3OOBA

Structural and functional insights of directly targeting pin1 by epigallocatechin-3-gallate
Total Genus 49
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
49
sequence length
158
structure length
146
Chain Sequence
b'KLPPGWEKAMSRSSGRVYYFNHITNASQWERPSEPARVRCSHLLVKHSQSRRPSSWRQEKITRTKEEALELINGYIQKIKSGEEDFESLASQFSDCSSAKARGDLGAFSRGQMQKPFEDASFALRTGEMSGPVFTDSGIHIILRTE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Peptidyl-prolyl cis-trans isomerase NIMA-interacting 1
publication title Epigallocatechin-gallate suppresses tumorigenesis by directly targeting Pin1.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Isomerase
total genus 49
structure length 146
sequence length 158
ec nomenclature ec 5.2.1.8: Peptidylprolyl isomerase.
pdb deposition date 2010-08-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00397 WW WW domain
A PF00639 Rotamase PPIC-type PPIASE domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.20.70.10 Mainly Beta Single Sheet Ubiquitin Ligase Nedd4; Chain: W; Ubiquitin Ligase Nedd4; Chain: W; 3oobA01
3.10.50.40 Alpha Beta Roll Chitinase A; domain 3 Chitinase A; domain 3 3oobA02
3KAHA 1N1AA 3O5KA 4ODQA 4LAWA 4DIPA 4QIBA 2F21A 3O5LA 4TW8A 2MF9A 3EY6A 1I5HW 4U86A 1Q6IA 1YATA 1K9RA 1FAPA 3PRBA 1FKIA 3RGCA 1YW5A 2OFNA 3UI5A 2ZQTA 5DIUA 3O5DA 4DRQA 1QPLA 2XP9A 4DRPA 3CGNA 3JXVA 4W9OA 2VCDA 2EZ5W 2YSIA 3JYJA 4BF8A 2RUCA 5D75A 4TW7A 2XP5A 2DG9A 2DG4A 4J4OA 1NSGA 1W26A 3NRKA 2ZQUA 3GPKA 2KXQA 2E45A 4DRJA 2RE3A 3NTPA 2FKEA 2ZR5A 4DZ2A 2ZR4A 4DT4A 1Q1CA 2JV4A 5I98A 2M8JA 1HXVA 4JYSA 2YSFA 2DK1A 3KABA 2M8IA 4FAPA 2DMVA 4DRHA 4ODRA 2MLXA 5HTGA 2JXWA 2L2SA 1FD9A 3VAWA 5DITA 4IQCA 4TX0A 3O5GA 2L4JA 2D9FA 3UI6A 1WR7A 2DK7A 2Q5AA 2DWVA 1BL4A 1KT0A 4DROA 2LKNA 4JFIA 3TC5A 3O5QA 2MLZA 2ITKA 3LE4A 5CQ2A 4ODOA 1L1PA 1T11A 1F8AB 2XP4A 2LJ4A 1QZ2A 2BA1A 1FKBA 2RSEA 3RFWA 2Y78A 2IF4A 3O5IA 5B8IC 1JNTA 3IK8A 1A7XA 3KADA 3L4HA 4ODMA 2N87A 2PPOA 3M7NA 2XPAA 3WH0A 2F2DA 3PRDA 2LAJA 2LPVA 4J4NA 5HT1A 3I6CA 4JFMA 4DH0A 4W9PA 1FKLA 2ZQVA 3O5RA 4C02B 2YSGA 3O5EA 2KFWA 5BXJA 3TDBA 1J4HA 3UQAA 1D7JA 3UI4A 3H9RB 1PINA 5HW8A 2RQSA 4O2TA 1TCOC 1FJDA 2PPPA 1PBKA 1JNSA 4FN2A 1D6OA 2PPNA 4DRNA 2F4EA 2JMFA 4JFLA 2K8IA 1TK7A 4LAYA 5J6EA 2KE0A 3FAPA 4JFJA 1R9HA 1BKFA 1WMVA 4G2PA 4ODLA 1K9QA 1FKTA 1EG4A 4E5RA 1D7IA 1D7HA 3IHZA 2YSHA 2KR7A 3JYMA 3KAFA 1QPFA 1C9HA 4REXA 4LAVA 1J4RA 4ODNA 4GGQA 1FKFA 3OOBA 1FKGA 1U79A 2FAPA 3UQBA 3KZ7A 1EG3A 5DIVA 4ITZA 3CNGA 4QT2A 2ZR6A 2XPBA 2XP8A 4R0XA 4N19A 4W9QA 3TCZA 3MDYB 3O5JA 4MGVA 4TNSA 3O5PA 1Q6UA 1FKJA 1FKKA 3O5OA 3CGMA 2PBCA 3UF8A 2VN1A 1FKSA 4JFKA 3LUOA 1O6WA 2MNTA 4G50A 3UQIA 3KAIA 5HW6A 2XP7A 2M3OW 1B6CA 2PV3A 3PA7A 2M1IA 2KI3A 4GIVA 2LGOA 4IQ2A 1EQ3A 1ZK6A 3KACA 3O5MA 4DRMA 1FKDA 4DZ3A 1Y0OA 2ZQSA 2MLYA 2YSBA 5HW7A 2PV2A 3IKGA 2RUDA 4DRKA 3O5FA 2PV1A 5HKGA 1FKRA 1F40A 2JX8A 2KGJA 3M85A 1JVWA 5HWBA 2XP3A 1M5YA 1ROUA 2JZVA 4IPXA 4U84A 4ODKA 3IKDA 1Q6HA 4U85A 1EYMA 1ROTA 1KT1A 2DJYA 4NNRA 3B7XA 3KCEA 4TW6A 2KO7A 1JMQA 1ZCNA 1FKHA 2DG3A 2M08A 2M2AA 1P5QA 5AHTA 4TYOA 4ODPA 4MSPA 5HWCA 5HUAA 5GPGA 2MDIA 2UZ5A 1NMVA 2XP6A 1NMWA 4DRIA 2RUQA 1J4IA 3ODKA 2ZAJA 3KAGA 1J6YA 2AWGA 2RURA 2MPHA 4LAXA 3NI6A 4QT3A
chains in the Genus database with same CATH superfamily
3KAHA 1N1AA 1LL4A 4HBOA 3O5KA 4ODQA 1RP5A 4LAWA 1H0GA 3BMBA 4DIPA 4QIBA 1HKMA 2F21A 3QOKA 3MCBA 3AS0A 1E6ZA 5DEZA 4DWSD 3B8SA 3O5LA 4TW8A 2MF9A 1W9UA 3EY6A 1I5HW 4U86A 1X6NA 4ZS6A 1Q6IA 2A3CA 1YATA 1EIBA 1UR9A 1O6IA 1K9RA 1FAPA 3PRBA 1FKIA 5E5WA 4Z2LA 1RD6A 3RGCA 1YW5A 3LKXA 2DPEA 2OFNA 3UI5A 3WD2A 2ZQTA 2A3AA 1SYTA 5E62A 5DIUA 4IT6A 3O5DA 3CHDA 4DRQA 2YAJB 4NZCA 1LG2A 1QPLA 2XP9A 3G6MA 4XAKA 4DRPA 3CGNA 1OWQA 4MNMA 3JXVA 2WAEA 2VCDA 4W9OA 2EZ5W 2YSIA 4ZPWR 3JYJA 4BF8A 2RUCA 5D75A 4TW7A 3BXWA 1HKIA 2XP5A 2DG9A 2A3EA 2DG4A 4J4OA 3RM9A 1NSGA 1W26A 1ZL1A 4DWSB 1WNOA 3NRKA 1NWRA 2DSVA 2ZQUA 5E64A 2WLYA 3GPKA 2WM0A 2DSZA 2KXQA 2E45A 1GPFA 4DRJA 2RE3A 2Y8NB 3NTPA 3B9AA 2FKEA 2ZR5A 3PR9A 2YBUA 3WD3A 4DZ2A 2ZR4A 1HJXA 2ETNA 4DT4A 1Q1CA 3FSBA 3FXYA 4A0UA 4Q7NA 3WD1A 2JV4A 3CHFA 3EIPA 1W1TA 5I98A 2M8JA 1ZU8A 3ARPA 1HJVA 1HXVA 3WD0A 4JYSA 2YSFA 2DK1A 3KABA 2M8IA 3ARZA 4FAPA 2DMVA 4DRHA 5HBFA 1E6PA 1CTNA 4ODRA 2DSWA 1NWSA 1W9VA 2MLXA 5HTGA 2JXWA 2L2SA 1FD9A 3VAWA 5DITA 3RM8A 4IQCA 2QRVA 1H0IA 4TX0A 4MNJA 4ZPTR 5E65A 4LGXA 3O5GA 2L4JA 2D9FA 3UI6A 1WR7A 2DK7A 2Q5AA 2DWVA 1XHGA 1BL4A 1TR8A 1KT0A 4DROA 2LKNA 1D2KA 4JFIA 3TC5A 3O5QA 3CZ8A 1FFRA 3ARYA 3ARUA 1E44A 2MLZA 2ITKA 3LE4A 5CQ2A 4ODOA 4WKFA 1L1PA 1T11A 1F8AB 2XP4A 3B9DA 2LJ4A 1W1YA 1QZ2A 4P8XA 2BA1A 1FKBA 2RSEA 3RFWA 3WL1A 1GOIA 2FDMA 2Y78A 2IF4A 3O5IA 3ARVA 5B8IC 1NWUA 1JNTA 2QF8A 3IK8A 1A7XA 3KADA 3L4HA 2DT3A 4ODMA 2N87A 4WKHA 2PPOA 3M7NA 2XPAA 4S3KA 2ESCA 3RMEA 3WH0A 2F2DA 3FS8A 3GTYX 3PRDA 4WJXA 2LAJA 2LPVA 1UR8A 4J4NA 3I6CA 2PN0A 4MPKA 5HT1A 4JFMA 4DH0A 3ARTA 4W9PA 1FKLA 2ZQVA 2EULA 4HBEA 3O5RA 4C02B 2WLZA 2YSGA 3O5EA 2KFWA 3ARXA 4QZVB 5BXJA 3B9EA 3TDBA 1J4HA 2P4VA 3UQAA 1D7JA 4ML4A 3UI4A 4P8VA 3H9RB 4A0TA 5E66A 1WAWA 1PINA 1E9LA 5HW8A 2RQSA 4HARA 4O2TA 1TCOC 2YBTA 1FJDA 2DT2A 1ZBWA 1PBKA 2PPPA 1JNSA 1LQ0A 4Q22A 4FN2A 1D6OA 2PPNA 4DRNA 2F4EA 2JMFA 5JH8A 1W1PA 4JFLA 3AS2A 2K8IA 1TK7A 1XRVA 4LAYA 2KE0A 5J6EA 3FAPA 4JFJA 3MQHA 1HJWA 1IX5A 1R9HA 1BKFA 1WMVA 2A3BA 4G2PA 4ODLA 1WB0A 1K9QA 3ARRA 1VF8A 1FKTA 1EG4A 4E5RA 4GLXA 3GU0A 1D7IA 1D7HA 3IHZA 2YSHA 3ARQA 3AS1A 2KR7A 1GUVA 1E6RA 3KAFA 3JYMA 3LKXB 1QPFA 1C9HA 4W5UA 1E6NA 4REXA 1ZB5A 4KQZA 4LAVA 1J4RA 1HKJA 1ZBKA 4URIA 4ODNA 1FLCA 4GGQA 4R5EA 2AOSA 3CHCA 1FKFA 3OOBA 1FKGA 1U79A 2F23A 2FAPA 3UQBA 3KZ7A 1EG3A 1X6LA 1K9TA 5DIVA 4MTVA 1LL6A 3AQUA 4ITZA 4KR0B 3CNGA 4Z2KA 4DWSA 4QT2A 4Z2GA 3WQWA 4MAVA 2ZR6A 4Z2JA 2XPBA 2XP8A 3ARWA 2O9OA 4R0XA 4N19A 4W9QA 3TCZA 3MDYB 3O5JA 2DT1A 4MGVA 1JCHB 4TNSA 3AS3A 3O5PA 1Q6UA 1FKJA 1FKKA 3AROA 3O5OA 3CGMA 2PBCA 3UF8A 2VN1A 1FKSA 1EHNA 4JFKA 1FFQA 2DT0A 3LUOA 1O6WA 2MNTA 1SR0A 4G50A 1LJYA 3UQIA 3KAIA 2WADA 3WQVA 5HW6A 1JNDA 2XP7A 2M3OW 1NWTA 2IUZA 3PQHA 3MQGA 1B6CA 2PV3A 4IT4A 3PA7A 2M1IA 2KI3A 1JNEA 4GIVA 2LGOA 4IQ2A 1EQ3A 1GRJA 1ZK6A 3KACA 3O5MA 1NH6A 4DRMA 4S3JA 1FKDA 3ARSA 3OA5A 4NSBA 4L3NA 4DZ3A 2OWOA 1Y0OA 2ZQSA 3ALFA 2B31A 4DWSC 3WL0A 2MLYA 2YSBA 1E15A 5HW7A 3RM4A 1ZBVA 5U47A 2PV2A 3IKGA 4WIWA 2RUDA 1W9PA 3WD4A 4DRKA 4MNLA 3PRAA 3O5FA 2PV1A 5HKGA 1FKRA 1F40A 4Z2HA 2JX8A 2KGJA 3M85A 4P8UA 1JVWA 3CHEA 3MCBB 5HWBA 2XP3A 1M5YA 1EDQA 1KFWA 1ROUA 2JZVA 4IPXA 1ITXA 4WK9A 4L72B 4ZPVR 4U84A 4ODKA 1W1VA 3IKDA 1OGGA 2OLHA 1Q6HA 4U85A 4Z2IA 1EYMA 2PI6A 5GPRA 2DSUA 1ROTA 5GQBA 1KT1A 2DJYA 4NNRA 3FSCA 3B7XA 1ZBCA 3KCEA 4TW6A 2KO7A 1JMQA 1ZCNA 1LG1A 1FKHA 2O92A 2DG3A 3CH9A 2M08A 4AY1A 2M2AA 1P5QA 5AHTA 3WKZA 4TYOA 4ODPA 4MSPA 3FY1A 4MNKA 1HKKA 5HWCA 3W4RA 5HUAA 5GPGA 2MDIA 2UZ5A 1NMVA 2XP6A 1NMWA 4DRIA 3WIJA 2RUQA 2G8ZA 1J4IA 3ODKA 2ZAJA 5DF0A 3KAGA 1OGBA 4UDMA 5DO2A 2B5UB 1LL7A 3G6LA 1TFVA 2AWGA 4P8WA 4WKAA 1J6YA 2RURA 2MPHA 4LAXA 3NI6A 4QT3A 2WK2A 3ALGA 4PTMA 2G41A
chains in the Genus database with same CATH topology
3KAHA 1N1AA 1LL4A 4HBOA 3O5KA 4ODQA 1RP5A 4LAWA 1H0GA 4DIPA 4QIBA 1HKMA 2F21A 3QOKA 3MCBA 3AS0A 1E6ZA 5DEZA 4DWSD 3B8SA 3O5LA 4TW8A 2MF9A 1W9UA 3EY6A 1I5HW 4U86A 1X6NA 4ZS6A 1Q6IA 2A3CA 1YATA 1EIBA 1UR9A 1O6IA 1K9RA 1FAPA 3PRBA 1FKIA 5E5WA 4Z2LA 1RD6A 3RGCA 1YW5A 3LKXA 2DPEA 2OFNA 3UI5A 3WD2A 2ZQTA 2A3AA 1SYTA 5E62A 5DIUA 4IT6A 3O5DA 3CHDA 4DRQA 2YAJB 4NZCA 1LG2A 1QPLA 2XP9A 3G6MA 4XAKA 4DRPA 3CGNA 1OWQA 4MNMA 3JXVA 2WAEA 2VCDA 4W9OA 2EZ5W 2YSIA 4ZPWR 3JYJA 4BF8A 2RUCA 5D75A 4TW7A 3BXWA 1HKIA 2XP5A 2DG9A 2A3EA 2DG4A 4J4OA 3RM9A 1NSGA 1W26A 1ZL1A 4DWSB 1WNOA 3NRKA 1NWRA 2DSVA 2ZQUA 5E64A 2WLYA 3GPKA 2WM0A 2DSZA 2KXQA 2E45A 1GPFA 4DRJA 2RE3A 2Y8NB 3NTPA 3B9AA 2FKEA 2ZR5A 3PR9A 2YBUA 3WD3A 4DZ2A 2ZR4A 1HJXA 4DT4A 1Q1CA 3FSBA 3FXYA 4A0UA 4Q7NA 3WD1A 2JV4A 3CHFA 1W1TA 5I98A 2M8JA 1ZU8A 3ARPA 1HJVA 1HXVA 3WD0A 4JYSA 2YSFA 2DK1A 3KABA 2M8IA 3ARZA 4FAPA 2DMVA 4DRHA 5HBFA 1E6PA 1CTNA 4ODRA 2DSWA 1NWSA 1W9VA 2MLXA 5HTGA 2JXWA 2L2SA 1FD9A 3VAWA 5DITA 3RM8A 4IQCA 2QRVA 1H0IA 4TX0A 4MNJA 4ZPTR 5E65A 4LGXA 3O5GA 2L4JA 2D9FA 3UI6A 1WR7A 2DK7A 2Q5AA 2DWVA 1XHGA 1BL4A 1TR8A 1KT0A 4DROA 2LKNA 1D2KA 4JFIA 3TC5A 3O5QA 3CZ8A 1FFRA 3ARYA 3ARUA 2MLZA 2ITKA 3LE4A 5CQ2A 4ODOA 4WKFA 1L1PA 1T11A 1F8AB 2XP4A 3B9DA 2LJ4A 1W1YA 1QZ2A 4P8XA 2BA1A 1FKBA 2RSEA 3RFWA 3WL1A 1GOIA 2FDMA 2Y78A 2IF4A 3O5IA 3ARVA 5B8IC 1NWUA 1JNTA 2QF8A 3IK8A 1A7XA 3KADA 3L4HA 2DT3A 4ODMA 2N87A 4WKHA 2PPOA 3M7NA 2XPAA 4S3KA 2ESCA 3RMEA 3WH0A 2F2DA 3FS8A 3PRDA 4WJXA 2LAJA 2LPVA 1UR8A 4J4NA 3I6CA 5HT1A 4MPKA 4JFMA 4DH0A 3ARTA 4W9PA 1FKLA 2ZQVA 4HBEA 3O5RA 4C02B 2WLZA 2YSGA 3O5EA 2KFWA 3ARXA 4QZVB 5BXJA 3B9EA 3TDBA 1J4HA 3UQAA 1D7JA 4ML4A 3UI4A 4P8VA 3H9RB 4A0TA 5E66A 1WAWA 1PINA 1E9LA 5HW8A 2RQSA 4HARA 4O2TA 1TCOC 2YBTA 1FJDA 2DT2A 1ZBWA 1PBKA 2PPPA 1JNSA 1LQ0A 4Q22A 4FN2A 1D6OA 2PPNA 4DRNA 2F4EA 2JMFA 5JH8A 1W1PA 4JFLA 3AS2A 2K8IA 1TK7A 1XRVA 4LAYA 2KE0A 5J6EA 3FAPA 4JFJA 3MQHA 1HJWA 1IX5A 1R9HA 1BKFA 1WMVA 2A3BA 4G2PA 4ODLA 1WB0A 1K9QA 3ARRA 1VF8A 1FKTA 1EG4A 4E5RA 4GLXA 1D7IA 1D7HA 3IHZA 2YSHA 3ARQA 3AS1A 2KR7A 1GUVA 1E6RA 3KAFA 3JYMA 3LKXB 1QPFA 1C9HA 4W5UA 1E6NA 4REXA 1ZB5A 4KQZA 4LAVA 1J4RA 1HKJA 1ZBKA 4URIA 4ODNA 1FLCA 4GGQA 4R5EA 2AOSA 3CHCA 1FKFA 3OOBA 1FKGA 1U79A 2FAPA 3UQBA 3KZ7A 1EG3A 1X6LA 1K9TA 5DIVA 4MTVA 1LL6A 3AQUA 4ITZA 4KR0B 3CNGA 4Z2KA 4DWSA 4QT2A 4Z2GA 3WQWA 4MAVA 2ZR6A 4Z2JA 2XPBA 2XP8A 3ARWA 2O9OA 4R0XA 4N19A 4W9QA 3TCZA 3MDYB 3O5JA 2DT1A 4MGVA 4TNSA 3AS3A 3O5PA 1Q6UA 1FKJA 1FKKA 3AROA 3O5OA 3CGMA 2PBCA 3UF8A 2VN1A 1FKSA 1EHNA 4JFKA 1FFQA 2DT0A 3LUOA 1O6WA 2MNTA 1SR0A 4G50A 1LJYA 3UQIA 3KAIA 2WADA 3WQVA 5HW6A 1JNDA 2XP7A 2M3OW 1NWTA 2IUZA 3PQHA 3MQGA 1B6CA 2PV3A 4IT4A 3PA7A 2M1IA 2KI3A 1JNEA 4GIVA 2LGOA 4IQ2A 1EQ3A 1ZK6A 3KACA 3O5MA 1NH6A 4DRMA 4S3JA 1FKDA 3ARSA 3OA5A 4NSBA 4L3NA 4DZ3A 2OWOA 1Y0OA 2ZQSA 3ALFA 2B31A 4DWSC 3WL0A 2MLYA 2YSBA 1E15A 5HW7A 3RM4A 1ZBVA 5U47A 2PV2A 3IKGA 4WIWA 2RUDA 1W9PA 3WD4A 4DRKA 4MNLA 3PRAA 3O5FA 2PV1A 5HKGA 1FKRA 1F40A 4Z2HA 2JX8A 2KGJA 3M85A 4P8UA 1JVWA 3CHEA 3MCBB 5HWBA 2XP3A 1M5YA 1EDQA 1KFWA 1ROUA 2JZVA 4IPXA 1ITXA 4WK9A 4L72B 4ZPVR 4U84A 4ODKA 1W1VA 3IKDA 1OGGA 2OLHA 1Q6HA 4U85A 4Z2IA 1EYMA 2PI6A 5GPRA 2DSUA 1ROTA 5GQBA 1KT1A 2DJYA 4NNRA 3FSCA 3B7XA 1ZBCA 3KCEA 4TW6A 2KO7A 1JMQA 1ZCNA 1LG1A 1FKHA 2O92A 2DG3A 3CH9A 2M08A 4AY1A 2M2AA 1P5QA 5AHTA 3WKZA 4TYOA 4ODPA 4MSPA 3FY1A 4MNKA 1HKKA 5HWCA 3W4RA 5HUAA 5GPGA 2MDIA 2UZ5A 1NMVA 2XP6A 1NMWA 4DRIA 3WIJA 2RUQA 2G8ZA 1J4IA 3ODKA 2ZAJA 5DF0A 3KAGA 1OGBA 5DO2A 1LL7A 3G6LA 1TFVA 2AWGA 4P8WA 4WKAA 1J6YA 2RURA 2MPHA 4LAXA 3NI6A 4QT3A 2WK2A 3ALGA 4PTMA 2G41A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3KAH A;  1N1A A;  3O5K A;  4ODQ A;  4LAW A;  4DIP A;  4QIB A;  2F21 A;  3O5L A;  4TW8 A;  2MF9 A;  3EY6 A;  1I5H W;  4U86 A;  1Q6I A;  1YAT A;  1K9R A;  1FAP A;  3PRB A;  1FKI A;  3RGC A;  1YW5 A;  2OFN A;  3UI5 A;  2ZQT A;  5DIU A;  3O5D A;  4DRQ A;  1QPL A;  2XP9 A;  4DRP A;  3CGN A;  3JXV A;  4W9O A;  2VCD A;  2EZ5 W;  2YSI A;  3JYJ A;  4BF8 A;  2RUC A;  5D75 A;  4TW7 A;  2XP5 A;  2DG9 A;  2DG4 A;  4J4O A;  1NSG A;  1W26 A;  3NRK A;  2ZQU A;  3GPK A;  2KXQ A;  2E45 A;  4DRJ A;  2RE3 A;  3NTP A;  2FKE A;  2ZR5 A;  4DZ2 A;  2ZR4 A;  4DT4 A;  1Q1C A;  2JV4 A;  5I98 A;  2M8J A;  1HXV A;  4JYS A;  2YSF A;  2DK1 A;  3KAB A;  2M8I A;  4FAP A;  2DMV A;  4DRH A;  4ODR A;  2MLX A;  5HTG A;  2JXW A;  2L2S A;  1FD9 A;  3VAW A;  5DIT A;  4IQC A;  4TX0 A;  3O5G A;  2L4J A;  2D9F A;  3UI6 A;  1WR7 A;  2DK7 A;  2Q5A A;  2DWV A;  1BL4 A;  1KT0 A;  4DRO A;  2LKN A;  4JFI A;  3TC5 A;  3O5Q A;  2MLZ A;  2ITK A;  3LE4 A;  5CQ2 A;  4ODO A;  1L1P A;  1T11 A;  1F8A B;  2XP4 A;  2LJ4 A;  1QZ2 A;  2BA1 A;  1FKB A;  2RSE A;  3RFW A;  2Y78 A;  2IF4 A;  3O5I A;  5B8I C;  1JNT A;  3IK8 A;  1A7X A;  3KAD A;  3L4H A;  4ODM A;  2N87 A;  2PPO A;  3M7N A;  2XPA A;  3WH0 A;  2F2D A;  3PRD A;  2LAJ A;  2LPV A;  4J4N A;  5HT1 A;  3I6C A;  4JFM A;  4DH0 A;  4W9P A;  1FKL A;  2ZQV A;  3O5R A;  4C02 B;  2YSG A;  3O5E A;  2KFW A;  5BXJ A;  3TDB A;  1J4H A;  3UQA A;  1D7J A;  3UI4 A;  3H9R B;  1PIN A;  5HW8 A;  2RQS A;  4O2T A;  1TCO C;  1FJD A;  2PPP A;  1PBK A;  1JNS A;  4FN2 A;  1D6O A;  2PPN A;  4DRN A;  2F4E A;  2JMF A;  4JFL A;  2K8I A;  1TK7 A;  4LAY A;  5J6E A;  2KE0 A;  3FAP A;  4JFJ A;  1R9H A;  1BKF A;  1WMV A;  4G2P A;  4ODL A;  1K9Q A;  1FKT A;  1EG4 A;  4E5R A;  1D7I A;  1D7H A;  3IHZ A;  2YSH A;  2KR7 A;  3JYM A;  3KAF A;  1QPF A;  1C9H A;  4REX A;  4LAV A;  1J4R A;  4ODN A;  4GGQ A;  1FKF A;  3OOB A;  1FKG A;  1U79 A;  2FAP A;  3UQB A;  3KZ7 A;  1EG3 A;  5DIV A;  4ITZ A;  3CNG A;  4QT2 A;  2ZR6 A;  2XPB A;  2XP8 A;  4R0X A;  4N19 A;  4W9Q A;  3TCZ A;  3MDY B;  3O5J A;  4MGV A;  4TNS A;  3O5P A;  1Q6U A;  1FKJ A;  1FKK A;  3O5O A;  3CGM A;  2PBC A;  3UF8 A;  2VN1 A;  1FKS A;  4JFK A;  3LUO A;  1O6W A;  2MNT A;  4G50 A;  3UQI A;  3KAI A;  5HW6 A;  2XP7 A;  2M3O W;  1B6C A;  2PV3 A;  3PA7 A;  2M1I A;  2KI3 A;  4GIV A;  2LGO A;  4IQ2 A;  1EQ3 A;  1ZK6 A;  3KAC A;  3O5M A;  4DRM A;  1FKD A;  4DZ3 A;  1Y0O A;  2ZQS A;  2MLY A;  2YSB A;  5HW7 A;  2PV2 A;  3IKG A;  2RUD A;  4DRK A;  3O5F A;  2PV1 A;  5HKG A;  1FKR A;  1F40 A;  2JX8 A;  2KGJ A;  3M85 A;  1JVW A;  5HWB A;  2XP3 A;  1M5Y A;  1ROU A;  2JZV A;  4IPX A;  4U84 A;  4ODK A;  3IKD A;  1Q6H A;  4U85 A;  1EYM A;  1ROT A;  1KT1 A;  2DJY A;  4NNR A;  3B7X A;  3KCE A;  4TW6 A;  2KO7 A;  1JMQ A;  1ZCN A;  1FKH A;  2DG3 A;  2M08 A;  2M2A A;  1P5Q A;  5AHT A;  4TYO A;  4ODP A;  4MSP A;  5HWC A;  5HUA A;  5GPG A;  2MDI A;  2UZ5 A;  1NMV A;  2XP6 A;  1NMW A;  4DRI A;  2RUQ A;  1J4I A;  3ODK A;  2ZAJ A;  3KAG A;  1J6Y A;  2AWG A;  2RUR A;  2MPH A;  4LAX A;  3NI6 A;  4QT3 A; 
#chains in the Genus database with same CATH topology
 3KAH A;  1N1A A;  1LL4 A;  4HBO A;  3O5K A;  4ODQ A;  1RP5 A;  4LAW A;  1H0G A;  3BMB A;  4DIP A;  4QIB A;  1HKM A;  2F21 A;  3QOK A;  3MCB A;  3AS0 A;  1E6Z A;  5DEZ A;  4DWS D;  3B8S A;  3O5L A;  4TW8 A;  2MF9 A;  1W9U A;  3EY6 A;  1I5H W;  4U86 A;  1X6N A;  4ZS6 A;  1Q6I A;  2A3C A;  1YAT A;  1EIB A;  1UR9 A;  1O6I A;  1K9R A;  1FAP A;  3PRB A;  1FKI A;  5E5W A;  4Z2L A;  1RD6 A;  3RGC A;  1YW5 A;  3LKX A;  2DPE A;  2OFN A;  3UI5 A;  3WD2 A;  2ZQT A;  2A3A A;  1SYT A;  5E62 A;  5DIU A;  4IT6 A;  3O5D A;  3CHD A;  4DRQ A;  2YAJ B;  4NZC A;  1LG2 A;  1QPL A;  2XP9 A;  3G6M A;  4XAK A;  4DRP A;  3CGN A;  1OWQ A;  4MNM A;  3JXV A;  2WAE A;  2VCD A;  4W9O A;  2EZ5 W;  2YSI A;  4ZPW R;  3JYJ A;  4BF8 A;  2RUC A;  5D75 A;  4TW7 A;  3BXW A;  1HKI A;  2XP5 A;  2DG9 A;  2A3E A;  2DG4 A;  4J4O A;  3RM9 A;  1NSG A;  1W26 A;  1ZL1 A;  4DWS B;  1WNO A;  3NRK A;  1NWR A;  2DSV A;  2ZQU A;  5E64 A;  2WLY A;  3GPK A;  2WM0 A;  2DSZ A;  2KXQ A;  2E45 A;  1GPF A;  4DRJ A;  2RE3 A;  2Y8N B;  3NTP A;  3B9A A;  2FKE A;  2ZR5 A;  3PR9 A;  2YBU A;  3WD3 A;  4DZ2 A;  2ZR4 A;  1HJX A;  2ETN A;  4DT4 A;  1Q1C A;  3FSB A;  3FXY A;  4A0U A;  4Q7N A;  3WD1 A;  2JV4 A;  3CHF A;  3EIP A;  1W1T A;  5I98 A;  2M8J A;  1ZU8 A;  3ARP A;  1HJV A;  1HXV A;  3WD0 A;  4JYS A;  2YSF A;  2DK1 A;  3KAB A;  2M8I A;  3ARZ A;  4FAP A;  2DMV A;  4DRH A;  5HBF A;  1E6P A;  1CTN A;  4ODR A;  2DSW A;  1NWS A;  1W9V A;  2MLX A;  5HTG A;  2JXW A;  2L2S A;  1FD9 A;  3VAW A;  5DIT A;  3RM8 A;  4IQC A;  2QRV A;  1H0I A;  4TX0 A;  4MNJ A;  4ZPT R;  5E65 A;  4LGX A;  3O5G A;  2L4J A;  2D9F A;  3UI6 A;  1WR7 A;  2DK7 A;  2Q5A A;  2DWV A;  1XHG A;  1BL4 A;  1TR8 A;  1KT0 A;  4DRO A;  2LKN A;  1D2K A;  4JFI A;  3TC5 A;  3O5Q A;  3CZ8 A;  1FFR A;  3ARY A;  3ARU A;  1E44 A;  2MLZ A;  2ITK A;  3LE4 A;  5CQ2 A;  4ODO A;  4WKF A;  1L1P A;  1T11 A;  1F8A B;  2XP4 A;  3B9D A;  2LJ4 A;  1W1Y A;  1QZ2 A;  4P8X A;  2BA1 A;  1FKB A;  2RSE A;  3RFW A;  3WL1 A;  1GOI A;  2FDM A;  2Y78 A;  2IF4 A;  3O5I A;  3ARV A;  5B8I C;  1NWU A;  1JNT A;  2QF8 A;  3IK8 A;  1A7X A;  3KAD A;  3L4H A;  2DT3 A;  4ODM A;  2N87 A;  4WKH A;  2PPO A;  3M7N A;  2XPA A;  4S3K A;  2ESC A;  3RME A;  3WH0 A;  2F2D A;  3FS8 A;  3GTY X;  3PRD A;  4WJX A;  2LAJ A;  2LPV A;  1UR8 A;  4J4N A;  3I6C A;  2PN0 A;  4MPK A;  5HT1 A;  4JFM A;  4DH0 A;  3ART A;  4W9P A;  1FKL A;  2ZQV A;  2EUL A;  4HBE A;  3O5R A;  4C02 B;  2WLZ A;  2YSG A;  3O5E A;  2KFW A;  3ARX A;  4QZV B;  5BXJ A;  3B9E A;  3TDB A;  1J4H A;  2P4V A;  3UQA A;  1D7J A;  4ML4 A;  3UI4 A;  4P8V A;  3H9R B;  4A0T A;  5E66 A;  1WAW A;  1PIN A;  1E9L A;  5HW8 A;  2RQS A;  4HAR A;  4O2T A;  1TCO C;  2YBT A;  1FJD A;  2DT2 A;  1ZBW A;  1PBK A;  2PPP A;  1JNS A;  1LQ0 A;  4Q22 A;  4FN2 A;  1D6O A;  2PPN A;  4DRN A;  2F4E A;  2JMF A;  5JH8 A;  1W1P A;  4JFL A;  3AS2 A;  2K8I A;  1TK7 A;  1XRV A;  4LAY A;  2KE0 A;  5J6E A;  3FAP A;  4JFJ A;  3MQH A;  1HJW A;  1IX5 A;  1R9H A;  1BKF A;  1WMV A;  2A3B A;  4G2P A;  4ODL A;  1WB0 A;  1K9Q A;  3ARR A;  1VF8 A;  1FKT A;  1EG4 A;  4E5R A;  4GLX A;  3GU0 A;  1D7I A;  1D7H A;  3IHZ A;  2YSH A;  3ARQ A;  3AS1 A;  2KR7 A;  1GUV A;  1E6R A;  3KAF A;  3JYM A;  3LKX B;  1QPF A;  1C9H A;  4W5U A;  1E6N A;  4REX A;  1ZB5 A;  4KQZ A;  4LAV A;  1J4R A;  1HKJ A;  1ZBK A;  4URI A;  4ODN A;  1FLC A;  4GGQ A;  4R5E A;  2AOS A;  3CHC A;  1FKF A;  3OOB A;  1FKG A;  1U79 A;  2F23 A;  2FAP A;  3UQB A;  3KZ7 A;  1EG3 A;  1X6L A;  1K9T A;  5DIV A;  4MTV A;  1LL6 A;  3AQU A;  4ITZ A;  4KR0 B;  3CNG A;  4Z2K A;  4DWS A;  4QT2 A;  4Z2G A;  3WQW A;  4MAV A;  2ZR6 A;  4Z2J A;  2XPB A;  2XP8 A;  3ARW A;  2O9O A;  4R0X A;  4N19 A;  4W9Q A;  3TCZ A;  3MDY B;  3O5J A;  2DT1 A;  4MGV A;  1JCH B;  4TNS A;  3AS3 A;  3O5P A;  1Q6U A;  1FKJ A;  1FKK A;  3ARO A;  3O5O A;  3CGM A;  2PBC A;  3UF8 A;  2VN1 A;  1FKS A;  1EHN A;  4JFK A;  1FFQ A;  2DT0 A;  3LUO A;  1O6W A;  2MNT A;  1SR0 A;  4G50 A;  1LJY A;  3UQI A;  3KAI A;  2WAD A;  3WQV A;  5HW6 A;  1JND A;  2XP7 A;  2M3O W;  1NWT A;  2IUZ A;  3PQH A;  3MQG A;  1B6C A;  2PV3 A;  4IT4 A;  3PA7 A;  2M1I A;  2KI3 A;  1JNE A;  4GIV A;  2LGO A;  4IQ2 A;  1EQ3 A;  1GRJ A;  1ZK6 A;  3KAC A;  3O5M A;  1NH6 A;  4DRM A;  4S3J A;  1FKD A;  3ARS A;  3OA5 A;  4NSB A;  4L3N A;  4DZ3 A;  2OWO A;  1Y0O A;  2ZQS A;  3ALF A;  2B31 A;  4DWS C;  3WL0 A;  2MLY A;  2YSB A;  1E15 A;  5HW7 A;  3RM4 A;  1ZBV A;  5U47 A;  2PV2 A;  3IKG A;  4WIW A;  2RUD A;  1W9P A;  3WD4 A;  4DRK A;  4MNL A;  3PRA A;  3O5F A;  2PV1 A;  5HKG A;  1FKR A;  1F40 A;  4Z2H A;  2JX8 A;  2KGJ A;  3M85 A;  4P8U A;  1JVW A;  3CHE A;  3MCB B;  5HWB A;  2XP3 A;  1M5Y A;  1EDQ A;  1KFW A;  1ROU A;  2JZV A;  4IPX A;  1ITX A;  4WK9 A;  4L72 B;  4ZPV R;  4U84 A;  4ODK A;  1W1V A;  3IKD A;  1OGG A;  2OLH A;  1Q6H A;  4U85 A;  4Z2I A;  1EYM A;  2PI6 A;  5GPR A;  2DSU A;  1ROT A;  5GQB A;  1KT1 A;  2DJY A;  4NNR A;  3FSC A;  3B7X A;  1ZBC A;  3KCE A;  4TW6 A;  2KO7 A;  1JMQ A;  1ZCN A;  1LG1 A;  1FKH A;  2O92 A;  2DG3 A;  3CH9 A;  2M08 A;  4AY1 A;  2M2A A;  1P5Q A;  5AHT A;  3WKZ A;  4TYO A;  4ODP A;  4MSP A;  3FY1 A;  4MNK A;  1HKK A;  5HWC A;  3W4R A;  5HUA A;  5GPG A;  2MDI A;  2UZ5 A;  1NMV A;  2XP6 A;  1NMW A;  4DRI A;  3WIJ A;  2RUQ A;  2G8Z A;  1J4I A;  3ODK A;  2ZAJ A;  5DF0 A;  3KAG A;  1OGB A;  4UDM A;  5DO2 A;  2B5U B;  1LL7 A;  3G6L A;  1TFV A;  2AWG A;  4P8W A;  4WKA A;  1J6Y A;  2RUR A;  2MPH A;  4LAX A;  3NI6 A;  4QT3 A;  2WK2 A;  3ALG A;  4PTM A;  2G41 A; 
#chains in the Genus database with same CATH homology
 3KAH A;  1N1A A;  1LL4 A;  4HBO A;  3O5K A;  4ODQ A;  1RP5 A;  4LAW A;  1H0G A;  4DIP A;  4QIB A;  1HKM A;  2F21 A;  3QOK A;  3MCB A;  3AS0 A;  1E6Z A;  5DEZ A;  4DWS D;  3B8S A;  3O5L A;  4TW8 A;  2MF9 A;  1W9U A;  3EY6 A;  1I5H W;  4U86 A;  1X6N A;  4ZS6 A;  1Q6I A;  2A3C A;  1YAT A;  1EIB A;  1UR9 A;  1O6I A;  1K9R A;  1FAP A;  3PRB A;  1FKI A;  5E5W A;  4Z2L A;  1RD6 A;  3RGC A;  1YW5 A;  3LKX A;  2DPE A;  2OFN A;  3UI5 A;  3WD2 A;  2ZQT A;  2A3A A;  1SYT A;  5E62 A;  5DIU A;  4IT6 A;  3O5D A;  3CHD A;  4DRQ A;  2YAJ B;  4NZC A;  1LG2 A;  1QPL A;  2XP9 A;  3G6M A;  4XAK A;  4DRP A;  3CGN A;  1OWQ A;  4MNM A;  3JXV A;  2WAE A;  2VCD A;  4W9O A;  2EZ5 W;  2YSI A;  4ZPW R;  3JYJ A;  4BF8 A;  2RUC A;  5D75 A;  4TW7 A;  3BXW A;  1HKI A;  2XP5 A;  2DG9 A;  2A3E A;  2DG4 A;  4J4O A;  3RM9 A;  1NSG A;  1W26 A;  1ZL1 A;  4DWS B;  1WNO A;  3NRK A;  1NWR A;  2DSV A;  2ZQU A;  5E64 A;  2WLY A;  3GPK A;  2WM0 A;  2DSZ A;  2KXQ A;  2E45 A;  1GPF A;  4DRJ A;  2RE3 A;  2Y8N B;  3NTP A;  3B9A A;  2FKE A;  2ZR5 A;  3PR9 A;  2YBU A;  3WD3 A;  4DZ2 A;  2ZR4 A;  1HJX A;  4DT4 A;  1Q1C A;  3FSB A;  3FXY A;  4A0U A;  4Q7N A;  3WD1 A;  2JV4 A;  3CHF A;  1W1T A;  5I98 A;  2M8J A;  1ZU8 A;  3ARP A;  1HJV A;  1HXV A;  3WD0 A;  4JYS A;  2YSF A;  2DK1 A;  3KAB A;  2M8I A;  3ARZ A;  4FAP A;  2DMV A;  4DRH A;  5HBF A;  1E6P A;  1CTN A;  4ODR A;  2DSW A;  1NWS A;  1W9V A;  2MLX A;  5HTG A;  2JXW A;  2L2S A;  1FD9 A;  3VAW A;  5DIT A;  3RM8 A;  4IQC A;  2QRV A;  1H0I A;  4TX0 A;  4MNJ A;  4ZPT R;  5E65 A;  4LGX A;  3O5G A;  2L4J A;  2D9F A;  3UI6 A;  1WR7 A;  2DK7 A;  2Q5A A;  2DWV A;  1XHG A;  1BL4 A;  1TR8 A;  1KT0 A;  4DRO A;  2LKN A;  1D2K A;  4JFI A;  3TC5 A;  3O5Q A;  3CZ8 A;  1FFR A;  3ARY A;  3ARU A;  2MLZ A;  2ITK A;  3LE4 A;  5CQ2 A;  4ODO A;  4WKF A;  1L1P A;  1T11 A;  1F8A B;  2XP4 A;  3B9D A;  2LJ4 A;  1W1Y A;  1QZ2 A;  4P8X A;  2BA1 A;  1FKB A;  2RSE A;  3RFW A;  3WL1 A;  1GOI A;  2FDM A;  2Y78 A;  2IF4 A;  3O5I A;  3ARV A;  5B8I C;  1NWU A;  1JNT A;  2QF8 A;  3IK8 A;  1A7X A;  3KAD A;  3L4H A;  2DT3 A;  4ODM A;  2N87 A;  4WKH A;  2PPO A;  3M7N A;  2XPA A;  4S3K A;  2ESC A;  3RME A;  3WH0 A;  2F2D A;  3FS8 A;  3PRD A;  4WJX A;  2LAJ A;  2LPV A;  1UR8 A;  4J4N A;  3I6C A;  5HT1 A;  4MPK A;  4JFM A;  4DH0 A;  3ART A;  4W9P A;  1FKL A;  2ZQV A;  4HBE A;  3O5R A;  4C02 B;  2WLZ A;  2YSG A;  3O5E A;  2KFW A;  3ARX A;  4QZV B;  5BXJ A;  3B9E A;  3TDB A;  1J4H A;  3UQA A;  1D7J A;  4ML4 A;  3UI4 A;  4P8V A;  3H9R B;  4A0T A;  5E66 A;  1WAW A;  1PIN A;  1E9L A;  5HW8 A;  2RQS A;  4HAR A;  4O2T A;  1TCO C;  2YBT A;  1FJD A;  2DT2 A;  1ZBW A;  1PBK A;  2PPP A;  1JNS A;  1LQ0 A;  4Q22 A;  4FN2 A;  1D6O A;  2PPN A;  4DRN A;  2F4E A;  2JMF A;  5JH8 A;  1W1P A;  4JFL A;  3AS2 A;  2K8I A;  1TK7 A;  1XRV A;  4LAY A;  2KE0 A;  5J6E A;  3FAP A;  4JFJ A;  3MQH A;  1HJW A;  1IX5 A;  1R9H A;  1BKF A;  1WMV A;  2A3B A;  4G2P A;  4ODL A;  1WB0 A;  1K9Q A;  3ARR A;  1VF8 A;  1FKT A;  1EG4 A;  4E5R A;  4GLX A;  1D7I A;  1D7H A;  3IHZ A;  2YSH A;  3ARQ A;  3AS1 A;  2KR7 A;  1GUV A;  1E6R A;  3KAF A;  3JYM A;  3LKX B;  1QPF A;  1C9H A;  4W5U A;  1E6N A;  4REX A;  1ZB5 A;  4KQZ A;  4LAV A;  1J4R A;  1HKJ A;  1ZBK A;  4URI A;  4ODN A;  1FLC A;  4GGQ A;  4R5E A;  2AOS A;  3CHC A;  1FKF A;  3OOB A;  1FKG A;  1U79 A;  2FAP A;  3UQB A;  3KZ7 A;  1EG3 A;  1X6L A;  1K9T A;  5DIV A;  4MTV A;  1LL6 A;  3AQU A;  4ITZ A;  4KR0 B;  3CNG A;  4Z2K A;  4DWS A;  4QT2 A;  4Z2G A;  3WQW A;  4MAV A;  2ZR6 A;  4Z2J A;  2XPB A;  2XP8 A;  3ARW A;  2O9O A;  4R0X A;  4N19 A;  4W9Q A;  3TCZ A;  3MDY B;  3O5J A;  2DT1 A;  4MGV A;  4TNS A;  3AS3 A;  3O5P A;  1Q6U A;  1FKJ A;  1FKK A;  3ARO A;  3O5O A;  3CGM A;  2PBC A;  3UF8 A;  2VN1 A;  1FKS A;  1EHN A;  4JFK A;  1FFQ A;  2DT0 A;  3LUO A;  1O6W A;  2MNT A;  1SR0 A;  4G50 A;  1LJY A;  3UQI A;  3KAI A;  2WAD A;  3WQV A;  5HW6 A;  1JND A;  2XP7 A;  2M3O W;  1NWT A;  2IUZ A;  3PQH A;  3MQG A;  1B6C A;  2PV3 A;  4IT4 A;  3PA7 A;  2M1I A;  2KI3 A;  1JNE A;  4GIV A;  2LGO A;  4IQ2 A;  1EQ3 A;  1ZK6 A;  3KAC A;  3O5M A;  1NH6 A;  4DRM A;  4S3J A;  1FKD A;  3ARS A;  3OA5 A;  4NSB A;  4L3N A;  4DZ3 A;  2OWO A;  1Y0O A;  2ZQS A;  3ALF A;  2B31 A;  4DWS C;  3WL0 A;  2MLY A;  2YSB A;  1E15 A;  5HW7 A;  3RM4 A;  1ZBV A;  5U47 A;  2PV2 A;  3IKG A;  4WIW A;  2RUD A;  1W9P A;  3WD4 A;  4DRK A;  4MNL A;  3PRA A;  3O5F A;  2PV1 A;  5HKG A;  1FKR A;  1F40 A;  4Z2H A;  2JX8 A;  2KGJ A;  3M85 A;  4P8U A;  1JVW A;  3CHE A;  3MCB B;  5HWB A;  2XP3 A;  1M5Y A;  1EDQ A;  1KFW A;  1ROU A;  2JZV A;  4IPX A;  1ITX A;  4WK9 A;  4L72 B;  4ZPV R;  4U84 A;  4ODK A;  1W1V A;  3IKD A;  1OGG A;  2OLH A;  1Q6H A;  4U85 A;  4Z2I A;  1EYM A;  2PI6 A;  5GPR A;  2DSU A;  1ROT A;  5GQB A;  1KT1 A;  2DJY A;  4NNR A;  3FSC A;  3B7X A;  1ZBC A;  3KCE A;  4TW6 A;  2KO7 A;  1JMQ A;  1ZCN A;  1LG1 A;  1FKH A;  2O92 A;  2DG3 A;  3CH9 A;  2M08 A;  4AY1 A;  2M2A A;  1P5Q A;  5AHT A;  3WKZ A;  4TYO A;  4ODP A;  4MSP A;  3FY1 A;  4MNK A;  1HKK A;  5HWC A;  3W4R A;  5HUA A;  5GPG A;  2MDI A;  2UZ5 A;  1NMV A;  2XP6 A;  1NMW A;  4DRI A;  3WIJ A;  2RUQ A;  2G8Z A;  1J4I A;  3ODK A;  2ZAJ A;  5DF0 A;  3KAG A;  1OGB A;  5DO2 A;  1LL7 A;  3G6L A;  1TFV A;  2AWG A;  4P8W A;  4WKA A;  1J6Y A;  2RUR A;  2MPH A;  4LAX A;  3NI6 A;  4QT3 A;  2WK2 A;  3ALG A;  4PTM A;  2G41 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...