BF8A 3FSBA 1ZK6A 3LKXB 5E66A 2YSIA 2UZ5A 4W9OA 4FAPA 1ZBKA 4ODNA 2F4EA 4ODMA 3W4RA 3PQHA 2O92A 5I98A 2B31A 2L2SA 4Q22A 4DRHA 3CHCA 2KI3A 2JZVA 4WKAA 4GLXA 1FAPA 4QIBA 1SR0A 4IT6A 4ODOA 2DG4A 2F21A 2OWOA 1HKJA 2LGOA 3JYJA 3O5OA 4G50A 5HTGA 5HW7A 4WJXA 1FKDA 3QOKA 1TCOC 3CGNA 1TFVA 2DPEA 2PV2A 4MNMA 2PPOA 2ZAJA 1NWTA 4ZPVR 4LAYA 5HUAA 4P8XA 1B6CA 3WH0A 1Y0OA 3L4HA 3RGCA 3O5JA 3RM4A 5BXJA 1KT0A 2E45A 4Z2IA 2DMVA 5E62A 1YATA 4ODRA 1EQ3A 1A7XA 4WK9A 5GQBA 3UI4A 1LL6A 3UI5A 3BXWA 1GRJA 2YSFA 3IKGA 1E44A 3KADA 4HARA 1W1PA 1KT1A 2PV3A 4A0TA 3WKZA 3ARSA 3ARVA 2A3CA 1FKTA 4ML4A 1NSGA 2BA1A 1U79A 4TX0A 3JYMA 4ZS6A 1I5HW 1W1TA 4JYSA 2Y78A 3WD1A 2PV1A 5JH8A 1F40A 1OGBA 2F2DA 1BKFA 5HWCA 1FKGA 4DT4A 4JFJA 2ETNA 1LL7A 1W1YA 3ARZA 3O5RA 3RM9A 4J4NA 1EHNA 2XPAA 2WAEA 4Z2KA 2WM0A 2DT3A 3O5KA 3EY6A 1E9LA 2A3EA 5D75A 2EZ5W 3LKXA 3FXYA 4C02B 2DG9A 3ARQA 4G2PA 1W1VA 2PN0A 4JFLA 2LAJA 4TW7A 3UF8A 3TDBA 2G8ZA 1W9UA 4LAWA 1EIBA 1FKJA 4NZCA 4P8WA 1D2KA 1FKRA 1PBKA 4DROA 1UR9A 4ODKA 3AROA 1ZBCA 2DT2A 1J4RA 2DG3A 4J4OA 1Q1CA 1BL4A 2XP4A 2VCDA 4MSPA 3IKDA 2DK1A 3ODKA 1XRVA 3PA7A 1O6WA 5E5WA 1JMQA 1HKKA 3WL0A 5HBFA 1CTNA 1NWRA 2ZR6A 1LL4A 2YSHA 4N19A 4DRMA 4MPKA 3CZ8A 3JXVA 1SYTA 2G41A 1WB0A 4DRKA 1FLCA 1M5YA 1W26A 2PPNA 3WD0A 3NTPA 1FKHA 1NH6A 2XP3A 2PBCA 2Q5AA 3B9DA 2M8JA 1QPFA 3GTYX 3MCBA 3AS1A 2KXQA 1JVWA 2RUQA 2YBTA 1Q6UA 3ALFA 4Z2HA 3OOBA 4MNLA 3CH9A 3KACA 1OWQA 2L4JA 1HXVA 2M1IA 2MF9A 2RQSA 2YAJB 2MLZA 1J4HA 2QF8A 1NMWA 2DT1A 2MLXA 2WADA 1TK7A 2O9OA 1LJYA 5HWBA 2FKEA 2XP5A 1ZBVA 4ITZA 3RFWA 1X6NA 4DZ2A 4WKFA 1JCHB 4Q7NA 3B9AA 4JFKA 3UQIA 4LAXA 1WNOA 1UR8A 2YBUA 1HKIA 1C9HA 1N1AA 4L72B 3AS0A 3O5MA 3NI6A 2EULA 4O2TA 5GPRA 4Z2JA 1PINA 1GUVA 4P8VA 4WKHA 1ROTA 1W9PA 4DRIA 4DH0A 2OLHA 3IHZA 4Z2GA 3O5DA 1Q6HA 3KAFA 1HJVA 3EIPA 1YW5A 3RM8A 3B9EA 1K9QA 2ZR5A 4IQ2A 5DF0A 1K9TA 4DRNA 2DJYA 2JMFA 5CQ2A 1D7JA 2WLYA 3UQBA 2D9FA 3FS8A 2RE3A 3ARPA 1LG1A 3ARXA 3O5EA 5E64A 3FSCA 1E6NA 2XP6A 2DSZA 4MNJA 1JNTA 3TC5A 1LQ0A 4QT2A 4DWSC 1J4IA 2RUCA 3CGMA 3LUOA 2M08A 1GPFA 4WIWA 4TNSA 3O5QA 5HW8A 5E65A 4DWSA 4R0XA 4W9PA 1E6PA 3WQVA 1ITXA 4IT4A 2JXWA 5HKGA 5HW6A 1H0GA 3WL1A 1FKLA 2PPPA 1E15A 3KABA 3ARWA 2Y8NB 5GPGA 4U86A 4ODQA 2LKNA 1E6ZA 2XP7A 3WQWA 4W9QA 1L1PA 4ZPWR 4S3JA 2M3OW 4ZPTR 2RSEA 4MTVA 4TW6A 4AY1A 4KR0B 3B8SA 3WD4A 3TCZA 4HBEA 1EG4A 3KAIA 3KCEA 3NRKA 3GU0A 3CHFA 3O5LA 3CHDA 1T11A 2DSUA 3KAHA 1EYMA 3M85A 1HJXA 2LPVA 4QZVB 2ZQSA 2ZQUA 3O5IA 1FD9A 2OFNA 4DWSD 3PRBA 1XHGA 1TR8A 3MDYB 4W5UA 2M2AA 2ZQVA 2N87A 1W9VA 4GIVA 3ALGA 4XAKA 3UI6A 1WR7A 4TYOA 1IX5A 4MNKA 4HBOA 2F23A 1JNDA 4REXA 2DT0A 2MPHA 3G6MA 4DIPA 1RD6A 4DRQA 1O6IA 3LE4A 3MQGA 1D7HA
chains in the Genus database with same CATH topology
5HT1A 1H0IA 1QPLA 3M7NA 3AS2A 3B7XA 2MNTA 5J6EA 3RMEA 3CNGA 4U84A 1ZB5A 3PRAA 1D6OA 2IUZA 1HKMA 1J6YA 2K8IA 1F8AB 5U47A 2WLZA 1NWUA 2A3AA 2ZQTA 5DIVA 2QRVA 2KE0A 3PR9A 1ZBWA 2A3BA 5B8IC 3I6CA 1ROUA 1K9RA 1WMVA 1FFRA 3O5GA 3ARTA 2AOSA 4KQZA 2M8IA 1EDQA 1FKIA 1R9HA 1E6RA 1FJDA 4ODLA 2MLYA 4P8UA 3MQHA 4DZ3A 2DWVA 3ARUA 2DK7A 4TW8A 1X6LA 2IF4A 1HJWA 4NNRA 2VN1A 1ZCNA 1FKSA 2JV4A 4DRPA 1WAWA 4IPXA 2DSWA 1KFWA 4S3KA 4DWSB 2AWGA 3O5FA 1FFQA 1RP5A 1EG3A 4ODPA 3VAWA 1OGGA 2PI6A 2DSVA 1FKBA 4U85A 4MGVA 3G6LA 1P5QA 5DEZA 3WD3A 3IK8A 2KO7A 1Q6IA 2JX8A 4NSBA 3ARYA 4LAVA 3H9RB 2FDMA 4MAVA 1JNSA 1ZU8A 3WIJA 3KZ7A 1JNEA 3UQAA 3AQUA 4DRJA 4R5EA 2ESCA 4PTMA 2KFWA 3WD2A 4Z2LA 4GGQA 2ZR4A 1NMVA 2KR7A 2WK2A 3PRDA 2LJ4A 2KGJA 2ITKA 2XPBA 5DO2A 3ARRA 4L3NA 2RURA 3MCBB 3AS3A 3FAPA 3OA5A 4JFIA 4URIA 3FY1A 4FN2A 1D7IA 1QZ2A 1FKKA 4IQCA 2YSGA 3KAGA 3CHEA 1ZL1A 2FAPA 4A0UA 2YSBA 5AHTA 1NWSA 5DITA 3O5PA 5DIUA 3GPKA 1LG2A 4LGXA 4QT3A 1VF8A 4JFMA 2XP8A 2RUDA 1FKFA 2XP9A 4E5RA 2MDIA 1GOIA 4BF8A 3FSBA 1ZK6A 3LKXB 5E66A 2YSIA 2UZ5A 4W9OA 4FAPA 1ZBKA 4ODNA 2F4EA 4ODMA 3W4RA 3PQHA 2O92A 5I98A 2B31A 2L2SA 4Q22A 4DRHA 3CHCA 2KI3A 2JZVA 4WKAA 4GLXA 1FAPA 4QIBA 1SR0A 4IT6A 4ODOA 2DG4A 2F21A 2OWOA 1HKJA 2LGOA 3JYJA 3O5OA 4G50A 5HTGA 5HW7A 4WJXA 1FKDA 3QOKA 1TCOC 3CGNA 1TFVA 2DPEA 2PV2A 4MNMA 2PPOA 2ZAJA 1NWTA 4ZPVR 4LAYA 5HUAA 4P8XA 1B6CA 3WH0A 1Y0OA 3L4HA 3RGCA 3O5JA 3RM4A 5BXJA 1KT0A 2E45A 4Z2IA 2DMVA 5E62A 1YATA 4ODRA 1EQ3A 1A7XA 4WK9A 5GQBA 3UI4A 1LL6A 3UI5A 3BXWA 2YSFA 3IKGA 3KADA 4HARA 1W1PA 1KT1A 2PV3A 4A0TA 3WKZA 3ARSA 3ARVA 2A3CA 1FKTA 4ML4A 1NSGA 2BA1A 1U79A 4TX0A 3JYMA 4ZS6A 1I5HW 1W1TA 4JYSA 2Y78A 3WD1A 2PV1A 5JH8A 1F40A 1OGBA 2F2DA 1BKFA 5HWCA 1FKGA 4DT4A 4JFJA 1LL7A 1W1YA 3ARZA 3O5RA 3RM9A 4J4NA 1EHNA 2XPAA 2WAEA 4Z2KA 2WM0A 2DT3A 3O5KA 3EY6A 1E9LA 2A3EA 5D75A 2EZ5W 3LKXA 3FXYA 4C02B 2DG9A 3ARQA 4G2PA 1W1VA 4JFLA 2LAJA 4TW7A 3UF8A 3TDBA 2G8ZA 1W9UA 4LAWA 1EIBA 1FKJA 4NZCA 4P8WA 1D2KA 1FKRA 1PBKA 4DROA 1UR9A 4ODKA 3AROA 1ZBCA 2DT2A 1J4RA 2DG3A 4J4OA 1Q1CA 1BL4A 2XP4A 2VCDA 4MSPA 3IKDA 2DK1A 3ODKA 1XRVA 3PA7A 1O6WA 5E5WA 1JMQA 1HKKA 3WL0A 5HBFA 1CTNA 1NWRA 2ZR6A 1LL4A 2YSHA 4N19A 4DRMA 4MPKA 3CZ8A 3JXVA 1SYTA 2G41A 1WB0A 4DRKA 1FLCA 1M5YA 1W26A 2PPNA 3WD0A 3NTPA 1FKHA 1NH6A 2XP3A 2PBCA 2Q5AA 3B9DA 2M8JA 1QPFA 3MCBA 3AS1A 2KXQA 1JVWA 2RUQA 2YBTA 1Q6UA 3ALFA 4Z2HA 3OOBA 4MNLA 3CH9A 3KACA 1OWQA 2L4JA 1HXVA 2M1IA 2MF9A 2RQSA 2YAJB 2MLZA 1J4HA 2QF8A 1NMWA 2DT1A 2MLXA 2WADA 1TK7A 2O9OA 1LJYA 5HWBA 2FKEA 2XP5A 1ZBVA 4ITZA 3RFWA 1X6NA 4DZ2A 4WKFA 4Q7NA 3B9AA 4JFKA 3UQIA 4LAXA 1WNOA 1UR8A 2YBUA 1HKIA 1C9HA 1N1AA 4L72B 3AS0A 3O5MA 3NI6A 4O2TA 5GPRA 4Z2JA 1PINA 1GUVA 4P8VA 4WKHA 1ROTA 1W9PA 4DRIA 4DH0A 2OLHA 3IHZA 4Z2GA 3O5DA 1Q6HA 3KAFA 1HJVA 1YW5A 3RM8A 3B9EA 1K9QA 2ZR5A 4IQ2A 5DF0A 1K9TA 4DRNA 2DJYA 2JMFA 5CQ2A 1D7JA 2WLYA 3UQBA 2D9FA 3FS8A 2RE3A 3ARPA 1LG1A 3ARXA 3O5EA 5E64A 3FSCA 1E6NA 2XP6A 2DSZA 4MNJA 1JNTA 3TC5A 1LQ0A 4QT2A 4DWSC 1J4IA 2RUCA 3CGMA 3LUOA 2M08A 1GPFA 4WIWA 4TNSA 3O5QA 5HW8A 5E65A 4DWSA 4R0XA 4W9PA 1E6PA 3WQVA 1ITXA 4IT4A 2JXWA 5HKGA 5HW6A 1H0GA 3WL1A 1FKLA 2PPPA 1E15A 3KABA 3ARWA 2Y8NB 5GPGA 4U86A 4ODQA 2LKNA 1E6ZA 2XP7A 3WQWA 4W9QA 1L1PA 4ZPWR 4S3JA 2M3OW 4ZPTR 2RSEA 4MTVA 4TW6A 4AY1A 4KR0B 3B8SA 3WD4A 3TCZA 4HBEA 1EG4A 3KAIA 3KCEA 3NRKA 3CHFA 3O5LA 3CHDA 1T11A 2DSUA 3KAHA 1EYMA 3M85A 1HJXA 2LPVA 4QZVB 2ZQSA 2ZQUA 3O5IA 1FD9A 2OFNA 4DWSD 3PRBA 1XHGA 1TR8A 3MDYB 4W5UA 2M2AA 2ZQVA 2N87A 1W9VA 4GIVA 3ALGA 4XAKA 3UI6A 1WR7A 4TYOA 1IX5A 4MNKA 4HBOA 1JNDA 4REXA 2DT0A 2MPHA 3G6MA 4DIPA 1RD6A 4DRQA 1O6IA 3LE4A 3MQGA 1D7HA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5DIU A;  3GPK A;  5HT1 A;  4JFL A;  2LAJ A;  4TW7 A;  3UF8 A;  1QPL A;  3M7N A;  1PIN A;  3B7X A;  3TDB A;  2MNT A;  5J6E A;  4LAW A;  1ROT A;  3CNG A;  4U84 A;  1D6O A;  4DRI A;  1FKJ A;  1J6Y A;  4DH0 A;  4QT3 A;  1FKR A;  2K8I A;  1F8A B;  3IHZ A;  3O5D A;  1PBK A;  1Q6H A;  3KAF A;  4DRO A;  4JFM A;  2XP8 A;  2RUD A;  4ODK A;  2ZQT A;  1FKF A;  5DIV A;  1YW5 A;  1K9Q A;  2ZR5 A;  1J4R A;  2XP9 A;  2DG3 A;  4E5R A;  2KE0 A;  4IQ2 A;  4J4O A;  4DRN A;  5B8I C;  2MDI A;  1BL4 A;  1Q1C A;  3I6C A;  4BF8 A;  2XP4 A;  1ZK6 A;  2VCD A;  2DJY A;  2JMF A;  5CQ2 A;  1ROU A;  1D7J A;  1K9R A;  2DK1 A;  3IKD A;  3ODK A;  4MSP A;  2YSI A;  3UQB A;  1WMV A;  2UZ5 A;  3O5G A;  3PA7 A;  2D9F A;  4W9O A;  2M8I A;  1O6W A;  1R9H A;  1FKI A;  2RE3 A;  4FAP A;  1JMQ A;  1FJD A;  4ODN A;  2F4E A;  4ODL A;  4ODM A;  3O5E A;  5I98 A;  2MLY A;  2L2S A;  4DRH A;  2KI3 A;  2XP6 A;  2JZV A;  2ZR6 A;  4DZ3 A;  2DWV A;  1FAP A;  2DK7 A;  2YSH A;  1JNT A;  3TC5 A;  4N19 A;  4QT2 A;  4QIB A;  1J4I A;  2RUC A;  3JXV A;  4TW8 A;  4DRM A;  3CGM A;  3LUO A;  4ODO A;  2M08 A;  2DG4 A;  2F21 A;  2IF4 A;  4DRK A;  1M5Y A;  2LGO A;  1W26 A;  2PPN A;  3JYJ A;  3NTP A;  1FKH A;  3O5O A;  3O5Q A;  4G50 A;  2VN1 A;  2XP3 A;  4NNR A;  4R0X A;  1ZCN A;  1FKD A;  1FKS A;  2JV4 A;  2PBC A;  4W9P A;  4DT4 A;  4DRP A;  2Q5A A;  1TCO C;  3CGN A;  4IPX A;  2M8J A;  1QPF A;  5HTG A;  2PV2 A;  2PPO A;  2JXW A;  2AWG A;  2KXQ A;  3O5F A;  1JVW A;  2ZAJ A;  5HKG A;  5HW6 A;  5HW8 A;  2RUQ A;  1EG3 A;  1Q6U A;  4LAY A;  1FKL A;  3OOB A;  2PPP A;  4ODP A;  3KAB A;  3VAW A;  5HUA A;  1B6C A;  3WH0 A;  5GPG A;  4U86 A;  1Y0O A;  3L4H A;  2LKN A;  4ODQ A;  3RGC A;  3O5J A;  5BXJ A;  3KAC A;  1KT0 A;  2E45 A;  2XP7 A;  2L4J A;  1FKB A;  4U85 A;  4MGV A;  1HXV A;  2DMV A;  4W9Q A;  1L1P A;  1P5Q A;  2M1I A;  2MF9 A;  2M3O W;  1YAT A;  4ODR A;  2RSE A;  4TW6 A;  1EQ3 A;  1A7X A;  3IK8 A;  2KO7 A;  3UI4 A;  1Q6I A;  5HWC A;  2JX8 A;  3UI5 A;  2RQS A;  3TCZ A;  2MLZ A;  2YSF A;  3IKG A;  1EG4 A;  3KAI A;  3KAD A;  3KCE A;  1J4H A;  3H9R B;  3NRK A;  4LAV A;  1KT1 A;  2PV3 A;  1NMW A;  1JNS A;  2MLX A;  3KZ7 A;  3O5L A;  3UQA A;  1T11 A;  4DRJ A;  3KAH A;  1EYM A;  1FKT A;  3M85 A;  1TK7 A;  1NSG A;  2BA1 A;  1U79 A;  2LPV A;  4TX0 A;  3JYM A;  2ZQS A;  4TNS A;  2KFW A;  5HWB A;  1I5H W;  2FKE A;  4JYS A;  2Y78 A;  2ZQU A;  2XP5 A;  2PV1 A;  4ITZ A;  1F40 A;  2F2D A;  1BKF A;  3O5I A;  1FKG A;  1FD9 A;  2OFN A;  4GGQ A;  2ZR4 A;  1NMV A;  2KR7 A;  3PRB A;  4JFJ A;  3RFW A;  3PRD A;  4DZ2 A;  3MDY B;  2LJ4 A;  2KGJ A;  5HW7 A;  3O5R A;  2M2A A;  2ITK A;  2XPB A;  4J4N A;  4JFK A;  3UQI A;  2XPA A;  2ZQV A;  2N87 A;  4LAX A;  2RUR A;  4GIV A;  3FAP A;  4JFI A;  3UI6 A;  1N1A A;  1C9H A;  3O5K A;  4FN2 A;  1WR7 A;  1D7I A;  4TYO A;  3EY6 A;  1QZ2 A;  1FKK A;  4IQC A;  2YSG A;  5D75 A;  2EZ5 W;  4REX A;  3KAG A;  2MPH A;  4C02 B;  2DG9 A;  3O5M A;  3NI6 A;  2FAP A;  4DIP A;  2YSB A;  4DRQ A;  5AHT A;  4G2P A;  3LE4 A;  5DIT A;  4O2T A;  3O5P A;  1D7H A; 
#chains in the Genus database with same CATH topology
 5HT1 A;  1H0I A;  1QPL A;  3M7N A;  3AS2 A;  3B7X A;  2MNT A;  5J6E A;  3RME A;  3CNG A;  4U84 A;  1ZB5 A;  3PRA A;  1D6O A;  2IUZ A;  1HKM A;  1J6Y A;  3BMB A;  2K8I A;  1F8A B;  5U47 A;  2WLZ A;  1NWU A;  2A3A A;  2ZQT A;  5DIV A;  2QRV A;  2KE0 A;  3PR9 A;  1ZBW A;  2A3B A;  5B8I C;  3I6C A;  1ROU A;  1K9R A;  1WMV A;  1FFR A;  3O5G A;  3ART A;  2AOS A;  4KQZ A;  2M8I A;  1EDQ A;  1FKI A;  1R9H A;  1E6R A;  1FJD A;  4ODL A;  2MLY A;  4P8U A;  3MQH A;  4DZ3 A;  2DWV A;  3ARU A;  2DK7 A;  4TW8 A;  1X6L A;  2IF4 A;  1HJW A;  4NNR A;  2VN1 A;  1ZCN A;  1FKS A;  2JV4 A;  4DRP A;  1WAW A;  4IPX A;  2DSW A;  1KFW A;  4S3K A;  4DWS B;  2AWG A;  3O5F A;  1FFQ A;  1RP5 A;  1EG3 A;  4ODP A;  3VAW A;  1OGG A;  2PI6 A;  2DSV A;  1FKB A;  4U85 A;  4MGV A;  3G6L A;  1P5Q A;  4UDM A;  5DEZ A;  3WD3 A;  3IK8 A;  2KO7 A;  1Q6I A;  2JX8 A;  4NSB A;  3ARY A;  4LAV A;  3H9R B;  2FDM A;  4MAV A;  1JNS A;  1ZU8 A;  3WIJ A;  3KZ7 A;  1JNE A;  3UQA A;  3AQU A;  4DRJ A;  4R5E A;  2ESC A;  4PTM A;  2KFW A;  3WD2 A;  4Z2L A;  4GGQ A;  2ZR4 A;  1NMV A;  2KR7 A;  2WK2 A;  3PRD A;  2LJ4 A;  2KGJ A;  2ITK A;  2XPB A;  5DO2 A;  3ARR A;  4L3N A;  2RUR A;  3MCB B;  3AS3 A;  3FAP A;  3OA5 A;  4JFI A;  4URI A;  3FY1 A;  4FN2 A;  1D7I A;  1QZ2 A;  2P4V A;  1FKK A;  4IQC A;  2YSG A;  3KAG A;  3CHE A;  1ZL1 A;  2FAP A;  4A0U A;  2YSB A;  5AHT A;  1NWS A;  5DIT A;  3O5P A;  5DIU A;  3GPK A;  1LG2 A;  4LGX A;  4QT3 A;  1VF8 A;  4JFM A;  2XP8 A;  2RUD A;  1FKF A;  2B5U B;  2XP9 A;  4E5R A;  2MDI A;  1GOI A;  4BF8 A;  3FSB A;  1ZK6 A;  3LKX B;  5E66 A;  2YSI A;  2UZ5 A;  4W9O A;  4FAP A;  1ZBK A;  4ODN A;  2F4E A;  4ODM A;  3W4R A;  3PQH A;  2O92 A;  5I98 A;  2B31 A;  2L2S A;  4Q22 A;  4DRH A;  3CHC A;  2KI3 A;  2JZV A;  4WKA A;  4GLX A;  1FAP A;  4QIB A;  1SR0 A;  4IT6 A;  4ODO A;  2DG4 A;  2F21 A;  2OWO A;  1HKJ A;  2LGO A;  3JYJ A;  3O5O A;  4G50 A;  5HTG A;  5HW7 A;  4WJX A;  1FKD A;  3QOK A;  1TCO C;  3CGN A;  1TFV A;  2DPE A;  2PV2 A;  4MNM A;  2PPO A;  2ZAJ A;  1NWT A;  4ZPV R;  4LAY A;  5HUA A;  4P8X A;  1B6C A;  3WH0 A;  1Y0O A;  3L4H A;  3RGC A;  3O5J A;  3RM4 A;  5BXJ A;  1KT0 A;  2E45 A;  4Z2I A;  2DMV A;  5E62 A;  1YAT A;  4ODR A;  1EQ3 A;  1A7X A;  4WK9 A;  5GQB A;  3UI4 A;  1LL6 A;  3UI5 A;  3BXW A;  1GRJ A;  2YSF A;  3IKG A;  1E44 A;  3KAD A;  4HAR A;  1W1P A;  1KT1 A;  2PV3 A;  4A0T A;  3WKZ A;  3ARS A;  3ARV A;  2A3C A;  1FKT A;  4ML4 A;  1NSG A;  2BA1 A;  1U79 A;  4TX0 A;  3JYM A;  4ZS6 A;  1I5H W;  1W1T A;  4JYS A;  2Y78 A;  3WD1 A;  2PV1 A;  5JH8 A;  1F40 A;  1OGB A;  2F2D A;  1BKF A;  5HWC A;  1FKG A;  4DT4 A;  4JFJ A;  2ETN A;  1LL7 A;  1W1Y A;  3ARZ A;  3O5R A;  3RM9 A;  4J4N A;  1EHN A;  2XPA A;  2WAE A;  4Z2K A;  2WM0 A;  2DT3 A;  3O5K A;  3EY6 A;  1E9L A;  2A3E A;  5D75 A;  2EZ5 W;  3LKX A;  3FXY A;  4C02 B;  2DG9 A;  3ARQ A;  4G2P A;  1W1V A;  2PN0 A;  4JFL A;  2LAJ A;  4TW7 A;  3UF8 A;  3TDB A;  2G8Z A;  1W9U A;  4LAW A;  1EIB A;  1FKJ A;  4NZC A;  4P8W A;  1D2K A;  1FKR A;  1PBK A;  4DRO A;  1UR9 A;  4ODK A;  3ARO A;  1ZBC A;  2DT2 A;  1J4R A;  2DG3 A;  4J4O A;  1Q1C A;  1BL4 A;  2XP4 A;  2VCD A;  4MSP A;  3IKD A;  2DK1 A;  3ODK A;  1XRV A;  3PA7 A;  1O6W A;  5E5W A;  1JMQ A;  1HKK A;  3WL0 A;  5HBF A;  1CTN A;  1NWR A;  2ZR6 A;  1LL4 A;  2YSH A;  4N19 A;  4DRM A;  4MPK A;  3CZ8 A;  3JXV A;  1SYT A;  2G41 A;  1WB0 A;  4DRK A;  1FLC A;  1M5Y A;  1W26 A;  2PPN A;  3WD0 A;  3NTP A;  1FKH A;  1NH6 A;  2XP3 A;  2PBC A;  2Q5A A;  3B9D A;  2M8J A;  1QPF A;  3GTY X;  3MCB A;  3AS1 A;  2KXQ A;  1JVW A;  2RUQ A;  2YBT A;  1Q6U A;  3ALF A;  4Z2H A;  3OOB A;  4MNL A;  3CH9 A;  3KAC A;  1OWQ A;  2L4J A;  1HXV A;  2M1I A;  2MF9 A;  2RQS A;  2YAJ B;  2MLZ A;  1J4H A;  2QF8 A;  1NMW A;  2DT1 A;  2MLX A;  2WAD A;  1TK7 A;  2O9O A;  1LJY A;  5HWB A;  2FKE A;  2XP5 A;  1ZBV A;  4ITZ A;  3RFW A;  1X6N A;  4DZ2 A;  4WKF A;  1JCH B;  4Q7N A;  3B9A A;  4JFK A;  3UQI A;  4LAX A;  1WNO A;  1UR8 A;  2YBU A;  1HKI A;  1C9H A;  1N1A A;  4L72 B;  3AS0 A;  3O5M A;  3NI6 A;  2EUL A;  4O2T A;  5GPR A;  4Z2J A;  1PIN A;  1GUV A;  4P8V A;  4WKH A;  1ROT A;  1W9P A;  4DRI A;  4DH0 A;  2OLH A;  3IHZ A;  4Z2G A;  3O5D A;  1Q6H A;  3KAF A;  1HJV A;  3EIP A;  1YW5 A;  3RM8 A;  3B9E A;  1K9Q A;  2ZR5 A;  4IQ2 A;  5DF0 A;  1K9T A;  4DRN A;  2DJY A;  2JMF A;  5CQ2 A;  1D7J A;  2WLY A;  3UQB A;  2D9F A;  3FS8 A;  2RE3 A;  3ARP A;  1LG1 A;  3ARX A;  3O5E A;  5E64 A;  3FSC A;  1E6N A;  2XP6 A;  2DSZ A;  4MNJ A;  1JNT A;  3TC5 A;  1LQ0 A;  4QT2 A;  4DWS C;  1J4I A;  2RUC A;  3CGM A;  3LUO A;  2M08 A;  1GPF A;  4WIW A;  4TNS A;  3O5Q A;  5HW8 A;  5E65 A;  4DWS A;  4R0X A;  4W9P A;  1E6P A;  3WQV A;  1ITX A;  4IT4 A;  2JXW A;  5HKG A;  5HW6 A;  1H0G A;  3WL1 A;  1FKL A;  2PPP A;  1E15 A;  3KAB A;  3ARW A;  2Y8N B;  5GPG A;  4U86 A;  4ODQ A;  2LKN A;  1E6Z A;  2XP7 A;  3WQW A;  4W9Q A;  1L1P A;  4ZPW R;  4S3J A;  2M3O W;  4ZPT R;  2RSE A;  4MTV A;  4TW6 A;  4AY1 A;  4KR0 B;  3B8S A;  3WD4 A;  3TCZ A;  4HBE A;  1EG4 A;  3KAI A;  3KCE A;  3NRK A;  3GU0 A;  3CHF A;  3O5L A;  3CHD A;  1T11 A;  2DSU A;  3KAH A;  1EYM A;  3M85 A;  1HJX A;  2LPV A;  4QZV B;  2ZQS A;  2ZQU A;  3O5I A;  1FD9 A;  2OFN A;  4DWS D;  3PRB A;  1XHG A;  1TR8 A;  3MDY B;  4W5U A;  2M2A A;  2ZQV A;  2N87 A;  1W9V A;  4GIV A;  3ALG A;  4XAK A;  3UI6 A;  1WR7 A;  4TYO A;  1IX5 A;  4MNK A;  4HBO A;  2F23 A;  1JND A;  4REX A;  2DT0 A;  2MPH A;  3G6M A;  4DIP A;  1RD6 A;  4DRQ A;  1O6I A;  3LE4 A;  3MQG A;  1D7H A; 
#chains in the Genus database with same CATH homology
 5HT1 A;  1H0I A;  1QPL A;  3M7N A;  3AS2 A;  3B7X A;  2MNT A;  5J6E A;  3RME A;  3CNG A;  4U84 A;  1ZB5 A;  3PRA A;  1D6O A;  2IUZ A;  1HKM A;  1J6Y A;  2K8I A;  1F8A B;  5U47 A;  2WLZ A;  1NWU A;  2A3A A;  2ZQT A;  5DIV A;  2QRV A;  2KE0 A;  3PR9 A;  1ZBW A;  2A3B A;  5B8I C;  3I6C A;  1ROU A;  1K9R A;  1WMV A;  1FFR A;  3O5G A;  3ART A;  2AOS A;  4KQZ A;  2M8I A;  1EDQ A;  1FKI A;  1R9H A;  1E6R A;  1FJD A;  4ODL A;  2MLY A;  4P8U A;  3MQH A;  4DZ3 A;  2DWV A;  3ARU A;  2DK7 A;  4TW8 A;  1X6L A;  2IF4 A;  1HJW A;  4NNR A;  2VN1 A;  1ZCN A;  1FKS A;  2JV4 A;  4DRP A;  1WAW A;  4IPX A;  2DSW A;  1KFW A;  4S3K A;  4DWS B;  2AWG A;  3O5F A;  1FFQ A;  1RP5 A;  1EG3 A;  4ODP A;  3VAW A;  1OGG A;  2PI6 A;  2DSV A;  1FKB A;  4U85 A;  4MGV A;  3G6L A;  1P5Q A;  5DEZ A;  3WD3 A;  3IK8 A;  2KO7 A;  1Q6I A;  2JX8 A;  4NSB A;  3ARY A;  4LAV A;  3H9R B;  2FDM A;  4MAV A;  1JNS A;  1ZU8 A;  3WIJ A;  3KZ7 A;  1JNE A;  3UQA A;  3AQU A;  4DRJ A;  4R5E A;  2ESC A;  4PTM A;  2KFW A;  3WD2 A;  4Z2L A;  4GGQ A;  2ZR4 A;  1NMV A;  2KR7 A;  2WK2 A;  3PRD A;  2LJ4 A;  2KGJ A;  2ITK A;  2XPB A;  5DO2 A;  3ARR A;  4L3N A;  2RUR A;  3MCB B;  3AS3 A;  3FAP A;  3OA5 A;  4JFI A;  4URI A;  3FY1 A;  4FN2 A;  1D7I A;  1QZ2 A;  1FKK A;  4IQC A;  2YSG A;  3KAG A;  3CHE A;  1ZL1 A;  2FAP A;  4A0U A;  2YSB A;  5AHT A;  1NWS A;  5DIT A;  3O5P A;  5DIU A;  3GPK A;  1LG2 A;  4LGX A;  4QT3 A;  1VF8 A;  4JFM A;  2XP8 A;  2RUD A;  1FKF A;  2XP9 A;  4E5R A;  2MDI A;  1GOI A;  4BF8 A;  3FSB A;  1ZK6 A;  3LKX B;  5E66 A;  2YSI A;  2UZ5 A;  4W9O A;  4FAP A;  1ZBK A;  4ODN A;  2F4E A;  4ODM A;  3W4R A;  3PQH A;  2O92 A;  5I98 A;  2B31 A;  2L2S A;  4Q22 A;  4DRH A;  3CHC A;  2KI3 A;  2JZV A;  4WKA A;  4GLX A;  1FAP A;  4QIB A;  1SR0 A;  4IT6 A;  4ODO A;  2DG4 A;  2F21 A;  2OWO A;  1HKJ A;  2LGO A;  3JYJ A;  3O5O A;  4G50 A;  5HTG A;  5HW7 A;  4WJX A;  1FKD A;  3QOK A;  1TCO C;  3CGN A;  1TFV A;  2DPE A;  2PV2 A;  4MNM A;  2PPO A;  2ZAJ A;  1NWT A;  4ZPV R;  4LAY A;  5HUA A;  4P8X A;  1B6C A;  3WH0 A;  1Y0O A;  3L4H A;  3RGC A;  3O5J A;  3RM4 A;  5BXJ A;  1KT0 A;  2E45 A;  4Z2I A;  2DMV A;  5E62 A;  1YAT A;  4ODR A;  1EQ3 A;  1A7X A;  4WK9 A;  5GQB A;  3UI4 A;  1LL6 A;  3UI5 A;  3BXW A;  2YSF A;  3IKG A;  3KAD A;  4HAR A;  1W1P A;  1KT1 A;  2PV3 A;  4A0T A;  3WKZ A;  3ARS A;  3ARV A;  2A3C A;  1FKT A;  4ML4 A;  1NSG A;  2BA1 A;  1U79 A;  4TX0 A;  3JYM A;  4ZS6 A;  1I5H W;  1W1T A;  4JYS A;  2Y78 A;  3WD1 A;  2PV1 A;  5JH8 A;  1F40 A;  1OGB A;  2F2D A;  1BKF A;  5HWC A;  1FKG A;  4DT4 A;  4JFJ A;  1LL7 A;  1W1Y A;  3ARZ A;  3O5R A;  3RM9 A;  4J4N A;  1EHN A;  2XPA A;  2WAE A;  4Z2K A;  2WM0 A;  2DT3 A;  3O5K A;  3EY6 A;  1E9L A;  2A3E A;  5D75 A;  2EZ5 W;  3LKX A;  3FXY A;  4C02 B;  2DG9 A;  3ARQ A;  4G2P A;  1W1V A;  4JFL A;  2LAJ A;  4TW7 A;  3UF8 A;  3TDB A;  2G8Z A;  1W9U A;  4LAW A;  1EIB A;  1FKJ A;  4NZC A;  4P8W A;  1D2K A;  1FKR A;  1PBK A;  4DRO A;  1UR9 A;  4ODK A;  3ARO A;  1ZBC A;  2DT2 A;  1J4R A;  2DG3 A;  4J4O A;  1Q1C A;  1BL4 A;  2XP4 A;  2VCD A;  4MSP A;  3IKD A;  2DK1 A;  3ODK A;  1XRV A;  3PA7 A;  1O6W A;  5E5W A;  1JMQ A;  1HKK A;  3WL0 A;  5HBF A;  1CTN A;  1NWR A;  2ZR6 A;  1LL4 A;  2YSH A;  4N19 A;  4DRM A;  4MPK A;  3CZ8 A;  3JXV A;  1SYT A;  2G41 A;  1WB0 A;  4DRK A;  1FLC A;  1M5Y A;  1W26 A;  2PPN A;  3WD0 A;  3NTP A;  1FKH A;  1NH6 A;  2XP3 A;  2PBC A;  2Q5A A;  3B9D A;  2M8J A;  1QPF A;  3MCB A;  3AS1 A;  2KXQ A;  1JVW A;  2RUQ A;  2YBT A;  1Q6U A;  3ALF A;  4Z2H A;  3OOB A;  4MNL A;  3CH9 A;  3KAC A;  1OWQ A;  2L4J A;  1HXV A;  2M1I A;  2MF9 A;  2RQS A;  2YAJ B;  2MLZ A;  1J4H A;  2QF8 A;  1NMW A;  2DT1 A;  2MLX A;  2WAD A;  1TK7 A;  2O9O A;  1LJY A;  5HWB A;  2FKE A;  2XP5 A;  1ZBV A;  4ITZ A;  3RFW A;  1X6N A;  4DZ2 A;  4WKF A;  4Q7N A;  3B9A A;  4JFK A;  3UQI A;  4LAX A;  1WNO A;  1UR8 A;  2YBU A;  1HKI A;  1C9H A;  1N1A A;  4L72 B;  3AS0 A;  3O5M A;  3NI6 A;  4O2T A;  5GPR A;  4Z2J A;  1PIN A;  1GUV A;  4P8V A;  4WKH A;  1ROT A;  1W9P A;  4DRI A;  4DH0 A;  2OLH A;  3IHZ A;  4Z2G A;  3O5D A;  1Q6H A;  3KAF A;  1HJV A;  1YW5 A;  3RM8 A;  3B9E A;  1K9Q A;  2ZR5 A;  4IQ2 A;  5DF0 A;  1K9T A;  4DRN A;  2DJY A;  2JMF A;  5CQ2 A;  1D7J A;  2WLY A;  3UQB A;  2D9F A;  3FS8 A;  2RE3 A;  3ARP A;  1LG1 A;  3ARX A;  3O5E A;  5E64 A;  3FSC A;  1E6N A;  2XP6 A;  2DSZ A;  4MNJ A;  1JNT A;  3TC5 A;  1LQ0 A;  4QT2 A;  4DWS C;  1J4I A;  2RUC A;  3CGM A;  3LUO A;  2M08 A;  1GPF A;  4WIW A;  4TNS A;  3O5Q A;  5HW8 A;  5E65 A;  4DWS A;  4R0X A;  4W9P A;  1E6P A;  3WQV A;  1ITX A;  4IT4 A;  2JXW A;  5HKG A;  5HW6 A;  1H0G A;  3WL1 A;  1FKL A;  2PPP A;  1E15 A;  3KAB A;  3ARW A;  2Y8N B;  5GPG A;  4U86 A;  4ODQ A;  2LKN A;  1E6Z A;  2XP7 A;  3WQW A;  4W9Q A;  1L1P A;  4ZPW R;  4S3J A;  2M3O W;  4ZPT R;  2RSE A;  4MTV A;  4TW6 A;  4AY1 A;  4KR0 B;  3B8S A;  3WD4 A;  3TCZ A;  4HBE A;  1EG4 A;  3KAI A;  3KCE A;  3NRK A;  3CHF A;  3O5L A;  3CHD A;  1T11 A;  2DSU A;  3KAH A;  1EYM A;  3M85 A;  1HJX A;  2LPV A;  4QZV B;  2ZQS A;  2ZQU A;  3O5I A;  1FD9 A;  2OFN A;  4DWS D;  3PRB A;  1XHG A;  1TR8 A;  3MDY B;  4W5U A;  2M2A A;  2ZQV A;  2N87 A;  1W9V A;  4GIV A;  3ALG A;  4XAK A;  3UI6 A;  1WR7 A;  4TYO A;  1IX5 A;  4MNK A;  4HBO A;  1JND A;  4REX A;  2DT0 A;  2MPH A;  3G6M A;  4DIP A;  1RD6 A;  4DRQ A;  1O6I A;  3LE4 A;  3MQG A;  1D7H A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...