3OOBA

Structural and functional insights of directly targeting pin1 by epigallocatechin-3-gallate
Total Genus 49
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
49
sequence length
158
structure length
146
Chain Sequence
KLPPGWEKAMSRSSGRVYYFNHITNASQWERPSEPARVRCSHLLVKHSQSRRPSSWRQEKITRTKEEALELINGYIQKIKSGEEDFESLASQFSDCSSAKARGDLGAFSRGQMQKPFEDASFALRTGEMSGPVFTDSGIHIILRTE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Isomerase
molecule keywords Peptidyl-prolyl cis-trans isomerase NIMA-interacting 1
publication title Epigallocatechin-gallate suppresses tumorigenesis by directly targeting Pin1.
pubmed doi rcsb
source organism Homo sapiens
total genus 49
structure length 146
sequence length 158
ec nomenclature ec 5.2.1.8: Peptidylprolyl isomerase.
pdb deposition date 2010-08-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00397 WW WW domain
A PF00639 Rotamase PPIC-type PPIASE domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.20.70.10 Mainly Beta Single Sheet Ubiquitin Ligase Nedd4; Chain: W; Ubiquitin Ligase Nedd4; Chain: W; 3oobA01
3.10.50.40 Alpha Beta Roll Chitinase A; domain 3 Chitinase A; domain 3 3oobA02
3CNGA 2M8IA 4N19A 3O5OA 2LGOA 3KAFA 2PV1A 4J4OA 4DRKA 2OFNA 5HKGA 2F2DA 2KFWA 2XPBA 1KT1A 2UZ5A 1EG4A 2JV4A 2D9FA 3TDBA 1FKRA 3B7XA 4JYSA 3O5DA 2PV3A 2ZR6A 1HXVA 5HW6A 5DITA 2ITKA 2ZQSA 1K9QA 5DIVA 2RURA 3IKDA 3KABA 1YW5A 2FAPA 4FN2A 4E5RA 2F4EA 2L4JA 1NMWA 2JX8A 1FKKA 1L1PA 2BA1A 1FKDA 2AWGA 4DRQA 1PINA 4U84A 5J6EA 4DRIA 4W9OA 2DK1A 2LJ4A 1FJDA 4W9QA 1FKJA 1FAPA 4ODMA 1I5HW 1D7JA 3RFWA 4TW6A 2JXWA 5DIUA 1Y0OA 2VCDA 2XP5A 3UQBA 2ZR4A 3NRKA 1EYMA 3KAIA 4REXA 4MGVA 3JXVA 2XP3A 4JFKA 3MDYB 2RE3A 4LAYA 2FKEA 2YSIA 5HW8A 4TW8A 3O5QA 3O5MA 3EY6A 2N87A 1ZK6A 4BF8A 2DWVA 2ZQUA 1BL4A 2DMVA 3FAPA 5HWCA 2XP8A 2DK7A 4DT4A 1FD9A 1EG3A 1FKBA 2MLYA 3JYJA 4JFIA 5BXJA 2KE0A 1JNSA 4DRJA 3O5JA 1JNTA 3TC5A 1M5YA 2XP4A 1ROTA 2MLXA 3KCEA 1NMVA 2RQSA 1WMVA 2YSHA 2YSFA 1FKTA 1QPLA 2JMFA 2KO7A 3O5RA 2LAJA 2PPPA 2MPHA 1WR7A 5D75A 3M85A 4TNSA 1FKFA 3UQAA 2ZR5A 1F8AB 2Y78A 1U79A 5CQ2A 1JVWA 4ODQA 2M2AA 2L2SA 2YSBA 1R9HA 3VAWA 4ODPA 1FKIA 1Q6HA 2M08A 2ZAJA 3PRDA 2LKNA 2DG4A 1Q6UA 3O5EA 1C9HA 3NI6A 2DG3A 2M8JA 1Q1CA 3UI5A 4JFJA 2M3OW 4GGQA 4IQ2A 2JZVA 4C02B 3LE4A 1T11A 3RGCA 2RUDA 2KXQA 4J4NA 3PA7A 3H9RB 3UF8A 4DH0A 2VN1A 4IQCA 4MSPA 3OOBA 4DZ3A 4ODLA 4IPXA 4NNRA 2MDIA 2ZQVA 2ZQTA 5HT1A 3LUOA 4TX0A 1JMQA 1FKLA 3IKGA 3UQIA 3KADA 3ODKA 4TW7A 3WH0A 4DRNA 1D7IA 4LAWA 2YSGA 3CGMA 3JYMA 4DRMA 5HUAA 4LAXA 1N1AA 1FKGA 2MLZA 2DJYA 1F40A 3L4HA 2RSEA 4DRHA 1NSGA 1FKSA 1A7XA 1QZ2A 2IF4A 5HW7A 3GPKA 5GPGA 1FKHA 2RUQA 5B8IC 3O5IA 3O5LA 1EQ3A 2DG9A 4TYOA 4DIPA 2LPVA 4ODOA 2XP9A 2PBCA 1D7HA 3KAGA 5HWBA 1Q6IA 3IK8A 4ODRA 2MNTA 4U85A 1B6CA 4ODNA 1P5QA 4QT3A 3UI4A 1O6WA 1J4IA 3KZ7A 2EZ5W 3O5GA 4QT2A 1BKFA 4QIBA 2M1IA 2Q5AA 4GIVA 4G50A 4DROA 2XPAA 4DZ2A 4G2PA 5I98A 2RUCA 1KT0A 1K9RA 1QPFA 4ITZA 3UI6A 4DRPA 2MF9A 1ZCNA 1D6OA 2F21A 1TCOC 1J4RA 4FAPA 4W9PA 1J6YA 3I6CA 2KR7A 3O5PA 1YATA 3O5FA 4JFMA 2E45A 3CGNA 1W26A 2K8IA 4O2TA 3KAHA 2XP7A 5AHTA 5HTGA 4JFLA 1ROUA 1TK7A 3IHZA 2PPNA 3PRBA 2PV2A 2PPOA 3TCZA 2XP6A 1J4HA 4U86A 4R0XA 4ODKA 3O5KA 3KACA 2KI3A 2KGJA 3NTPA 1PBKA 4LAVA 3M7NA
chains in the Genus database with same CATH superfamily
4L3NA 3CNGA 1H0GA 2M8IA 4NZCA 4N19A 3PQHA 5E62A 3O5OA 2LGOA 3KAFA 2PV1A 2A3EA 4J4OA 4DRKA 1KFWA 2OFNA 5DO2A 5HKGA 1E6NA 3ALGA 2F2DA 2KFWA 1HKJA 2XPBA 3MQHA 1KT1A 2UZ5A 1EG4A 2JV4A 1CTNA 2D9FA 1NWTA 1ZU8A 3AS0A 3AQUA 1X6LA 4R5EA 3TDBA 1FKRA 3B7XA 4JYSA 2B5UB 3O5DA 2PV3A 1GUVA 2ZR6A 1HXVA 5HW6A 4DWSA 1X6NA 5DITA 4URIA 2ITKA 2ZQSA 2OLHA 3ARRA 1K9QA 5DIVA 2RURA 3IKDA 3KABA 1YW5A 3LKXA 1IX5A 1RP5A 2FAPA 4FN2A 4WJXA 4Z2JA 2Y8NB 4E5RA 2F4EA 3ARPA 1LL7A 2L4JA 1HJXA 1NMWA 2JX8A 2DSZA 1FKKA 1L1PA 2BA1A 1LL4A 1FKDA 2AWGA 4MNJA 4DRQA 1PINA 3PRAA 4U84A 5J6EA 2WM0A 4DRIA 4W9OA 2DK1A 2LJ4A 1FJDA 1ZBCA 1E9LA 4W9QA 4MNLA 1FKJA 4DWSD 2WAEA 1FAPA 2PI6A 4ODMA 1ITXA 1E44A 1I5HW 3FSCA 2DT0A 1GPFA 1D7JA 3MCBA 3RFWA 4TW6A 5DEZA 2JXWA 3ARTA 2WADA 5DIUA 1Y0OA 2VCDA 3ARSA 2XP5A 3UQBA 2ZR4A 3WD1A 4ZPVR 3NRKA 2YAJB 1EYMA 3KAIA 4REXA 1E15A 4MGVA 1LG1A 1W9UA 1E6RA 3JXVA 2XP3A 4JFKA 4LGXA 3MDYB 4MTVA 1WNOA 2RE3A 3ARVA 4LAYA 2P4VA 2FKEA 1K9TA 1EIBA 2YSIA 5HW8A 5E5WA 1JNDA 4TW8A 3O5QA 3O5MA 3ARWA 3EY6A 2B31A 2N87A 1HKKA 1ZK6A 3CZ8A 4BF8A 2DWVA 2ZQUA 1E6ZA 1RD6A 1BL4A 2DMVA 2DT3A 2YBUA 1FFQA 3FAPA 4Z2LA 5HWCA 2XP8A 2DK7A 4DT4A 2QRVA 1FD9A 4MNKA 1EG3A 1FKBA 2MLYA 3JYJA 3WQWA 4P8VA 3ARZA 3RM8A 3QOKA 4JFIA 1WB0A 1LL6A 1EHNA 1LQ0A 1SYTA 5BXJA 2KE0A 1JNSA 4DRJA 1OWQA 3O5JA 1JNTA 2ETNA 3TC5A 2PN0A 1M5YA 2DSUA 3PR9A 4DWSB 4Q7NA 2XP4A 1ROTA 1HJVA 2MLXA 3KCEA 5DF0A 1W9VA 1NMVA 2RQSA 1LG2A 1WMVA 4W5UA 2YSHA 2YSFA 1FKTA 1QPLA 4KQZA 3WD3A 2JMFA 2KO7A 3LKXB 3O5RA 2LAJA 1W1YA 2G41A 5E64A 2MPHA 2PPPA 3FY1A 1WR7A 5D75A 4HARA 3M85A 1E6PA 4PTMA 4TNSA 1FKFA 3UQAA 2ZR5A 1F8AB 4HBOA 2Y78A 3CH9A 1U79A 5CQ2A 1UR9A 1JVWA 4ODQA 4P8XA 2M2AA 3MCBB 2DT1A 2L2SA 2YSBA 1R9HA 3VAWA 4ODPA 1W9PA 3MQGA 1FKIA 1D2KA 3CHFA 1Q6HA 1O6IA 2M08A 2ZAJA 3PRDA 2LKNA 2WLYA 2DG4A 1Q6UA 3O5EA 1C9HA 3NI6A 2DG3A 1GOIA 2M8JA 2WLZA 1Q1CA 4IT4A 5E66A 3UI5A 4UDMA 4JFJA 2M3OW 4GGQA 5GQBA 4IQ2A 2JZVA 1WAWA 4C02B 3LE4A 1T11A 4HBEA 2A3AA 3RGCA 2RUDA 2KXQA 4J4NA 3PA7A 3RMEA 3H9RB 3UF8A 4DH0A 2VN1A 4MNMA 3GTYX 4IQCA 4MSPA 3OOBA 2FDMA 3WKZA 4DZ3A 2A3BA 4WKFA 4L72B 4ODLA 4ZPTR 1FFRA 1GRJA 4IPXA 4NNRA 3AS2A 2MDIA 2ZQVA 4WK9A 3BXWA 2ZQTA 1FLCA 1VF8A 1NWUA 1ZBKA 2DSWA 5HT1A 3LUOA 1TR8A 4TX0A 4WKHA 1JMQA 3WQVA 4P8UA 1FKLA 1ZL1A 3IKGA 3ARYA 3UQIA 3RM9A 4DWSC 3KADA 3ODKA 5E65A 4TW7A 3WH0A 4DRNA 1D7IA 2IUZA 4LAWA 2YSGA 3AROA 3CGMA 3JYMA 4DRMA 5HUAA 3ARQA 4LAXA 2G8ZA 1N1AA 1FKGA 2MLZA 2DJYA 3ALFA 1F40A 3L4HA 4WKAA 2RSEA 4DRHA 5GPRA 1NSGA 1FKSA 3G6LA 3AS1A 3GU0A 1A7XA 3WL0A 2ESCA 1QZ2A 2IF4A 4ZPWR 5HW7A 3GPKA 5GPGA 2O9OA 1FKHA 1NWSA 3CHEA 3ARXA 2RUQA 3B9EA 4XAKA 5B8IC 3EIPA 3O5IA 4A0UA 3O5LA 4A0TA 2DG9A 4TYOA 1EQ3A 4DIPA 3G6MA 2LPVA 1TFVA 4ODOA 2AOSA 1NWRA 1W1TA 2XP9A 2WK2A 2PBCA 1HKMA 2A3CA 3WD2A 1XRVA 2F23A 1D7HA 4KR0B 3KAGA 5HWBA 1Q6IA 3IK8A 5JH8A 4P8WA 5HBFA 3BMBA 4ODRA 2MNTA 4U85A 1B6CA 3AS3A 3FSBA 3FXYA 1OGBA 4ODNA 1P5QA 4NSBA 4QT3A 3UI4A 2QF8A 3FS8A 1O6WA 1J4IA 3KZ7A 2EZ5W 3O5GA 4QT2A 4Z2GA 1BKFA 4QIBA 2M1IA 2Q5AA 1W1VA 4GIVA 4G50A 4DROA 4IT6A 2XPAA 4DZ2A 1JCHB 4G2PA 5I98A 3WL1A 3RM4A 2DSVA 3OA5A 1EDQA 2RUCA 1UR8A 1ZBWA 1KT0A 1K9RA 1QPFA 2OWOA 4ITZA 3UI6A 3W4RA 4DRPA 3CHDA 2MF9A 1HJWA 1ZCNA 1XHGA 4ZS6A 1D6OA 1H0IA 4S3JA 2F21A 4WIWA 2DPEA 1TCOC 1J4RA 4FAPA 3CHCA 4AY1A 4Z2IA 4W9PA 4ML4A 1J6YA 3I6CA 2KR7A 3O5PA 1YATA 3O5FA 1ZB5A 1W1PA 4QZVB 4MPKA 4JFMA 2E45A 1LJYA 3WD0A 3B8SA 3CGNA 4S3KA 4Z2KA 1W26A 2K8IA 4O2TA 3KAHA 2XP7A 2YBTA 1NH6A 1SR0A 2EULA 5AHTA 5HTGA 4JFLA 1ZBVA 1ROUA 4Z2HA 1JNEA 1TK7A 3IHZA 2PPNA 3B9DA 3PRBA 4Q22A 3WIJA 4GLXA 1HKIA 2PV2A 2O92A 2PPOA 1OGGA 3TCZA 2XP6A 1J4HA 4MAVA 4U86A 4R0XA 4ODKA 3O5KA 3WD4A 3KACA 3ARUA 2DT2A 2KI3A 2KGJA 3NTPA 1PBKA 3B9AA 5U47A 4LAVA 3M7NA
chains in the Genus database with same CATH topology
4L3NA 3CNGA 1H0GA 2M8IA 4NZCA 4N19A 3PQHA 5E62A 3O5OA 2LGOA 3KAFA 2PV1A 2A3EA 4J4OA 4DRKA 1KFWA 2OFNA 5DO2A 5HKGA 1E6NA 3ALGA 2F2DA 2KFWA 1HKJA 2XPBA 3MQHA 1KT1A 2UZ5A 1EG4A 2JV4A 1CTNA 2D9FA 1NWTA 1ZU8A 3AS0A 3AQUA 1X6LA 4R5EA 3TDBA 1FKRA 3B7XA 4JYSA 3O5DA 2PV3A 1GUVA 2ZR6A 1HXVA 5HW6A 4DWSA 1X6NA 5DITA 4URIA 2ITKA 2ZQSA 2OLHA 3ARRA 1K9QA 5DIVA 2RURA 3IKDA 3KABA 1YW5A 3LKXA 1IX5A 1RP5A 2FAPA 4FN2A 4WJXA 4Z2JA 2Y8NB 4E5RA 2F4EA 3ARPA 1LL7A 2L4JA 1HJXA 1NMWA 2JX8A 2DSZA 1FKKA 1L1PA 2BA1A 1LL4A 1FKDA 2AWGA 4MNJA 4DRQA 1PINA 3PRAA 4U84A 5J6EA 2WM0A 4DRIA 4W9OA 2DK1A 2LJ4A 1FJDA 1ZBCA 1E9LA 4W9QA 4MNLA 1FKJA 4DWSD 2WAEA 1FAPA 2PI6A 4ODMA 1ITXA 1I5HW 3FSCA 2DT0A 1GPFA 1D7JA 3MCBA 3RFWA 4TW6A 5DEZA 2JXWA 3ARTA 2WADA 5DIUA 1Y0OA 2VCDA 3ARSA 2XP5A 3UQBA 2ZR4A 3WD1A 4ZPVR 3NRKA 2YAJB 1EYMA 3KAIA 4REXA 1E15A 4MGVA 1LG1A 1W9UA 1E6RA 3JXVA 2XP3A 4JFKA 4LGXA 3MDYB 4MTVA 1WNOA 2RE3A 3ARVA 4LAYA 2FKEA 1K9TA 1EIBA 2YSIA 5HW8A 5E5WA 1JNDA 4TW8A 3O5QA 3O5MA 3ARWA 3EY6A 2B31A 2N87A 1HKKA 1ZK6A 3CZ8A 4BF8A 2DWVA 2ZQUA 1E6ZA 1RD6A 1BL4A 2DMVA 2DT3A 2YBUA 1FFQA 3FAPA 4Z2LA 5HWCA 2XP8A 2DK7A 4DT4A 2QRVA 1FD9A 4MNKA 1EG3A 1FKBA 2MLYA 3JYJA 3WQWA 4P8VA 3ARZA 3RM8A 3QOKA 4JFIA 1WB0A 1LL6A 1EHNA 1LQ0A 1SYTA 5BXJA 2KE0A 1JNSA 4DRJA 1OWQA 3O5JA 1JNTA 3TC5A 1M5YA 2DSUA 3PR9A 4DWSB 4Q7NA 2XP4A 1ROTA 1HJVA 2MLXA 3KCEA 5DF0A 1W9VA 1NMVA 2RQSA 1LG2A 1WMVA 4W5UA 2YSHA 2YSFA 1FKTA 1QPLA 4KQZA 3WD3A 2JMFA 2KO7A 3LKXB 3O5RA 2LAJA 1W1YA 2G41A 5E64A 2MPHA 2PPPA 3FY1A 1WR7A 5D75A 4HARA 3M85A 1E6PA 4PTMA 4TNSA 1FKFA 3UQAA 2ZR5A 1F8AB 4HBOA 2Y78A 3CH9A 1U79A 5CQ2A 1UR9A 1JVWA 4ODQA 4P8XA 2M2AA 3MCBB 2DT1A 2L2SA 2YSBA 1R9HA 3VAWA 4ODPA 1W9PA 3MQGA 1FKIA 1D2KA 3CHFA 1Q6HA 1O6IA 2M08A 2ZAJA 3PRDA 2LKNA 2WLYA 2DG4A 1Q6UA 3O5EA 1C9HA 3NI6A 2DG3A 1GOIA 2M8JA 2WLZA 1Q1CA 4IT4A 5E66A 3UI5A 4JFJA 2M3OW 4GGQA 5GQBA 4IQ2A 2JZVA 1WAWA 4C02B 3LE4A 1T11A 4HBEA 2A3AA 3RGCA 2RUDA 2KXQA 4J4NA 3PA7A 3RMEA 3H9RB 3UF8A 4DH0A 2VN1A 4MNMA 4IQCA 4MSPA 3OOBA 2FDMA 3WKZA 4DZ3A 2A3BA 4WKFA 4L72B 4ODLA 4ZPTR 1FFRA 4IPXA 4NNRA 3AS2A 2MDIA 2ZQVA 4WK9A 3BXWA 2ZQTA 1FLCA 1VF8A 1NWUA 1ZBKA 2DSWA 5HT1A 3LUOA 1TR8A 4TX0A 4WKHA 1JMQA 3WQVA 4P8UA 1FKLA 1ZL1A 3IKGA 3ARYA 3UQIA 3RM9A 4DWSC 3KADA 3ODKA 5E65A 4TW7A 3WH0A 4DRNA 1D7IA 2IUZA 4LAWA 2YSGA 3AROA 3CGMA 3JYMA 4DRMA 5HUAA 3ARQA 4LAXA 2G8ZA 1N1AA 1FKGA 2MLZA 2DJYA 3ALFA 1F40A 3L4HA 4WKAA 2RSEA 4DRHA 5GPRA 1NSGA 1FKSA 3G6LA 3AS1A 1A7XA 3WL0A 2ESCA 1QZ2A 2IF4A 4ZPWR 5HW7A 3GPKA 5GPGA 2O9OA 1FKHA 1NWSA 3CHEA 3ARXA 2RUQA 3B9EA 4XAKA 5B8IC 3O5IA 4A0UA 3O5LA 4A0TA 2DG9A 4TYOA 1EQ3A 4DIPA 3G6MA 2LPVA 1TFVA 4ODOA 2AOSA 1NWRA 1W1TA 2XP9A 2WK2A 2PBCA 1HKMA 2A3CA 3WD2A 1XRVA 1D7HA 4KR0B 3KAGA 5HWBA 1Q6IA 3IK8A 5JH8A 4P8WA 5HBFA 4ODRA 2MNTA 4U85A 1B6CA 3AS3A 3FSBA 3FXYA 1OGBA 4ODNA 1P5QA 4NSBA 4QT3A 3UI4A 2QF8A 3FS8A 1O6WA 1J4IA 3KZ7A 2EZ5W 3O5GA 4QT2A 4Z2GA 1BKFA 4QIBA 2M1IA 2Q5AA 1W1VA 4GIVA 4G50A 4DROA 4IT6A 2XPAA 4DZ2A 4G2PA 5I98A 3WL1A 3RM4A 2DSVA 3OA5A 1EDQA 2RUCA 1UR8A 1ZBWA 1KT0A 1K9RA 1QPFA 2OWOA 4ITZA 3UI6A 3W4RA 4DRPA 3CHDA 2MF9A 1HJWA 1ZCNA 1XHGA 4ZS6A 1D6OA 1H0IA 4S3JA 2F21A 4WIWA 2DPEA 1TCOC 1J4RA 4FAPA 3CHCA 4AY1A 4Z2IA 4W9PA 4ML4A 1J6YA 3I6CA 2KR7A 3O5PA 1YATA 3O5FA 1ZB5A 1W1PA 4QZVB 4MPKA 4JFMA 2E45A 1LJYA 3WD0A 3B8SA 3CGNA 4S3KA 4Z2KA 1W26A 2K8IA 4O2TA 3KAHA 2XP7A 2YBTA 1NH6A 1SR0A 5AHTA 5HTGA 4JFLA 1ZBVA 1ROUA 4Z2HA 1JNEA 1TK7A 3IHZA 2PPNA 3B9DA 3PRBA 4Q22A 3WIJA 4GLXA 1HKIA 2PV2A 2O92A 2PPOA 1OGGA 3TCZA 2XP6A 1J4HA 4MAVA 4U86A 4R0XA 4ODKA 3O5KA 3WD4A 3KACA 3ARUA 2DT2A 2KI3A 2KGJA 3NTPA 1PBKA 3B9AA 5U47A 4LAVA 3M7NA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3CNG A;  2M8I A;  4N19 A;  3O5O A;  2LGO A;  3KAF A;  2PV1 A;  4J4O A;  4DRK A;  2OFN A;  5HKG A;  2F2D A;  2KFW A;  2XPB A;  1KT1 A;  2UZ5 A;  1EG4 A;  2JV4 A;  2D9F A;  3TDB A;  1FKR A;  3B7X A;  4JYS A;  3O5D A;  2PV3 A;  2ZR6 A;  1HXV A;  5HW6 A;  5DIT A;  2ITK A;  2ZQS A;  1K9Q A;  5DIV A;  2RUR A;  3IKD A;  3KAB A;  1YW5 A;  2FAP A;  4FN2 A;  4E5R A;  2F4E A;  2L4J A;  1NMW A;  2JX8 A;  1FKK A;  1L1P A;  2BA1 A;  1FKD A;  2AWG A;  4DRQ A;  1PIN A;  4U84 A;  5J6E A;  4DRI A;  4W9O A;  2DK1 A;  2LJ4 A;  1FJD A;  4W9Q A;  1FKJ A;  1FAP A;  4ODM A;  1I5H W;  1D7J A;  3RFW A;  4TW6 A;  2JXW A;  5DIU A;  1Y0O A;  2VCD A;  2XP5 A;  3UQB A;  2ZR4 A;  3NRK A;  1EYM A;  3KAI A;  4REX A;  4MGV A;  3JXV A;  2XP3 A;  4JFK A;  3MDY B;  2RE3 A;  4LAY A;  2FKE A;  2YSI A;  5HW8 A;  4TW8 A;  3O5Q A;  3O5M A;  3EY6 A;  2N87 A;  1ZK6 A;  4BF8 A;  2DWV A;  2ZQU A;  1BL4 A;  2DMV A;  3FAP A;  5HWC A;  2XP8 A;  2DK7 A;  4DT4 A;  1FD9 A;  1EG3 A;  1FKB A;  2MLY A;  3JYJ A;  4JFI A;  5BXJ A;  2KE0 A;  1JNS A;  4DRJ A;  3O5J A;  1JNT A;  3TC5 A;  1M5Y A;  2XP4 A;  1ROT A;  2MLX A;  3KCE A;  1NMV A;  2RQS A;  1WMV A;  2YSH A;  2YSF A;  1FKT A;  1QPL A;  2JMF A;  2KO7 A;  3O5R A;  2LAJ A;  2PPP A;  2MPH A;  1WR7 A;  5D75 A;  3M85 A;  4TNS A;  1FKF A;  3UQA A;  2ZR5 A;  1F8A B;  2Y78 A;  1U79 A;  5CQ2 A;  1JVW A;  4ODQ A;  2M2A A;  2L2S A;  2YSB A;  1R9H A;  3VAW A;  4ODP A;  1FKI A;  1Q6H A;  2M08 A;  2ZAJ A;  3PRD A;  2LKN A;  2DG4 A;  1Q6U A;  3O5E A;  1C9H A;  3NI6 A;  2DG3 A;  2M8J A;  1Q1C A;  3UI5 A;  4JFJ A;  2M3O W;  4GGQ A;  4IQ2 A;  2JZV A;  4C02 B;  3LE4 A;  1T11 A;  3RGC A;  2RUD A;  2KXQ A;  4J4N A;  3PA7 A;  3H9R B;  3UF8 A;  4DH0 A;  2VN1 A;  4IQC A;  4MSP A;  3OOB A;  4DZ3 A;  4ODL A;  4IPX A;  4NNR A;  2MDI A;  2ZQV A;  2ZQT A;  5HT1 A;  3LUO A;  4TX0 A;  1JMQ A;  1FKL A;  3IKG A;  3UQI A;  3KAD A;  3ODK A;  4TW7 A;  3WH0 A;  4DRN A;  1D7I A;  4LAW A;  2YSG A;  3CGM A;  3JYM A;  4DRM A;  5HUA A;  4LAX A;  1N1A A;  1FKG A;  2MLZ A;  2DJY A;  1F40 A;  3L4H A;  2RSE A;  4DRH A;  1NSG A;  1FKS A;  1A7X A;  1QZ2 A;  2IF4 A;  5HW7 A;  3GPK A;  5GPG A;  1FKH A;  2RUQ A;  5B8I C;  3O5I A;  3O5L A;  1EQ3 A;  2DG9 A;  4TYO A;  4DIP A;  2LPV A;  4ODO A;  2XP9 A;  2PBC A;  1D7H A;  3KAG A;  5HWB A;  1Q6I A;  3IK8 A;  4ODR A;  2MNT A;  4U85 A;  1B6C A;  4ODN A;  1P5Q A;  4QT3 A;  3UI4 A;  1O6W A;  1J4I A;  3KZ7 A;  2EZ5 W;  3O5G A;  4QT2 A;  1BKF A;  4QIB A;  2M1I A;  2Q5A A;  4GIV A;  4G50 A;  4DRO A;  2XPA A;  4DZ2 A;  4G2P A;  5I98 A;  2RUC A;  1KT0 A;  1K9R A;  1QPF A;  4ITZ A;  3UI6 A;  4DRP A;  2MF9 A;  1ZCN A;  1D6O A;  2F21 A;  1TCO C;  1J4R A;  4FAP A;  4W9P A;  1J6Y A;  3I6C A;  2KR7 A;  3O5P A;  1YAT A;  3O5F A;  4JFM A;  2E45 A;  3CGN A;  1W26 A;  2K8I A;  4O2T A;  3KAH A;  2XP7 A;  5AHT A;  5HTG A;  4JFL A;  1ROU A;  1TK7 A;  3IHZ A;  2PPN A;  3PRB A;  2PV2 A;  2PPO A;  3TCZ A;  2XP6 A;  1J4H A;  4U86 A;  4R0X A;  4ODK A;  3O5K A;  3KAC A;  2KI3 A;  2KGJ A;  3NTP A;  1PBK A;  4LAV A;  3M7N A; 
#chains in the Genus database with same CATH topology
 4L3N A;  3CNG A;  1H0G A;  2M8I A;  4NZC A;  4N19 A;  3PQH A;  5E62 A;  3O5O A;  2LGO A;  3KAF A;  2PV1 A;  2A3E A;  4J4O A;  4DRK A;  1KFW A;  2OFN A;  5DO2 A;  5HKG A;  1E6N A;  3ALG A;  2F2D A;  2KFW A;  1HKJ A;  2XPB A;  3MQH A;  1KT1 A;  2UZ5 A;  1EG4 A;  2JV4 A;  1CTN A;  2D9F A;  1NWT A;  1ZU8 A;  3AS0 A;  3AQU A;  1X6L A;  4R5E A;  3TDB A;  1FKR A;  3B7X A;  4JYS A;  2B5U B;  3O5D A;  2PV3 A;  1GUV A;  2ZR6 A;  1HXV A;  5HW6 A;  4DWS A;  1X6N A;  5DIT A;  4URI A;  2ITK A;  2ZQS A;  2OLH A;  3ARR A;  1K9Q A;  5DIV A;  2RUR A;  3IKD A;  3KAB A;  1YW5 A;  3LKX A;  1IX5 A;  1RP5 A;  2FAP A;  4FN2 A;  4WJX A;  4Z2J A;  2Y8N B;  4E5R A;  2F4E A;  3ARP A;  1LL7 A;  2L4J A;  1HJX A;  1NMW A;  2JX8 A;  2DSZ A;  1FKK A;  1L1P A;  2BA1 A;  1LL4 A;  1FKD A;  2AWG A;  4MNJ A;  4DRQ A;  1PIN A;  3PRA A;  4U84 A;  5J6E A;  2WM0 A;  4DRI A;  4W9O A;  2DK1 A;  2LJ4 A;  1FJD A;  1ZBC A;  1E9L A;  4W9Q A;  4MNL A;  1FKJ A;  4DWS D;  2WAE A;  1FAP A;  2PI6 A;  4ODM A;  1ITX A;  1E44 A;  1I5H W;  3FSC A;  2DT0 A;  1GPF A;  1D7J A;  3MCB A;  3RFW A;  4TW6 A;  5DEZ A;  2JXW A;  3ART A;  2WAD A;  5DIU A;  1Y0O A;  2VCD A;  3ARS A;  2XP5 A;  3UQB A;  2ZR4 A;  3WD1 A;  4ZPV R;  3NRK A;  2YAJ B;  1EYM A;  3KAI A;  4REX A;  1E15 A;  4MGV A;  1LG1 A;  1W9U A;  1E6R A;  3JXV A;  2XP3 A;  4JFK A;  4LGX A;  3MDY B;  4MTV A;  1WNO A;  2RE3 A;  3ARV A;  4LAY A;  2P4V A;  2FKE A;  1K9T A;  1EIB A;  2YSI A;  5HW8 A;  5E5W A;  1JND A;  4TW8 A;  3O5Q A;  3O5M A;  3ARW A;  3EY6 A;  2B31 A;  2N87 A;  1HKK A;  1ZK6 A;  3CZ8 A;  4BF8 A;  2DWV A;  2ZQU A;  1E6Z A;  1RD6 A;  1BL4 A;  2DMV A;  2DT3 A;  2YBU A;  1FFQ A;  3FAP A;  4Z2L A;  5HWC A;  2XP8 A;  2DK7 A;  4DT4 A;  2QRV A;  1FD9 A;  4MNK A;  1EG3 A;  1FKB A;  2MLY A;  3JYJ A;  3WQW A;  4P8V A;  3ARZ A;  3RM8 A;  3QOK A;  4JFI A;  1WB0 A;  1LL6 A;  1EHN A;  1LQ0 A;  1SYT A;  5BXJ A;  2KE0 A;  1JNS A;  4DRJ A;  1OWQ A;  3O5J A;  1JNT A;  2ETN A;  3TC5 A;  2PN0 A;  1M5Y A;  2DSU A;  3PR9 A;  4DWS B;  4Q7N A;  2XP4 A;  1ROT A;  1HJV A;  2MLX A;  3KCE A;  5DF0 A;  1W9V A;  1NMV A;  2RQS A;  1LG2 A;  1WMV A;  4W5U A;  2YSH A;  2YSF A;  1FKT A;  1QPL A;  4KQZ A;  3WD3 A;  2JMF A;  2KO7 A;  3LKX B;  3O5R A;  2LAJ A;  1W1Y A;  2G41 A;  5E64 A;  2MPH A;  2PPP A;  3FY1 A;  1WR7 A;  5D75 A;  4HAR A;  3M85 A;  1E6P A;  4PTM A;  4TNS A;  1FKF A;  3UQA A;  2ZR5 A;  1F8A B;  4HBO A;  2Y78 A;  3CH9 A;  1U79 A;  5CQ2 A;  1UR9 A;  1JVW A;  4ODQ A;  4P8X A;  2M2A A;  3MCB B;  2DT1 A;  2L2S A;  2YSB A;  1R9H A;  3VAW A;  4ODP A;  1W9P A;  3MQG A;  1FKI A;  1D2K A;  3CHF A;  1Q6H A;  1O6I A;  2M08 A;  2ZAJ A;  3PRD A;  2LKN A;  2WLY A;  2DG4 A;  1Q6U A;  3O5E A;  1C9H A;  3NI6 A;  2DG3 A;  1GOI A;  2M8J A;  2WLZ A;  1Q1C A;  4IT4 A;  5E66 A;  3UI5 A;  4UDM A;  4JFJ A;  2M3O W;  4GGQ A;  5GQB A;  4IQ2 A;  2JZV A;  1WAW A;  4C02 B;  3LE4 A;  1T11 A;  4HBE A;  2A3A A;  3RGC A;  2RUD A;  2KXQ A;  4J4N A;  3PA7 A;  3RME A;  3H9R B;  3UF8 A;  4DH0 A;  2VN1 A;  4MNM A;  3GTY X;  4IQC A;  4MSP A;  3OOB A;  2FDM A;  3WKZ A;  4DZ3 A;  2A3B A;  4WKF A;  4L72 B;  4ODL A;  4ZPT R;  1FFR A;  1GRJ A;  4IPX A;  4NNR A;  3AS2 A;  2MDI A;  2ZQV A;  4WK9 A;  3BXW A;  2ZQT A;  1FLC A;  1VF8 A;  1NWU A;  1ZBK A;  2DSW A;  5HT1 A;  3LUO A;  1TR8 A;  4TX0 A;  4WKH A;  1JMQ A;  3WQV A;  4P8U A;  1FKL A;  1ZL1 A;  3IKG A;  3ARY A;  3UQI A;  3RM9 A;  4DWS C;  3KAD A;  3ODK A;  5E65 A;  4TW7 A;  3WH0 A;  4DRN A;  1D7I A;  2IUZ A;  4LAW A;  2YSG A;  3ARO A;  3CGM A;  3JYM A;  4DRM A;  5HUA A;  3ARQ A;  4LAX A;  2G8Z A;  1N1A A;  1FKG A;  2MLZ A;  2DJY A;  3ALF A;  1F40 A;  3L4H A;  4WKA A;  2RSE A;  4DRH A;  5GPR A;  1NSG A;  1FKS A;  3G6L A;  3AS1 A;  3GU0 A;  1A7X A;  3WL0 A;  2ESC A;  1QZ2 A;  2IF4 A;  4ZPW R;  5HW7 A;  3GPK A;  5GPG A;  2O9O A;  1FKH A;  1NWS A;  3CHE A;  3ARX A;  2RUQ A;  3B9E A;  4XAK A;  5B8I C;  3EIP A;  3O5I A;  4A0U A;  3O5L A;  4A0T A;  2DG9 A;  4TYO A;  1EQ3 A;  4DIP A;  3G6M A;  2LPV A;  1TFV A;  4ODO A;  2AOS A;  1NWR A;  1W1T A;  2XP9 A;  2WK2 A;  2PBC A;  1HKM A;  2A3C A;  3WD2 A;  1XRV A;  2F23 A;  1D7H A;  4KR0 B;  3KAG A;  5HWB A;  1Q6I A;  3IK8 A;  5JH8 A;  4P8W A;  5HBF A;  3BMB A;  4ODR A;  2MNT A;  4U85 A;  1B6C A;  3AS3 A;  3FSB A;  3FXY A;  1OGB A;  4ODN A;  1P5Q A;  4NSB A;  4QT3 A;  3UI4 A;  2QF8 A;  3FS8 A;  1O6W A;  1J4I A;  3KZ7 A;  2EZ5 W;  3O5G A;  4QT2 A;  4Z2G A;  1BKF A;  4QIB A;  2M1I A;  2Q5A A;  1W1V A;  4GIV A;  4G50 A;  4DRO A;  4IT6 A;  2XPA A;  4DZ2 A;  1JCH B;  4G2P A;  5I98 A;  3WL1 A;  3RM4 A;  2DSV A;  3OA5 A;  1EDQ A;  2RUC A;  1UR8 A;  1ZBW A;  1KT0 A;  1K9R A;  1QPF A;  2OWO A;  4ITZ A;  3UI6 A;  3W4R A;  4DRP A;  3CHD A;  2MF9 A;  1HJW A;  1ZCN A;  1XHG A;  4ZS6 A;  1D6O A;  1H0I A;  4S3J A;  2F21 A;  4WIW A;  2DPE A;  1TCO C;  1J4R A;  4FAP A;  3CHC A;  4AY1 A;  4Z2I A;  4W9P A;  4ML4 A;  1J6Y A;  3I6C A;  2KR7 A;  3O5P A;  1YAT A;  3O5F A;  1ZB5 A;  1W1P A;  4QZV B;  4MPK A;  4JFM A;  2E45 A;  1LJY A;  3WD0 A;  3B8S A;  3CGN A;  4S3K A;  4Z2K A;  1W26 A;  2K8I A;  4O2T A;  3KAH A;  2XP7 A;  2YBT A;  1NH6 A;  1SR0 A;  2EUL A;  5AHT A;  5HTG A;  4JFL A;  1ZBV A;  1ROU A;  4Z2H A;  1JNE A;  1TK7 A;  3IHZ A;  2PPN A;  3B9D A;  3PRB A;  4Q22 A;  3WIJ A;  4GLX A;  1HKI A;  2PV2 A;  2O92 A;  2PPO A;  1OGG A;  3TCZ A;  2XP6 A;  1J4H A;  4MAV A;  4U86 A;  4R0X A;  4ODK A;  3O5K A;  3WD4 A;  3KAC A;  3ARU A;  2DT2 A;  2KI3 A;  2KGJ A;  3NTP A;  1PBK A;  3B9A A;  5U47 A;  4LAV A;  3M7N A; 
#chains in the Genus database with same CATH homology
 4L3N A;  3CNG A;  1H0G A;  2M8I A;  4NZC A;  4N19 A;  3PQH A;  5E62 A;  3O5O A;  2LGO A;  3KAF A;  2PV1 A;  2A3E A;  4J4O A;  4DRK A;  1KFW A;  2OFN A;  5DO2 A;  5HKG A;  1E6N A;  3ALG A;  2F2D A;  2KFW A;  1HKJ A;  2XPB A;  3MQH A;  1KT1 A;  2UZ5 A;  1EG4 A;  2JV4 A;  1CTN A;  2D9F A;  1NWT A;  1ZU8 A;  3AS0 A;  3AQU A;  1X6L A;  4R5E A;  3TDB A;  1FKR A;  3B7X A;  4JYS A;  3O5D A;  2PV3 A;  1GUV A;  2ZR6 A;  1HXV A;  5HW6 A;  4DWS A;  1X6N A;  5DIT A;  4URI A;  2ITK A;  2ZQS A;  2OLH A;  3ARR A;  1K9Q A;  5DIV A;  2RUR A;  3IKD A;  3KAB A;  1YW5 A;  3LKX A;  1IX5 A;  1RP5 A;  2FAP A;  4FN2 A;  4WJX A;  4Z2J A;  2Y8N B;  4E5R A;  2F4E A;  3ARP A;  1LL7 A;  2L4J A;  1HJX A;  1NMW A;  2JX8 A;  2DSZ A;  1FKK A;  1L1P A;  2BA1 A;  1LL4 A;  1FKD A;  2AWG A;  4MNJ A;  4DRQ A;  1PIN A;  3PRA A;  4U84 A;  5J6E A;  2WM0 A;  4DRI A;  4W9O A;  2DK1 A;  2LJ4 A;  1FJD A;  1ZBC A;  1E9L A;  4W9Q A;  4MNL A;  1FKJ A;  4DWS D;  2WAE A;  1FAP A;  2PI6 A;  4ODM A;  1ITX A;  1I5H W;  3FSC A;  2DT0 A;  1GPF A;  1D7J A;  3MCB A;  3RFW A;  4TW6 A;  5DEZ A;  2JXW A;  3ART A;  2WAD A;  5DIU A;  1Y0O A;  2VCD A;  3ARS A;  2XP5 A;  3UQB A;  2ZR4 A;  3WD1 A;  4ZPV R;  3NRK A;  2YAJ B;  1EYM A;  3KAI A;  4REX A;  1E15 A;  4MGV A;  1LG1 A;  1W9U A;  1E6R A;  3JXV A;  2XP3 A;  4JFK A;  4LGX A;  3MDY B;  4MTV A;  1WNO A;  2RE3 A;  3ARV A;  4LAY A;  2FKE A;  1K9T A;  1EIB A;  2YSI A;  5HW8 A;  5E5W A;  1JND A;  4TW8 A;  3O5Q A;  3O5M A;  3ARW A;  3EY6 A;  2B31 A;  2N87 A;  1HKK A;  1ZK6 A;  3CZ8 A;  4BF8 A;  2DWV A;  2ZQU A;  1E6Z A;  1RD6 A;  1BL4 A;  2DMV A;  2DT3 A;  2YBU A;  1FFQ A;  3FAP A;  4Z2L A;  5HWC A;  2XP8 A;  2DK7 A;  4DT4 A;  2QRV A;  1FD9 A;  4MNK A;  1EG3 A;  1FKB A;  2MLY A;  3JYJ A;  3WQW A;  4P8V A;  3ARZ A;  3RM8 A;  3QOK A;  4JFI A;  1WB0 A;  1LL6 A;  1EHN A;  1LQ0 A;  1SYT A;  5BXJ A;  2KE0 A;  1JNS A;  4DRJ A;  1OWQ A;  3O5J A;  1JNT A;  3TC5 A;  1M5Y A;  2DSU A;  3PR9 A;  4DWS B;  4Q7N A;  2XP4 A;  1ROT A;  1HJV A;  2MLX A;  3KCE A;  5DF0 A;  1W9V A;  1NMV A;  2RQS A;  1LG2 A;  1WMV A;  4W5U A;  2YSH A;  2YSF A;  1FKT A;  1QPL A;  4KQZ A;  3WD3 A;  2JMF A;  2KO7 A;  3LKX B;  3O5R A;  2LAJ A;  1W1Y A;  2G41 A;  5E64 A;  2MPH A;  2PPP A;  3FY1 A;  1WR7 A;  5D75 A;  4HAR A;  3M85 A;  1E6P A;  4PTM A;  4TNS A;  1FKF A;  3UQA A;  2ZR5 A;  1F8A B;  4HBO A;  2Y78 A;  3CH9 A;  1U79 A;  5CQ2 A;  1UR9 A;  1JVW A;  4ODQ A;  4P8X A;  2M2A A;  3MCB B;  2DT1 A;  2L2S A;  2YSB A;  1R9H A;  3VAW A;  4ODP A;  1W9P A;  3MQG A;  1FKI A;  1D2K A;  3CHF A;  1Q6H A;  1O6I A;  2M08 A;  2ZAJ A;  3PRD A;  2LKN A;  2WLY A;  2DG4 A;  1Q6U A;  3O5E A;  1C9H A;  3NI6 A;  2DG3 A;  1GOI A;  2M8J A;  2WLZ A;  1Q1C A;  4IT4 A;  5E66 A;  3UI5 A;  4JFJ A;  2M3O W;  4GGQ A;  5GQB A;  4IQ2 A;  2JZV A;  1WAW A;  4C02 B;  3LE4 A;  1T11 A;  4HBE A;  2A3A A;  3RGC A;  2RUD A;  2KXQ A;  4J4N A;  3PA7 A;  3RME A;  3H9R B;  3UF8 A;  4DH0 A;  2VN1 A;  4MNM A;  4IQC A;  4MSP A;  3OOB A;  2FDM A;  3WKZ A;  4DZ3 A;  2A3B A;  4WKF A;  4L72 B;  4ODL A;  4ZPT R;  1FFR A;  4IPX A;  4NNR A;  3AS2 A;  2MDI A;  2ZQV A;  4WK9 A;  3BXW A;  2ZQT A;  1FLC A;  1VF8 A;  1NWU A;  1ZBK A;  2DSW A;  5HT1 A;  3LUO A;  1TR8 A;  4TX0 A;  4WKH A;  1JMQ A;  3WQV A;  4P8U A;  1FKL A;  1ZL1 A;  3IKG A;  3ARY A;  3UQI A;  3RM9 A;  4DWS C;  3KAD A;  3ODK A;  5E65 A;  4TW7 A;  3WH0 A;  4DRN A;  1D7I A;  2IUZ A;  4LAW A;  2YSG A;  3ARO A;  3CGM A;  3JYM A;  4DRM A;  5HUA A;  3ARQ A;  4LAX A;  2G8Z A;  1N1A A;  1FKG A;  2MLZ A;  2DJY A;  3ALF A;  1F40 A;  3L4H A;  4WKA A;  2RSE A;  4DRH A;  5GPR A;  1NSG A;  1FKS A;  3G6L A;  3AS1 A;  1A7X A;  3WL0 A;  2ESC A;  1QZ2 A;  2IF4 A;  4ZPW R;  5HW7 A;  3GPK A;  5GPG A;  2O9O A;  1FKH A;  1NWS A;  3CHE A;  3ARX A;  2RUQ A;  3B9E A;  4XAK A;  5B8I C;  3O5I A;  4A0U A;  3O5L A;  4A0T A;  2DG9 A;  4TYO A;  1EQ3 A;  4DIP A;  3G6M A;  2LPV A;  1TFV A;  4ODO A;  2AOS A;  1NWR A;  1W1T A;  2XP9 A;  2WK2 A;  2PBC A;  1HKM A;  2A3C A;  3WD2 A;  1XRV A;  1D7H A;  4KR0 B;  3KAG A;  5HWB A;  1Q6I A;  3IK8 A;  5JH8 A;  4P8W A;  5HBF A;  4ODR A;  2MNT A;  4U85 A;  1B6C A;  3AS3 A;  3FSB A;  3FXY A;  1OGB A;  4ODN A;  1P5Q A;  4NSB A;  4QT3 A;  3UI4 A;  2QF8 A;  3FS8 A;  1O6W A;  1J4I A;  3KZ7 A;  2EZ5 W;  3O5G A;  4QT2 A;  4Z2G A;  1BKF A;  4QIB A;  2M1I A;  2Q5A A;  1W1V A;  4GIV A;  4G50 A;  4DRO A;  4IT6 A;  2XPA A;  4DZ2 A;  4G2P A;  5I98 A;  3WL1 A;  3RM4 A;  2DSV A;  3OA5 A;  1EDQ A;  2RUC A;  1UR8 A;  1ZBW A;  1KT0 A;  1K9R A;  1QPF A;  2OWO A;  4ITZ A;  3UI6 A;  3W4R A;  4DRP A;  3CHD A;  2MF9 A;  1HJW A;  1ZCN A;  1XHG A;  4ZS6 A;  1D6O A;  1H0I A;  4S3J A;  2F21 A;  4WIW A;  2DPE A;  1TCO C;  1J4R A;  4FAP A;  3CHC A;  4AY1 A;  4Z2I A;  4W9P A;  4ML4 A;  1J6Y A;  3I6C A;  2KR7 A;  3O5P A;  1YAT A;  3O5F A;  1ZB5 A;  1W1P A;  4QZV B;  4MPK A;  4JFM A;  2E45 A;  1LJY A;  3WD0 A;  3B8S A;  3CGN A;  4S3K A;  4Z2K A;  1W26 A;  2K8I A;  4O2T A;  3KAH A;  2XP7 A;  2YBT A;  1NH6 A;  1SR0 A;  5AHT A;  5HTG A;  4JFL A;  1ZBV A;  1ROU A;  4Z2H A;  1JNE A;  1TK7 A;  3IHZ A;  2PPN A;  3B9D A;  3PRB A;  4Q22 A;  3WIJ A;  4GLX A;  1HKI A;  2PV2 A;  2O92 A;  2PPO A;  1OGG A;  3TCZ A;  2XP6 A;  1J4H A;  4MAV A;  4U86 A;  4R0X A;  4ODK A;  3O5K A;  3WD4 A;  3KAC A;  3ARU A;  2DT2 A;  2KI3 A;  2KGJ A;  3NTP A;  1PBK A;  3B9A A;  5U47 A;  4LAV A;  3M7N A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...