3OOBA

Structural and functional insights of directly targeting pin1 by epigallocatechin-3-gallate
Total Genus 49
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
49
sequence length
158
structure length
146
Chain Sequence
KLPPGWEKAMSRSSGRVYYFNHITNASQWERPSEPARVRCSHLLVKHSQSRRPSSWRQEKITRTKEEALELINGYIQKIKSGEEDFESLASQFSDCSSAKARGDLGAFSRGQMQKPFEDASFALRTGEMSGPVFTDSGIHIILRTE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Epigallocatechin-gallate suppresses tumorigenesis by directly targeting Pin1.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Isomerase
molecule keywords Peptidyl-prolyl cis-trans isomerase NIMA-interacting 1
total genus 49
structure length 146
sequence length 158
ec nomenclature ec 5.2.1.8: Peptidylprolyl isomerase.
pdb deposition date 2010-08-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00397 WW WW domain
A PF00639 Rotamase PPIC-type PPIASE domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.20.70.10 Mainly Beta Single Sheet Ubiquitin Ligase Nedd4; Chain: W; Ubiquitin Ligase Nedd4; Chain: W; 3oobA01
3.10.50.40 Alpha Beta Roll Chitinase A; domain 3 Chitinase A; domain 3 3oobA02
3JYJA 1M5YA 3JXVA 2ZQUA 1FKSA 1FKRA 1FKTA 2K8IA 1EQ3A 3CGMA 2N87A 5J6EA 2F2DA 4QT3A 3O5GA 2M8JA 3O5RA 3NTPA 2D9FA 1WMVA 4ODRA 2DK1A 1I5HW 2DG9A 2YSGA 2PV2A 2E45A 1FAPA 1FKBA 3O5FA 4NNRA 2RUQA 2KFWA 1D7JA 4DRPA 4QIBA 2DG4A 2XP9A 2RQSA 4E5RA 1J4RA 3VAWA 2RUDA 2F21A 1FKJA 4DRJA 1JMQA 1J4IA 2M1IA 4ODPA 2YSFA 1R9HA 2XP3A 2XP6A 4DIPA 4DH0A 2DMVA 3M7NA 1KT0A 3PA7A 4O2TA 4ODMA 5HW7A 4C02B 2ZQTA 1JNTA 1YW5A 3FAPA 4DT4A 4QT2A 2LJ4A 1ZK6A 1D7HA 1KT1A 3CGNA 3I6CA 1FKDA 2JZVA 1Y0OA 3IKDA 4TYOA 3RGCA 3O5EA 2DK7A 1FKFA 3O5QA 4J4NA 4R0XA 5DIVA 4DZ3A 2M8IA 1FD9A 2YSHA 3B7XA 1U79A 1QPFA 1PBKA 4JFIA 4ODLA 3KAGA 4TW8A 5HT1A 4DRQA 5HW8A 4W9OA 4G50A 2XP8A 1A7XA 3H9RB 2RE3A 1JVWA 4W9PA 1WR7A 3TDBA 5B8IC 2L2SA 3UQIA 4DZ2A 1D6OA 3LUOA 2IF4A 2MLYA 3IK8A 3LE4A 1ZCNA 3KADA 3MDYB 1F40A 2KO7A 4BF8A 3O5KA 2ITKA 1Q1CA 3KZ7A 2LAJA 1FKHA 1NMVA 3TCZA 2KE0A 1W26A 4LAWA 2ZQSA 2XP5A 4REXA 5HTGA 2DJYA 4ITZA 2BA1A 4IQCA 2VCDA 2YSBA 4JYSA 3WH0A 1Q6HA 2AWGA 2PPOA 3ODKA 1B6CA 4IPXA 1FJDA 3EY6A 3TC5A 2ZAJA 2XP4A 2ZR6A 1K9QA 2EZ5W 2Q5AA 1Q6UA 1QPLA 1ROTA 2KI3A 2MPHA 1NMWA 1D7IA 2L4JA 2MF9A 2PBCA 4JFLA 5DITA 3JYMA 1L1PA 3OOBA 3KACA 1J4HA 1HXVA 4ODQA 2JMFA 2MDIA 3O5LA 4TW6A 3UQAA 2FKEA 1T11A 4ODKA 1TK7A 2YSIA 2DWVA 1O6WA 2JXWA 2VN1A 4ODOA 4TX0A 4W9QA 1YATA 4FN2A 4GGQA 3IKGA 4U85A 3NI6A 3UQBA 2KR7A 1J6YA 1EG4A 2JX8A 3KAHA 1F8AB 4U86A 2M08A 2PV3A 1BL4A 3O5MA 3O5OA 2XPAA 3L4HA 3KAIA 1FKIA 3GPKA 5HUAA 4JFKA 2ZR5A 4TW7A 2MLZA 2ZR4A 4DRMA 2DG3A 4LAYA 2F4EA 1JNSA 2LPVA 1P5QA 1NSGA 3KAFA 3KCEA 3UF8A 4IQ2A 3UI5A 4J4OA 5I98A 4G2PA 2PPPA 1QZ2A 1N1AA 3NRKA 1PINA 5GPGA 4DRNA 5DIUA 2XP7A 5D75A 3O5PA 2RURA 3KABA 2JV4A 2M2AA 2LGOA 3O5DA 5BXJA 2KXQA 4TNSA 1TCOC 4DRIA 3CNGA 2UZ5A 4LAVA 2Y78A 2LKNA 3UI6A 2XPBA 3O5JA 2RSEA 4DRHA 5HWBA 3PRBA 4JFJA 3M85A 4MGVA 4MSPA 1Q6IA 2RUCA 1FKGA 4N19A 1BKFA 4ODNA 4DRKA 5HKGA 5HWCA 2M3OW 3UI4A 2KGJA 4DROA 2ZQVA 4U84A 5HW6A 3IHZA 5CQ2A 1ROUA 2FAPA 1EG3A 2MNTA 3PRDA 2OFNA 4JFMA 2PV1A 4FAPA 2PPNA 3O5IA 1EYMA 1FKKA 4LAXA 3RFWA 2MLXA 4GIVA 5AHTA 1K9RA 1FKLA 1C9HA
chains in the Genus database with same CATH superfamily
3JXVA 2K8IA 4W5UA 2F2DA 2M8JA 1W1TA 1FFQA 2DK1A 1I5HW 2YSGA 1FKBA 2KFWA 4DRPA 4URIA 3B9EA 4HARA 4E5RA 1XHGA 2RUDA 1HJVA 2M1IA 4ODPA 1R9HA 4DH0A 2DMVA 3PA7A 3RM9A 1NWTA 1YW5A 1CTNA 1FKDA 4ZPWR 4J4NA 4DZ3A 1O6IA 4QZVB 5HW8A 5HT1A 4TW8A 4AY1A 1A7XA 3H9RB 1D6OA 4Z2HA 1E15A 3MDYB 1F40A 2DT2A 4BF8A 1FKHA 2KE0A 3W4RA 3FY1A 4ITZA 1LJYA 2BA1A 4WKHA 3ALGA 5E62A 3TC5A 3GU0A 2ZAJA 1K9QA 4XAKA 4ODRA 5DITA 2PBCA 1L1PA 3CHEA 2OWOA 4WK9A 2G41A 4ODQA 4TW6A 1T11A 2QF8A 2YSIA 1WAWA 3BMBA 3QOKA 4L72B 1E44A 3GTYX 3FXYA 3ARUA 2A3CA 1EG4A 3WIJA 1F8AB 2PV3A 2XPAA 4Z2IA 2DSZA 2IUZA 1W9UA 4JFKA 2YBUA 4Z2JA 4LAYA 3B9AA 1ZBCA 4P8UA 4G2PA 5GPGA 3O5DA 3CHCA 5BXJA 2WM0A 2Y78A 2LKNA 4P8XA 1H0GA 2RSEA 3MQGA 3M85A 4MSPA 1E6PA 4DRKA 2RUCA 4N19A 4ODNA 4ZPTR 5HWCA 5HKGA 2M3OW 3UI4A 4UDMA 2FAPA 4JFMA 2DSUA 1FKKA 2MLXA 2IF4A 3CGNA 3ARXA 1GRJA 1FKLA 4HBOA 1C9HA 1M5YA 2ZQUA 3ARPA 1JCHB 1FKTA 3CGMA 3ALFA 2PV2A 3O5FA 3PR9A 3G6LA 4QIBA 2F21A 3CHFA 4DRJA 1JMQA 2WAEA 1J4IA 4DIPA 5HW7A 4C02B 3WD4A 4DT4A 1W1PA 2LJ4A 3WL0A 1D7HA 1KT1A 4WKFA 3RGCA 4TYOA 3O5EA 3AS0A 2YSHA 1WNOA 1QPFA 4JFIA 1GOIA 4DRQA 4W9OA 4G50A 2XP8A 1LL6A 4W9PA 3TDBA 3G6MA 3UQIA 2MLYA 2B31A 3LE4A 3ARQA 2ITKA 1Q1CA 3TCZA 3FSBA 4LAWA 1TFVA 4REXA 2YSBA 2AWGA 2PPOA 3ODKA 2WK2A 2XP4A 2EZ5W 1QPLA 2KI3A 1ROTA 3B8SA 2L4JA 3JYMA 1W1VA 4Z2LA 1LG1A 3WD2A 3MCBA 3ARWA 1O6WA 2JXWA 2QRVA 5DO2A 1JNSA 3UQBA 3ARYA 3ARZA 2JX8A 1E6ZA 1ZB5A 1BL4A 4P8VA 3L4HA 4P8WA 2ETNA 2F4EA 4MNKA 2LPVA 1GPFA 3CHDA 3KCEA 3UF8A 4J4OA 5I98A 1QZ2A 2XP7A 2PN0A 3O5PA 2RURA 1IX5A 2LGOA 4TNSA 4WIWA 1W9PA 4LAVA 3FSCA 2XPBA 4IT4A 3PRBA 3AS3A 1FKGA 2OLHA 2PI6A 2ZQVA 2DPEA 4Q22A 3IHZA 4ZS6A 3O5IA 4LAXA 4GIVA 3PRAA 1ZBKA 2DT0A 3WQWA 1FKRA 1EQ3A 2N87A 1OGGA 3O5RA 3NTPA 1ITXA 1WMVA 1UR9A 3BXWA 2DG9A 3B9DA 2E45A 1FAPA 2DG4A 1RD6A 2XP9A 2RQSA 3VAWA 1J4RA 3ARSA 2YSFA 3WQVA 1FLCA 1KT0A 3FAPA 4MAVA 1X6NA 4ZPVR 3I6CA 4GLXA 1EIBA 1Y0OA 3IKDA 4Z2KA 1FKFA 5DIVA 1OWQA 1FD9A 3B7XA 4ODLA 1PBKA 5AHTA 2DT3A 2F23A 5B8IC 1H0IA 2L2SA 4DZ2A 1SR0A 3LUOA 1LG2A 1ZCNA 5E65A 5GPRA 2KO7A 2LAJA 3WKZA 2ZQSA 2XP5A 1W9VA 5HTGA 4HBEA 4IQCA 2VCDA 1FJDA 4IPXA 4LGXA 3ARVA 1Q6UA 3EIPA 2Q5AA 4KQZA 4DWSB 2MPHA 1NMWA 1D7IA 1ZBWA 3OOBA 3KACA 1J4HA 1SYTA 2JMFA 1HKJA 2FKEA 2VN1A 4TX0A 4FN2A 2O92A 3IKGA 4U85A 2KR7A 3WD1A 3O5MA 4U86A 3KAHA 1JNEA 2WLYA 2M08A 3AS1A 3O5OA 1VF8A 4TW7A 2MLZA 2ZR4A 2DG3A 3CH9A 3KAFA 1E9LA 4IQ2A 1E6RA 1HKIA 5DIUA 1FFRA 3PQHA 5D75A 3KABA 2JV4A 1GUVA 3CNGA 1WB0A 2WADA 5E5WA 5HWBA 4JFJA 4MGVA 3LKXB 2KGJA 4KR0B 4U84A 5DEZA 5CQ2A 1LL4A 3PRDA 2MNTA 2PPNA 3WL1A 5E66A 1EYMA 1JNDA 4R5EA 3RFWA 3WD0A 3JYJA 3AROA 1NWSA 1FKSA 1HJXA 1ZU8A 2O9OA 2WLZA 5J6EA 4QT3A 3O5GA 2D9FA 4MTVA 4NNRA 2RUQA 1D7JA 2YBTA 2ESCA 1FKJA 1HJWA 2B5UB 3OA5A 1EDQA 2XP3A 2XP6A 1EHNA 1X6LA 3M7NA 4O2TA 4ODMA 2ZQTA 1JNTA 1ZBVA 4QT2A 1LQ0A 1ZK6A 1D2KA 3CZ8A 4ML4A 2JZVA 2G8ZA 2DK7A 5U47A 4A0UA 4NSBA 3O5QA 4R0XA 3LKXA 2M8IA 1U79A 3KAGA 4NZCA 2Y8NB 3FS8A 2RE3A 1JVWA 5JH8A 1WR7A 3MQHA 3RM4A 3IK8A 1K9TA 1HKKA 3KADA 4MNLA 1LL7A 3O5KA 3KZ7A 2DT1A 4WJXA 1NMVA 1W26A 2DJYA 1ZL1A 4MNMA 4JYSA 3WH0A 1Q6HA 4MPKA 5HBFA 1B6CA 3EY6A 3AS2A 5GQBA 2ZR6A 1W1YA 4DWSA 1XRVA 2P4VA 3ARTA 2MF9A 4JFLA 5E64A 1HXVA 3O5LA 2MDIA 4S3JA 4Z2GA 3UQAA 2A3EA 4ODKA 1TK7A 2DWVA 4ODOA 4IT6A 4W9QA 1YATA 4GGQA 1NWUA 3NI6A 1KFWA 3RMEA 4WKAA 1NWRA 1J6YA 4MNJA 5HUAA 3KAIA 1FKIA 3GPKA 3RM8A 2ZR5A 3AQUA 4DRMA 1TR8A 2EULA 2YAJB 2A3AA 2FDMA 1P5QA 1NSGA 2AOSA 3UI5A 2PPPA 1N1AA 3NRKA 1PINA 1RP5A 4DRNA 4Q7NA 3WD3A 1OGBA 1NH6A 4PTMA 2KXQA 1TCOC 4DRIA 2UZ5A 3MCBB 1UR8A 3ARRA 3UI6A 3O5JA 4DRHA 2DSWA 4DWSC 2A3BA 4A0TA 1Q6IA 1BKFA 4DROA 2DSVA 4L3NA 1E6NA 5HW6A 5DF0A 1ROUA 4FAPA 1EG3A 2OFNA 2PV1A 4S3KA 4DWSD 2M2AA 1K9RA 1HKMA
chains in the Genus database with same CATH topology
3JXVA 2K8IA 4W5UA 2F2DA 2M8JA 1W1TA 1FFQA 2DK1A 1I5HW 2YSGA 1FKBA 2KFWA 4DRPA 4URIA 3B9EA 4HARA 4E5RA 1XHGA 2RUDA 1HJVA 2M1IA 4ODPA 1R9HA 4DH0A 2DMVA 3PA7A 3RM9A 1NWTA 1YW5A 1CTNA 1FKDA 4ZPWR 4J4NA 4DZ3A 1O6IA 4QZVB 5HW8A 5HT1A 4TW8A 4AY1A 1A7XA 3H9RB 1D6OA 4Z2HA 1E15A 3MDYB 1F40A 2DT2A 4BF8A 1FKHA 2KE0A 3W4RA 3FY1A 4ITZA 1LJYA 2BA1A 4WKHA 3ALGA 5E62A 3TC5A 2ZAJA 1K9QA 4XAKA 4ODRA 5DITA 2PBCA 1L1PA 3CHEA 2OWOA 4WK9A 2G41A 4ODQA 4TW6A 1T11A 2QF8A 2YSIA 1WAWA 3QOKA 4L72B 3FXYA 3ARUA 2A3CA 1EG4A 3WIJA 1F8AB 2PV3A 2XPAA 4Z2IA 2DSZA 2IUZA 1W9UA 4JFKA 2YBUA 4Z2JA 4LAYA 3B9AA 1ZBCA 4P8UA 4G2PA 5GPGA 3O5DA 3CHCA 5BXJA 2WM0A 2Y78A 2LKNA 4P8XA 1H0GA 2RSEA 3MQGA 3M85A 4MSPA 1E6PA 4DRKA 2RUCA 4N19A 4ODNA 4ZPTR 5HWCA 5HKGA 2M3OW 3UI4A 2FAPA 4JFMA 2DSUA 1FKKA 2MLXA 2IF4A 3CGNA 3ARXA 4HBOA 1FKLA 1C9HA 1M5YA 2ZQUA 3ARPA 1FKTA 3CGMA 3ALFA 2PV2A 3O5FA 3PR9A 3G6LA 4QIBA 2F21A 3CHFA 4DRJA 1JMQA 2WAEA 1J4IA 4DIPA 5HW7A 4C02B 3WD4A 4DT4A 1W1PA 2LJ4A 3WL0A 1D7HA 1KT1A 4WKFA 3RGCA 4TYOA 3O5EA 3AS0A 2YSHA 1WNOA 1QPFA 4JFIA 1GOIA 4DRQA 4W9OA 4G50A 2XP8A 1LL6A 4W9PA 3TDBA 3G6MA 3UQIA 2MLYA 2B31A 3LE4A 3ARQA 2ITKA 1Q1CA 3TCZA 3FSBA 4LAWA 1TFVA 4REXA 2YSBA 2AWGA 2PPOA 3ODKA 2WK2A 2XP4A 2EZ5W 1QPLA 2KI3A 1ROTA 3B8SA 2L4JA 3JYMA 1W1VA 4Z2LA 1LG1A 3WD2A 3MCBA 3ARWA 1O6WA 2JXWA 2QRVA 5DO2A 1JNSA 3UQBA 3ARYA 3ARZA 2JX8A 1E6ZA 1ZB5A 1BL4A 4P8VA 3L4HA 4P8WA 2F4EA 4MNKA 2LPVA 1GPFA 3CHDA 3KCEA 3UF8A 4J4OA 5I98A 1QZ2A 2XP7A 3O5PA 2RURA 1IX5A 2LGOA 4TNSA 4WIWA 1W9PA 4LAVA 3FSCA 2XPBA 4IT4A 3PRBA 3AS3A 1FKGA 2OLHA 2PI6A 2ZQVA 2DPEA 4Q22A 3IHZA 4ZS6A 3O5IA 4LAXA 4GIVA 3PRAA 1ZBKA 2DT0A 3WQWA 1FKRA 1EQ3A 2N87A 1OGGA 3O5RA 3NTPA 1ITXA 1WMVA 1UR9A 3BXWA 2DG9A 3B9DA 2E45A 1FAPA 2DG4A 1RD6A 2XP9A 2RQSA 3VAWA 1J4RA 3ARSA 2YSFA 3WQVA 1FLCA 1KT0A 3FAPA 4MAVA 1X6NA 4ZPVR 3I6CA 4GLXA 1EIBA 1Y0OA 3IKDA 4Z2KA 1FKFA 5DIVA 1OWQA 1FD9A 3B7XA 4ODLA 1PBKA 5AHTA 2DT3A 5B8IC 1H0IA 2L2SA 4DZ2A 1SR0A 3LUOA 1LG2A 1ZCNA 5E65A 5GPRA 2KO7A 2LAJA 3WKZA 2ZQSA 2XP5A 1W9VA 5HTGA 4HBEA 4IQCA 2VCDA 1FJDA 4IPXA 4LGXA 3ARVA 1Q6UA 2Q5AA 4KQZA 4DWSB 2MPHA 1NMWA 1D7IA 1ZBWA 3OOBA 3KACA 1J4HA 1SYTA 2JMFA 1HKJA 2FKEA 2VN1A 4TX0A 4FN2A 2O92A 3IKGA 4U85A 2KR7A 3WD1A 3O5MA 4U86A 3AS1A 3KAHA 1JNEA 2M08A 2WLYA 3O5OA 1VF8A 4TW7A 2MLZA 2ZR4A 2DG3A 3CH9A 3KAFA 1E9LA 4IQ2A 1E6RA 1HKIA 5DIUA 1FFRA 3PQHA 5D75A 3KABA 2JV4A 1GUVA 3CNGA 1WB0A 2WADA 5E5WA 5HWBA 4JFJA 4MGVA 3LKXB 2KGJA 4KR0B 4U84A 5DEZA 5CQ2A 1LL4A 3PRDA 2MNTA 2PPNA 3WL1A 5E66A 1EYMA 1JNDA 4R5EA 3RFWA 3WD0A 3JYJA 3AROA 1NWSA 1FKSA 1HJXA 1ZU8A 2O9OA 2WLZA 5J6EA 4QT3A 3O5GA 2D9FA 4MTVA 4NNRA 2RUQA 1D7JA 2YBTA 2ESCA 1FKJA 1HJWA 3OA5A 1EDQA 2XP3A 2XP6A 1EHNA 1X6LA 3M7NA 4O2TA 4ODMA 2ZQTA 1JNTA 1ZBVA 4QT2A 1LQ0A 1ZK6A 1D2KA 3CZ8A 4ML4A 2JZVA 2G8ZA 2DK7A 5U47A 4A0UA 4NSBA 3O5QA 4R0XA 3LKXA 2M8IA 1U79A 3KAGA 4NZCA 2Y8NB 3FS8A 2RE3A 1JVWA 5JH8A 1WR7A 3MQHA 3RM4A 3IK8A 1K9TA 1HKKA 3KADA 4MNLA 1LL7A 3O5KA 3KZ7A 2DT1A 4WJXA 1NMVA 1W26A 2DJYA 1ZL1A 4MNMA 4JYSA 3WH0A 1Q6HA 4MPKA 5HBFA 1B6CA 3EY6A 3AS2A 5GQBA 2ZR6A 1W1YA 4DWSA 1XRVA 3ARTA 2MF9A 4JFLA 5E64A 1HXVA 3O5LA 2MDIA 4S3JA 4Z2GA 3UQAA 2A3EA 4ODKA 1TK7A 2DWVA 4ODOA 4IT6A 4W9QA 1YATA 4GGQA 1NWUA 3NI6A 1KFWA 3RMEA 4WKAA 1NWRA 1J6YA 4MNJA 5HUAA 3KAIA 1FKIA 3GPKA 3RM8A 2ZR5A 3AQUA 4DRMA 1TR8A 2YAJB 2A3AA 2FDMA 1P5QA 1NSGA 2AOSA 3UI5A 2PPPA 1N1AA 3NRKA 1PINA 1RP5A 4DRNA 4Q7NA 3WD3A 1OGBA 1NH6A 4PTMA 2KXQA 1TCOC 4DRIA 2UZ5A 3MCBB 1UR8A 3ARRA 3UI6A 3O5JA 4DRHA 2DSWA 4DWSC 2A3BA 4A0TA 1Q6IA 1BKFA 4DROA 2DSVA 4L3NA 1E6NA 5HW6A 5DF0A 1ROUA 4FAPA 1EG3A 2OFNA 2PV1A 4S3KA 4DWSD 2M2AA 1K9RA 1HKMA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3JYJ A;  1M5Y A;  3JXV A;  2ZQU A;  1FKS A;  1FKR A;  1FKT A;  2K8I A;  1EQ3 A;  3CGM A;  2N87 A;  5J6E A;  2F2D A;  4QT3 A;  3O5G A;  2M8J A;  3O5R A;  3NTP A;  2D9F A;  1WMV A;  4ODR A;  2DK1 A;  1I5H W;  2DG9 A;  2YSG A;  2PV2 A;  2E45 A;  1FAP A;  1FKB A;  3O5F A;  4NNR A;  2RUQ A;  2KFW A;  1D7J A;  4DRP A;  4QIB A;  2DG4 A;  2XP9 A;  2RQS A;  4E5R A;  1J4R A;  3VAW A;  2RUD A;  2F21 A;  1FKJ A;  4DRJ A;  1JMQ A;  1J4I A;  2M1I A;  4ODP A;  2YSF A;  1R9H A;  2XP3 A;  2XP6 A;  4DIP A;  4DH0 A;  2DMV A;  3M7N A;  1KT0 A;  3PA7 A;  4O2T A;  4ODM A;  5HW7 A;  4C02 B;  2ZQT A;  1JNT A;  1YW5 A;  3FAP A;  4DT4 A;  4QT2 A;  2LJ4 A;  1ZK6 A;  1D7H A;  1KT1 A;  3CGN A;  3I6C A;  1FKD A;  2JZV A;  1Y0O A;  3IKD A;  4TYO A;  3RGC A;  3O5E A;  2DK7 A;  1FKF A;  3O5Q A;  4J4N A;  4R0X A;  5DIV A;  4DZ3 A;  2M8I A;  1FD9 A;  2YSH A;  3B7X A;  1U79 A;  1QPF A;  1PBK A;  4JFI A;  4ODL A;  3KAG A;  4TW8 A;  5HT1 A;  4DRQ A;  5HW8 A;  4W9O A;  4G50 A;  2XP8 A;  1A7X A;  3H9R B;  2RE3 A;  1JVW A;  4W9P A;  1WR7 A;  3TDB A;  5B8I C;  2L2S A;  3UQI A;  4DZ2 A;  1D6O A;  3LUO A;  2IF4 A;  2MLY A;  3IK8 A;  3LE4 A;  1ZCN A;  3KAD A;  3MDY B;  1F40 A;  2KO7 A;  4BF8 A;  3O5K A;  2ITK A;  1Q1C A;  3KZ7 A;  2LAJ A;  1FKH A;  1NMV A;  3TCZ A;  2KE0 A;  1W26 A;  4LAW A;  2ZQS A;  2XP5 A;  4REX A;  5HTG A;  2DJY A;  4ITZ A;  2BA1 A;  4IQC A;  2VCD A;  2YSB A;  4JYS A;  3WH0 A;  1Q6H A;  2AWG A;  2PPO A;  3ODK A;  1B6C A;  4IPX A;  1FJD A;  3EY6 A;  3TC5 A;  2ZAJ A;  2XP4 A;  2ZR6 A;  1K9Q A;  2EZ5 W;  2Q5A A;  1Q6U A;  1QPL A;  1ROT A;  2KI3 A;  2MPH A;  1NMW A;  1D7I A;  2L4J A;  2MF9 A;  2PBC A;  4JFL A;  5DIT A;  3JYM A;  1L1P A;  3OOB A;  3KAC A;  1J4H A;  1HXV A;  4ODQ A;  2JMF A;  2MDI A;  3O5L A;  4TW6 A;  3UQA A;  2FKE A;  1T11 A;  4ODK A;  1TK7 A;  2YSI A;  2DWV A;  1O6W A;  2JXW A;  2VN1 A;  4ODO A;  4TX0 A;  4W9Q A;  1YAT A;  4FN2 A;  4GGQ A;  3IKG A;  4U85 A;  3NI6 A;  3UQB A;  2KR7 A;  1J6Y A;  1EG4 A;  2JX8 A;  3KAH A;  1F8A B;  4U86 A;  2M08 A;  2PV3 A;  1BL4 A;  3O5M A;  3O5O A;  2XPA A;  3L4H A;  3KAI A;  1FKI A;  3GPK A;  5HUA A;  4JFK A;  2ZR5 A;  4TW7 A;  2MLZ A;  2ZR4 A;  4DRM A;  2DG3 A;  4LAY A;  2F4E A;  1JNS A;  2LPV A;  1P5Q A;  1NSG A;  3KAF A;  3KCE A;  3UF8 A;  4IQ2 A;  3UI5 A;  4J4O A;  5I98 A;  4G2P A;  2PPP A;  1QZ2 A;  1N1A A;  3NRK A;  1PIN A;  5GPG A;  4DRN A;  5DIU A;  2XP7 A;  5D75 A;  3O5P A;  2RUR A;  3KAB A;  2JV4 A;  2M2A A;  2LGO A;  3O5D A;  5BXJ A;  2KXQ A;  4TNS A;  1TCO C;  4DRI A;  3CNG A;  2UZ5 A;  4LAV A;  2Y78 A;  2LKN A;  3UI6 A;  2XPB A;  3O5J A;  2RSE A;  4DRH A;  5HWB A;  3PRB A;  4JFJ A;  3M85 A;  4MGV A;  4MSP A;  1Q6I A;  2RUC A;  1FKG A;  4N19 A;  1BKF A;  4ODN A;  4DRK A;  5HKG A;  5HWC A;  2M3O W;  3UI4 A;  2KGJ A;  4DRO A;  2ZQV A;  4U84 A;  5HW6 A;  3IHZ A;  5CQ2 A;  1ROU A;  2FAP A;  1EG3 A;  2MNT A;  3PRD A;  2OFN A;  4JFM A;  2PV1 A;  4FAP A;  2PPN A;  3O5I A;  1EYM A;  1FKK A;  4LAX A;  3RFW A;  2MLX A;  4GIV A;  5AHT A;  1K9R A;  1FKL A;  1C9H A; 
#chains in the Genus database with same CATH topology
 3JXV A;  2K8I A;  4W5U A;  2F2D A;  2M8J A;  1W1T A;  1FFQ A;  2DK1 A;  1I5H W;  2YSG A;  1FKB A;  2KFW A;  4DRP A;  4URI A;  3B9E A;  4HAR A;  4E5R A;  1XHG A;  2RUD A;  1HJV A;  2M1I A;  4ODP A;  1R9H A;  4DH0 A;  2DMV A;  3PA7 A;  3RM9 A;  1NWT A;  1YW5 A;  1CTN A;  1FKD A;  4ZPW R;  4J4N A;  4DZ3 A;  1O6I A;  4QZV B;  5HW8 A;  5HT1 A;  4TW8 A;  4AY1 A;  1A7X A;  3H9R B;  1D6O A;  4Z2H A;  1E15 A;  3MDY B;  1F40 A;  2DT2 A;  4BF8 A;  1FKH A;  2KE0 A;  3W4R A;  3FY1 A;  4ITZ A;  1LJY A;  2BA1 A;  4WKH A;  3ALG A;  5E62 A;  3TC5 A;  3GU0 A;  2ZAJ A;  1K9Q A;  4XAK A;  4ODR A;  5DIT A;  2PBC A;  1L1P A;  3CHE A;  2OWO A;  4WK9 A;  2G41 A;  4ODQ A;  4TW6 A;  1T11 A;  2QF8 A;  2YSI A;  1WAW A;  3BMB A;  3QOK A;  4L72 B;  1E44 A;  3GTY X;  3FXY A;  3ARU A;  2A3C A;  1EG4 A;  3WIJ A;  1F8A B;  2PV3 A;  2XPA A;  4Z2I A;  2DSZ A;  2IUZ A;  1W9U A;  4JFK A;  2YBU A;  4Z2J A;  4LAY A;  3B9A A;  1ZBC A;  4P8U A;  4G2P A;  5GPG A;  3O5D A;  3CHC A;  5BXJ A;  2WM0 A;  2Y78 A;  2LKN A;  4P8X A;  1H0G A;  2RSE A;  3MQG A;  3M85 A;  4MSP A;  1E6P A;  4DRK A;  2RUC A;  4N19 A;  4ODN A;  4ZPT R;  5HWC A;  5HKG A;  2M3O W;  3UI4 A;  4UDM A;  2FAP A;  4JFM A;  2DSU A;  1FKK A;  2MLX A;  2IF4 A;  3CGN A;  3ARX A;  1GRJ A;  1FKL A;  4HBO A;  1C9H A;  1M5Y A;  2ZQU A;  3ARP A;  1JCH B;  1FKT A;  3CGM A;  3ALF A;  2PV2 A;  3O5F A;  3PR9 A;  3G6L A;  4QIB A;  2F21 A;  3CHF A;  4DRJ A;  1JMQ A;  2WAE A;  1J4I A;  4DIP A;  5HW7 A;  4C02 B;  3WD4 A;  4DT4 A;  1W1P A;  2LJ4 A;  3WL0 A;  1D7H A;  1KT1 A;  4WKF A;  3RGC A;  4TYO A;  3O5E A;  3AS0 A;  2YSH A;  1WNO A;  1QPF A;  4JFI A;  1GOI A;  4DRQ A;  4W9O A;  4G50 A;  2XP8 A;  1LL6 A;  4W9P A;  3TDB A;  3G6M A;  3UQI A;  2MLY A;  2B31 A;  3LE4 A;  3ARQ A;  2ITK A;  1Q1C A;  3TCZ A;  3FSB A;  4LAW A;  1TFV A;  4REX A;  2YSB A;  2AWG A;  2PPO A;  3ODK A;  2WK2 A;  2XP4 A;  2EZ5 W;  1QPL A;  2KI3 A;  1ROT A;  3B8S A;  2L4J A;  3JYM A;  1W1V A;  4Z2L A;  1LG1 A;  3WD2 A;  3MCB A;  3ARW A;  1O6W A;  2JXW A;  2QRV A;  5DO2 A;  1JNS A;  3UQB A;  3ARY A;  3ARZ A;  2JX8 A;  1E6Z A;  1ZB5 A;  1BL4 A;  4P8V A;  3L4H A;  4P8W A;  2ETN A;  2F4E A;  4MNK A;  2LPV A;  1GPF A;  3CHD A;  3KCE A;  3UF8 A;  4J4O A;  5I98 A;  1QZ2 A;  2XP7 A;  2PN0 A;  3O5P A;  2RUR A;  1IX5 A;  2LGO A;  4TNS A;  4WIW A;  1W9P A;  4LAV A;  3FSC A;  2XPB A;  4IT4 A;  3PRB A;  3AS3 A;  1FKG A;  2OLH A;  2PI6 A;  2ZQV A;  2DPE A;  4Q22 A;  3IHZ A;  4ZS6 A;  3O5I A;  4LAX A;  4GIV A;  3PRA A;  1ZBK A;  2DT0 A;  3WQW A;  1FKR A;  1EQ3 A;  2N87 A;  1OGG A;  3O5R A;  3NTP A;  1ITX A;  1WMV A;  1UR9 A;  3BXW A;  2DG9 A;  3B9D A;  2E45 A;  1FAP A;  2DG4 A;  1RD6 A;  2XP9 A;  2RQS A;  3VAW A;  1J4R A;  3ARS A;  2YSF A;  3WQV A;  1FLC A;  1KT0 A;  3FAP A;  4MAV A;  1X6N A;  4ZPV R;  3I6C A;  4GLX A;  1EIB A;  1Y0O A;  3IKD A;  4Z2K A;  1FKF A;  5DIV A;  1OWQ A;  1FD9 A;  3B7X A;  4ODL A;  1PBK A;  5AHT A;  2DT3 A;  2F23 A;  5B8I C;  1H0I A;  2L2S A;  4DZ2 A;  1SR0 A;  3LUO A;  1LG2 A;  1ZCN A;  5E65 A;  5GPR A;  2KO7 A;  2LAJ A;  3WKZ A;  2ZQS A;  2XP5 A;  1W9V A;  5HTG A;  4HBE A;  4IQC A;  2VCD A;  1FJD A;  4IPX A;  4LGX A;  3ARV A;  1Q6U A;  3EIP A;  2Q5A A;  4KQZ A;  4DWS B;  2MPH A;  1NMW A;  1D7I A;  1ZBW A;  3OOB A;  3KAC A;  1J4H A;  1SYT A;  2JMF A;  1HKJ A;  2FKE A;  2VN1 A;  4TX0 A;  4FN2 A;  2O92 A;  3IKG A;  4U85 A;  2KR7 A;  3WD1 A;  3O5M A;  4U86 A;  3KAH A;  1JNE A;  2WLY A;  2M08 A;  3AS1 A;  3O5O A;  1VF8 A;  4TW7 A;  2MLZ A;  2ZR4 A;  2DG3 A;  3CH9 A;  3KAF A;  1E9L A;  4IQ2 A;  1E6R A;  1HKI A;  5DIU A;  1FFR A;  3PQH A;  5D75 A;  3KAB A;  2JV4 A;  1GUV A;  3CNG A;  1WB0 A;  2WAD A;  5E5W A;  5HWB A;  4JFJ A;  4MGV A;  3LKX B;  2KGJ A;  4KR0 B;  4U84 A;  5DEZ A;  5CQ2 A;  1LL4 A;  3PRD A;  2MNT A;  2PPN A;  3WL1 A;  5E66 A;  1EYM A;  1JND A;  4R5E A;  3RFW A;  3WD0 A;  3JYJ A;  3ARO A;  1NWS A;  1FKS A;  1HJX A;  1ZU8 A;  2O9O A;  2WLZ A;  5J6E A;  4QT3 A;  3O5G A;  2D9F A;  4MTV A;  4NNR A;  2RUQ A;  1D7J A;  2YBT A;  2ESC A;  1FKJ A;  1HJW A;  2B5U B;  3OA5 A;  1EDQ A;  2XP3 A;  2XP6 A;  1EHN A;  1X6L A;  3M7N A;  4O2T A;  4ODM A;  2ZQT A;  1JNT A;  1ZBV A;  4QT2 A;  1LQ0 A;  1ZK6 A;  1D2K A;  3CZ8 A;  4ML4 A;  2JZV A;  2G8Z A;  2DK7 A;  5U47 A;  4A0U A;  4NSB A;  3O5Q A;  4R0X A;  3LKX A;  2M8I A;  1U79 A;  3KAG A;  4NZC A;  2Y8N B;  3FS8 A;  2RE3 A;  1JVW A;  5JH8 A;  1WR7 A;  3MQH A;  3RM4 A;  3IK8 A;  1K9T A;  1HKK A;  3KAD A;  4MNL A;  1LL7 A;  3O5K A;  3KZ7 A;  2DT1 A;  4WJX A;  1NMV A;  1W26 A;  2DJY A;  1ZL1 A;  4MNM A;  4JYS A;  3WH0 A;  1Q6H A;  4MPK A;  5HBF A;  1B6C A;  3EY6 A;  3AS2 A;  5GQB A;  2ZR6 A;  1W1Y A;  4DWS A;  1XRV A;  2P4V A;  3ART A;  2MF9 A;  4JFL A;  5E64 A;  1HXV A;  3O5L A;  2MDI A;  4S3J A;  4Z2G A;  3UQA A;  2A3E A;  4ODK A;  1TK7 A;  2DWV A;  4ODO A;  4IT6 A;  4W9Q A;  1YAT A;  4GGQ A;  1NWU A;  3NI6 A;  1KFW A;  3RME A;  4WKA A;  1NWR A;  1J6Y A;  4MNJ A;  5HUA A;  3KAI A;  1FKI A;  3GPK A;  3RM8 A;  2ZR5 A;  3AQU A;  4DRM A;  1TR8 A;  2EUL A;  2YAJ B;  2A3A A;  2FDM A;  1P5Q A;  1NSG A;  2AOS A;  3UI5 A;  2PPP A;  1N1A A;  3NRK A;  1PIN A;  1RP5 A;  4DRN A;  4Q7N A;  3WD3 A;  1OGB A;  1NH6 A;  4PTM A;  2KXQ A;  1TCO C;  4DRI A;  2UZ5 A;  3MCB B;  1UR8 A;  3ARR A;  3UI6 A;  3O5J A;  4DRH A;  2DSW A;  4DWS C;  2A3B A;  4A0T A;  1Q6I A;  1BKF A;  4DRO A;  2DSV A;  4L3N A;  1E6N A;  5HW6 A;  5DF0 A;  1ROU A;  4FAP A;  1EG3 A;  2OFN A;  2PV1 A;  4S3K A;  4DWS D;  2M2A A;  1K9R A;  1HKM A; 
#chains in the Genus database with same CATH homology
 3JXV A;  2K8I A;  4W5U A;  2F2D A;  2M8J A;  1W1T A;  1FFQ A;  2DK1 A;  1I5H W;  2YSG A;  1FKB A;  2KFW A;  4DRP A;  4URI A;  3B9E A;  4HAR A;  4E5R A;  1XHG A;  2RUD A;  1HJV A;  2M1I A;  4ODP A;  1R9H A;  4DH0 A;  2DMV A;  3PA7 A;  3RM9 A;  1NWT A;  1YW5 A;  1CTN A;  1FKD A;  4ZPW R;  4J4N A;  4DZ3 A;  1O6I A;  4QZV B;  5HW8 A;  5HT1 A;  4TW8 A;  4AY1 A;  1A7X A;  3H9R B;  1D6O A;  4Z2H A;  1E15 A;  3MDY B;  1F40 A;  2DT2 A;  4BF8 A;  1FKH A;  2KE0 A;  3W4R A;  3FY1 A;  4ITZ A;  1LJY A;  2BA1 A;  4WKH A;  3ALG A;  5E62 A;  3TC5 A;  2ZAJ A;  1K9Q A;  4XAK A;  4ODR A;  5DIT A;  2PBC A;  1L1P A;  3CHE A;  2OWO A;  4WK9 A;  2G41 A;  4ODQ A;  4TW6 A;  1T11 A;  2QF8 A;  2YSI A;  1WAW A;  3QOK A;  4L72 B;  3FXY A;  3ARU A;  2A3C A;  1EG4 A;  3WIJ A;  1F8A B;  2PV3 A;  2XPA A;  4Z2I A;  2DSZ A;  2IUZ A;  1W9U A;  4JFK A;  2YBU A;  4Z2J A;  4LAY A;  3B9A A;  1ZBC A;  4P8U A;  4G2P A;  5GPG A;  3O5D A;  3CHC A;  5BXJ A;  2WM0 A;  2Y78 A;  2LKN A;  4P8X A;  1H0G A;  2RSE A;  3MQG A;  3M85 A;  4MSP A;  1E6P A;  4DRK A;  2RUC A;  4N19 A;  4ODN A;  4ZPT R;  5HWC A;  5HKG A;  2M3O W;  3UI4 A;  2FAP A;  4JFM A;  2DSU A;  1FKK A;  2MLX A;  2IF4 A;  3CGN A;  3ARX A;  4HBO A;  1FKL A;  1C9H A;  1M5Y A;  2ZQU A;  3ARP A;  1FKT A;  3CGM A;  3ALF A;  2PV2 A;  3O5F A;  3PR9 A;  3G6L A;  4QIB A;  2F21 A;  3CHF A;  4DRJ A;  1JMQ A;  2WAE A;  1J4I A;  4DIP A;  5HW7 A;  4C02 B;  3WD4 A;  4DT4 A;  1W1P A;  2LJ4 A;  3WL0 A;  1D7H A;  1KT1 A;  4WKF A;  3RGC A;  4TYO A;  3O5E A;  3AS0 A;  2YSH A;  1WNO A;  1QPF A;  4JFI A;  1GOI A;  4DRQ A;  4W9O A;  4G50 A;  2XP8 A;  1LL6 A;  4W9P A;  3TDB A;  3G6M A;  3UQI A;  2MLY A;  2B31 A;  3LE4 A;  3ARQ A;  2ITK A;  1Q1C A;  3TCZ A;  3FSB A;  4LAW A;  1TFV A;  4REX A;  2YSB A;  2AWG A;  2PPO A;  3ODK A;  2WK2 A;  2XP4 A;  2EZ5 W;  1QPL A;  2KI3 A;  1ROT A;  3B8S A;  2L4J A;  3JYM A;  1W1V A;  4Z2L A;  1LG1 A;  3WD2 A;  3MCB A;  3ARW A;  1O6W A;  2JXW A;  2QRV A;  5DO2 A;  1JNS A;  3UQB A;  3ARY A;  3ARZ A;  2JX8 A;  1E6Z A;  1ZB5 A;  1BL4 A;  4P8V A;  3L4H A;  4P8W A;  2F4E A;  4MNK A;  2LPV A;  1GPF A;  3CHD A;  3KCE A;  3UF8 A;  4J4O A;  5I98 A;  1QZ2 A;  2XP7 A;  3O5P A;  2RUR A;  1IX5 A;  2LGO A;  4TNS A;  4WIW A;  1W9P A;  4LAV A;  3FSC A;  2XPB A;  4IT4 A;  3PRB A;  3AS3 A;  1FKG A;  2OLH A;  2PI6 A;  2ZQV A;  2DPE A;  4Q22 A;  3IHZ A;  4ZS6 A;  3O5I A;  4LAX A;  4GIV A;  3PRA A;  1ZBK A;  2DT0 A;  3WQW A;  1FKR A;  1EQ3 A;  2N87 A;  1OGG A;  3O5R A;  3NTP A;  1ITX A;  1WMV A;  1UR9 A;  3BXW A;  2DG9 A;  3B9D A;  2E45 A;  1FAP A;  2DG4 A;  1RD6 A;  2XP9 A;  2RQS A;  3VAW A;  1J4R A;  3ARS A;  2YSF A;  3WQV A;  1FLC A;  1KT0 A;  3FAP A;  4MAV A;  1X6N A;  4ZPV R;  3I6C A;  4GLX A;  1EIB A;  1Y0O A;  3IKD A;  4Z2K A;  1FKF A;  5DIV A;  1OWQ A;  1FD9 A;  3B7X A;  4ODL A;  1PBK A;  5AHT A;  2DT3 A;  5B8I C;  1H0I A;  2L2S A;  4DZ2 A;  1SR0 A;  3LUO A;  1LG2 A;  1ZCN A;  5E65 A;  5GPR A;  2KO7 A;  2LAJ A;  3WKZ A;  2ZQS A;  2XP5 A;  1W9V A;  5HTG A;  4HBE A;  4IQC A;  2VCD A;  1FJD A;  4IPX A;  4LGX A;  3ARV A;  1Q6U A;  2Q5A A;  4KQZ A;  4DWS B;  2MPH A;  1NMW A;  1D7I A;  1ZBW A;  3OOB A;  3KAC A;  1J4H A;  1SYT A;  2JMF A;  1HKJ A;  2FKE A;  2VN1 A;  4TX0 A;  4FN2 A;  2O92 A;  3IKG A;  4U85 A;  2KR7 A;  3WD1 A;  3O5M A;  4U86 A;  3AS1 A;  3KAH A;  1JNE A;  2M08 A;  2WLY A;  3O5O A;  1VF8 A;  4TW7 A;  2MLZ A;  2ZR4 A;  2DG3 A;  3CH9 A;  3KAF A;  1E9L A;  4IQ2 A;  1E6R A;  1HKI A;  5DIU A;  1FFR A;  3PQH A;  5D75 A;  3KAB A;  2JV4 A;  1GUV A;  3CNG A;  1WB0 A;  2WAD A;  5E5W A;  5HWB A;  4JFJ A;  4MGV A;  3LKX B;  2KGJ A;  4KR0 B;  4U84 A;  5DEZ A;  5CQ2 A;  1LL4 A;  3PRD A;  2MNT A;  2PPN A;  3WL1 A;  5E66 A;  1EYM A;  1JND A;  4R5E A;  3RFW A;  3WD0 A;  3JYJ A;  3ARO A;  1NWS A;  1FKS A;  1HJX A;  1ZU8 A;  2O9O A;  2WLZ A;  5J6E A;  4QT3 A;  3O5G A;  2D9F A;  4MTV A;  4NNR A;  2RUQ A;  1D7J A;  2YBT A;  2ESC A;  1FKJ A;  1HJW A;  3OA5 A;  1EDQ A;  2XP3 A;  2XP6 A;  1EHN A;  1X6L A;  3M7N A;  4O2T A;  4ODM A;  2ZQT A;  1JNT A;  1ZBV A;  4QT2 A;  1LQ0 A;  1ZK6 A;  1D2K A;  3CZ8 A;  4ML4 A;  2JZV A;  2G8Z A;  2DK7 A;  5U47 A;  4A0U A;  4NSB A;  3O5Q A;  4R0X A;  3LKX A;  2M8I A;  1U79 A;  3KAG A;  4NZC A;  2Y8N B;  3FS8 A;  2RE3 A;  1JVW A;  5JH8 A;  1WR7 A;  3MQH A;  3RM4 A;  3IK8 A;  1K9T A;  1HKK A;  3KAD A;  4MNL A;  1LL7 A;  3O5K A;  3KZ7 A;  2DT1 A;  4WJX A;  1NMV A;  1W26 A;  2DJY A;  1ZL1 A;  4MNM A;  4JYS A;  3WH0 A;  1Q6H A;  4MPK A;  5HBF A;  1B6C A;  3EY6 A;  3AS2 A;  5GQB A;  2ZR6 A;  1W1Y A;  4DWS A;  1XRV A;  3ART A;  2MF9 A;  4JFL A;  5E64 A;  1HXV A;  3O5L A;  2MDI A;  4S3J A;  4Z2G A;  3UQA A;  2A3E A;  4ODK A;  1TK7 A;  2DWV A;  4ODO A;  4IT6 A;  4W9Q A;  1YAT A;  4GGQ A;  1NWU A;  3NI6 A;  1KFW A;  3RME A;  4WKA A;  1NWR A;  1J6Y A;  4MNJ A;  5HUA A;  3KAI A;  1FKI A;  3GPK A;  3RM8 A;  2ZR5 A;  3AQU A;  4DRM A;  1TR8 A;  2YAJ B;  2A3A A;  2FDM A;  1P5Q A;  1NSG A;  2AOS A;  3UI5 A;  2PPP A;  1N1A A;  3NRK A;  1PIN A;  1RP5 A;  4DRN A;  4Q7N A;  3WD3 A;  1OGB A;  1NH6 A;  4PTM A;  2KXQ A;  1TCO C;  4DRI A;  2UZ5 A;  3MCB B;  1UR8 A;  3ARR A;  3UI6 A;  3O5J A;  4DRH A;  2DSW A;  4DWS C;  2A3B A;  4A0T A;  1Q6I A;  1BKF A;  4DRO A;  2DSV A;  4L3N A;  1E6N A;  5HW6 A;  5DF0 A;  1ROU A;  4FAP A;  1EG3 A;  2OFN A;  2PV1 A;  4S3K A;  4DWS D;  2M2A A;  1K9R A;  1HKM A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...