3OOBA

Structural and functional insights of directly targeting pin1 by epigallocatechin-3-gallate
Total Genus 49
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
49
sequence length
158
structure length
146
Chain Sequence
KLPPGWEKAMSRSSGRVYYFNHITNASQWERPSEPARVRCSHLLVKHSQSRRPSSWRQEKITRTKEEALELINGYIQKIKSGEEDFESLASQFSDCSSAKARGDLGAFSRGQMQKPFEDASFALRTGEMSGPVFTDSGIHIILRTE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Peptidyl-prolyl cis-trans isomerase NIMA-interacting 1
publication title Epigallocatechin-gallate suppresses tumorigenesis by directly targeting Pin1.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Isomerase
total genus 49
structure length 146
sequence length 158
ec nomenclature ec 5.2.1.8: Peptidylprolyl isomerase.
pdb deposition date 2010-08-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00397 WW WW domain
A PF00639 Rotamase PPIC-type PPIASE domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.20.70.10 Mainly Beta Single Sheet Ubiquitin Ligase Nedd4; Chain: W; Ubiquitin Ligase Nedd4; Chain: W; 3oobA01
3.10.50.40 Alpha Beta Roll Chitinase A; domain 3 Chitinase A; domain 3 3oobA02
3O5KA 2ZQSA 4J4NA 2KO7A 2N87A 2D9FA 1PBKA 2Q5AA 4FAPA 1ROTA 1FJDA 3KABA 4REXA 1BKFA 4DH0A 4E5RA 5HWBA 4TW8A 1FKHA 3FAPA 2KXQA 5J6EA 1J4HA 1QPLA 2LKNA 2M1IA 5CQ2A 3O5FA 2KE0A 4DROA 1K9QA 2RE3A 2YSGA 1U79A 2M8IA 1TK7A 1QPFA 3RGCA 3JYJA 4DRQA 1FKRA 1W26A 2F2DA 3NI6A 4DRKA 2XP6A 2LGOA 5D75A 4U85A 3IHZA 2ZQVA 1ZCNA 2DG3A 5HW6A 4W9PA 3L4HA 3O5DA 1J4RA 2Y78A 4ODMA 2XP7A 4ODOA 1NMWA 2LAJA 2ZQUA 1D7IA 2FAPA 3TCZA 1EG4A 1FKBA 3TC5A 1EG3A 2YSBA 3CGMA 4DRHA 3KADA 3M85A 2KFWA 1FKKA 4QIBA 2DK1A 4IQ2A 2RURA 3O5JA 2F21A 3KAHA 2K8IA 4JFLA 4TW6A 1M5YA 4ODRA 2MLZA 1HXVA 2M8JA 1QZ2A 3NTPA 1EQ3A 4JFIA 1ZK6A 4G50A 4G2PA 4JFKA 2OFNA 3OOBA 2UZ5A 2DWVA 4ODNA 2DG4A 4QT2A 4TYOA 4TX0A 4MSPA 1BL4A 3M7NA 1Y0OA 2XP8A 2MF9A 2JZVA 2ITKA 3TDBA 1FKSA 4C02B 1J6YA 5AHTA 1I5HW 1O6WA 4NNRA 1WR7A 2M2AA 3RFWA 2PBCA 3I6CA 4IQCA 4U84A 4DRIA 1K9RA 4DZ3A 4GGQA 5DIVA 5HTGA 1A7XA 4DIPA 3UQIA 4FN2A 3O5PA 3O5QA 4ODQA 5I98A 3VAWA 1KT1A 1KT0A 2BA1A 2MDIA 4MGVA 2XP3A 2MPHA 4N19A 1R9HA 1YATA 3UI4A 5GPGA 5HUAA 2LJ4A 3PRDA 2JXWA 1JNTA 1Q1CA 3O5RA 4O2TA 3IKGA 2ZAJA 1ROUA 4JFJA 2EZ5W 3EY6A 1N1AA 1TCOC 1FKDA 5HKGA 2AWGA 1Q6HA 4JYSA 1YW5A 2E45A 2JV4A 2ZQTA 3PA7A 2RSEA 2ZR4A 2IF4A 4QT3A 1JVWA 1JNSA 2XP4A 3KACA 1C9HA 3UI5A 3UQAA 3CGNA 1FKFA 5DITA 5B8IC 2RUCA 4LAXA 1WMVA 2MNTA 1FKJA 2PV3A 2DMVA 2DJYA 4BF8A 3NRKA 3KAGA 3O5IA 4GIVA 1FD9A 4TW7A 2XPBA 3O5GA 1D7JA 2ZR6A 1FAPA 2DK7A 4J4OA 4LAYA 2KI3A 3UI6A 3KAFA 4R0XA 2XP9A 1EYMA 2PV2A 3GPKA 1F40A 3ODKA 4JFMA 4DT4A 2RQSA 2YSHA 4ODKA 5HW7A 4W9QA 2RUQA 1P5QA 2JX8A 5HW8A 1NMVA 4DRNA 2VN1A 2FKEA 5HWCA 2YSFA 4IPXA 4TNSA 3JYMA 4ODPA 4DRJA 2L4JA 3UF8A 3KAIA 4DRPA 1JMQA 2VCDA 1Q6IA 1B6CA 2PV1A 3UQBA 2XPAA 2M08A 1T11A 1D6OA 1PINA 1FKIA 1L1PA 3KCEA 2MLXA 4DRMA 1F8AB 4ODLA 4DZ2A 2RUDA 2DG9A 3B7XA 2JMFA 5BXJA 4W9OA 1FKLA 3PRBA 5HT1A 2LPVA 1NSGA 3IKDA 3O5LA 4LAVA 2ZR5A 2PPNA 3CNGA 1FKTA 3KZ7A 3O5MA 3H9RB 2XP5A 2F4EA 1Q6UA 3JXVA 5DIUA 2KR7A 4LAWA 1D7HA 2KGJA 4ITZA 1J4IA 1FKGA 3O5EA 3O5OA 3LE4A 3WH0A 2M3OW 3MDYB 2PPOA 3LUOA 2L2SA 2YSIA 4U86A 2MLYA 3IK8A 2PPPA
chains in the Genus database with same CATH superfamily
3O5KA 1E6PA 2ZQSA 3ARWA 4J4NA 2KO7A 2N87A 4HBOA 1W9UA 2D9FA 4DWSA 2G41A 1PBKA 4MNKA 2Q5AA 4FAPA 1ROTA 1FJDA 1W9VA 3AS0A 3KABA 4REXA 1BKFA 4DH0A 4E5RA 5HWBA 4MNMA 4TW8A 1FKHA 3FAPA 2KXQA 5J6EA 1J4HA 1H0GA 1QPLA 2LKNA 2G8ZA 2M1IA 3RM9A 5CQ2A 1W1YA 2P4VA 3O5FA 1UR8A 3CH9A 4R5EA 3CHDA 3FSBA 2KE0A 4DROA 1K9QA 2RE3A 4L72B 2YSGA 1GOIA 1U79A 2M8IA 1TK7A 1QPFA 2DT1A 3RGCA 3JYJA 4DRQA 1FKRA 4DWSB 1W26A 3EIPA 2F2DA 3NI6A 3BMBA 4NZCA 4WKFA 1JCHB 2XP6A 4DRKA 2ETNA 1LL6A 1GRJA 4U85A 2LGOA 5D75A 3IHZA 1IX5A 2ZQVA 1ZCNA 2DG3A 5HW6A 4W9PA 3L4HA 3O5DA 1J4RA 1HKIA 2IUZA 2Y78A 4WIWA 3WL1A 3B9AA 4ODMA 2XP7A 1W1TA 4ODOA 1NMWA 2LAJA 2ZQUA 1D7IA 2FAPA 3TCZA 1EG4A 1TFVA 3WD2A 1OGBA 1UR9A 1FKBA 3OA5A 3TC5A 1EG3A 2YSBA 3ARPA 3RM4A 1OGGA 3CGMA 4DRHA 1NWSA 3KADA 2KFWA 3M85A 1FKKA 3PRAA 4QIBA 3FSCA 1X6NA 3ARUA 2A3EA 2DK1A 4IQ2A 4WKAA 1GPFA 4Z2KA 2RURA 3O5JA 1HJWA 2DSVA 4Z2GA 3AROA 2F21A 3KAHA 2K8IA 2OWOA 3W4RA 2A3CA 1CTNA 4JFLA 4TW6A 1ZBWA 1M5YA 2YBTA 4ODRA 4ZPVR 2MLZA 1HXVA 2M8JA 1QZ2A 2O92A 3NTPA 1EQ3A 4Z2JA 4JFIA 1ZK6A 4G50A 4G2PA 4JFKA 1SR0A 3ARXA 2OFNA 3OOBA 2Y8NB 4KR0B 2EULA 2UZ5A 2DWVA 1VF8A 1W1PA 4ODNA 2DG4A 4P8VA 4QT2A 4TYOA 1FFRA 4TX0A 4MSPA 1BL4A 5E64A 1E6NA 3CHEA 3M7NA 1Y0OA 2XP8A 2MF9A 2JZVA 2ITKA 4WJXA 3TDBA 1FKSA 4MAVA 4C02B 1J6YA 2DT2A 5AHTA 1I5HW 1EHNA 1O6WA 4ML4A 4NNRA 4MPKA 1WR7A 3G6LA 3WKZA 1LQ0A 2M2AA 3QOKA 3RFWA 4Z2IA 1RD6A 2PBCA 5E62A 3I6CA 4IQCA 4U84A 4DRIA 4A0UA 3ARYA 1JNDA 1K9RA 5E5WA 2QRVA 3IK8A 4DZ3A 1LL7A 4GGQA 1ZBCA 1FFQA 4S3KA 5DIVA 3ARVA 5HTGA 1E44A 1A7XA 2A3AA 3LKXA 3AS2A 3RMEA 4DIPA 4PTMA 4FN2A 3UQIA 1H0IA 3O5PA 1LG2A 2ESCA 3O5QA 4ODQA 5JH8A 1ZBKA 1NWUA 4L3NA 5I98A 1OWQA 3VAWA 4A0TA 1HKMA 1KT1A 2DT3A 2PN0A 1KT0A 5E65A 4URIA 2B5UB 2DSUA 4P8XA 2BA1A 2YBUA 2PI6A 3WL0A 1RP5A 1JNEA 2MDIA 3B9DA 1W1VA 4P8WA 3ALGA 4MGVA 2B31A 1EIBA 1ITXA 2XP3A 3ARQA 2MPHA 3CZ8A 4N19A 1LL4A 1R9HA 3LKXB 3MCBA 1YATA 3UI4A 3AS3A 1D2KA 4MNLA 2LJ4A 3ARZA 2JXWA 3PRDA 5GPGA 1JNTA 5HUAA 3GU0A 1Q1CA 1WNOA 3O5RA 3ARTA 4O2TA 3IKGA 2OLHA 2ZAJA 1ROUA 4JFJA 1E9LA 2EZ5W 4IT6A 2DSZA 3CHCA 3EY6A 1HJXA 3GTYX 1N1AA 1TCOC 1FKDA 5HKGA 2AWGA 3FXYA 3WD1A 1NH6A 1Q6HA 3WQVA 4JYSA 1YW5A 1K9TA 4Q22A 2E45A 1NWTA 2JV4A 2ZQTA 5HBFA 2WM0A 3PA7A 2RSEA 2ZR4A 2IF4A 1GUVA 4XAKA 4QT3A 1JVWA 3B9EA 5E66A 3WIJA 3MQHA 1JNSA 2XP4A 3KACA 2QF8A 4DWSC 1C9HA 3UI5A 4Z2HA 4W5UA 3UQAA 4MNJA 3CGNA 1FKFA 5DITA 5B8IC 2RUCA 1LG1A 4LAXA 1WMVA 2MNTA 4MTVA 1FKJA 2PV3A 2DMVA 4S3JA 2DJYA 4BF8A 3NRKA 3KAGA 2WAEA 4P8UA 3O5IA 4GIVA 1E6ZA 5DF0A 2WLYA 2A3BA 3ALFA 1HKJA 1FD9A 4TW7A 2XPBA 1ZL1A 3BXWA 4Q7NA 1LJYA 3O5GA 1D7JA 5DEZA 2ZR6A 1WAWA 5GPRA 2DT0A 2AOSA 1FAPA 3FS8A 2DK7A 4J4OA 4LAYA 2KI3A 5U47A 3UI6A 3KAFA 4R0XA 2DSWA 2XP9A 4GLXA 1EYMA 1W9PA 3PR9A 2WADA 2PV2A 3GPKA 1F40A 3ODKA 4JFMA 4DT4A 2RQSA 2YSHA 3MQGA 1HKKA 4ODKA 5HW7A 4W9QA 2RUQA 3ARSA 1P5QA 2JX8A 4QZVB 5HW8A 1NMVA 2DPEA 4KQZA 4DRNA 2VN1A 2FKEA 3AQUA 5HWCA 2YSFA 4IPXA 4TNSA 3PQHA 3JYMA 4ODPA 4DRJA 4ZS6A 3RM8A 2L4JA 3UF8A 1EDQA 3KAIA 1TR8A 4DRPA 1JMQA 2VCDA 3WD3A 1Q6IA 1B6CA 2PV1A 3UQBA 1XHGA 1KFWA 5GQBA 4DWSD 2XPAA 4IT4A 3ARRA 2M08A 1T11A 1D6OA 1PINA 1FKIA 1L1PA 2O9OA 1ZU8A 1XRVA 3KCEA 2MLXA 3WD4A 4DRMA 4LGXA 1F8AB 1ZBVA 3FY1A 4WK9A 4ODLA 4DZ2A 2RUDA 2DG9A 3G6MA 3B7XA 4NSBA 2JMFA 4Z2LA 3CHFA 5BXJA 5DO2A 4W9OA 1FKLA 3PRBA 5HT1A 2LPVA 1NSGA 3IKDA 1ZB5A 3O5LA 4LAVA 2YAJB 2ZR5A 3WQWA 2WLZA 4HARA 2PPNA 3B8SA 3CNGA 1FKTA 3KZ7A 4AY1A 3O5MA 3MCBB 1E15A 3H9RB 4ZPTR 2XP5A 1X6LA 2F4EA 4UDMA 1Q6UA 3JXVA 5DIUA 2KR7A 2FDMA 1FLCA 4LAWA 1D7HA 4HBEA 2F23A 3WD0A 3AS1A 1E6RA 2KGJA 4ITZA 1J4IA 1NWRA 1FKGA 3O5EA 1HJVA 3O5OA 3LE4A 3WH0A 2M3OW 3MDYB 4WKHA 1WB0A 2PPOA 3LUOA 4ZPWR 2L2SA 2YSIA 4U86A 1O6IA 2MLYA 2WK2A 2PPPA 1SYTA
chains in the Genus database with same CATH topology
3O5KA 1E6PA 2ZQSA 3ARWA 4J4NA 2KO7A 2N87A 4HBOA 1W9UA 2D9FA 4DWSA 2G41A 1PBKA 4MNKA 2Q5AA 4FAPA 1ROTA 1FJDA 1W9VA 3AS0A 3KABA 4REXA 1BKFA 4DH0A 4E5RA 5HWBA 4MNMA 4TW8A 1FKHA 3FAPA 2KXQA 5J6EA 1J4HA 1H0GA 1QPLA 2LKNA 2G8ZA 2M1IA 3RM9A 5CQ2A 1W1YA 3O5FA 1UR8A 3CH9A 4R5EA 3CHDA 3FSBA 2KE0A 4DROA 1K9QA 2RE3A 4L72B 2YSGA 1GOIA 1U79A 2M8IA 1TK7A 1QPFA 2DT1A 3RGCA 3JYJA 4DRQA 1FKRA 4DWSB 1W26A 2F2DA 3NI6A 4NZCA 4WKFA 4DRKA 2XP6A 1LL6A 2LGOA 4U85A 5D75A 3IHZA 1IX5A 2ZQVA 1ZCNA 2DG3A 5HW6A 4W9PA 3L4HA 3O5DA 1J4RA 1HKIA 2IUZA 2Y78A 4WIWA 3WL1A 3B9AA 4ODMA 2XP7A 1W1TA 4ODOA 1NMWA 2LAJA 2ZQUA 1D7IA 2FAPA 3TCZA 1EG4A 1TFVA 3WD2A 1OGBA 1UR9A 1FKBA 3OA5A 3TC5A 1EG3A 2YSBA 3ARPA 3RM4A 1OGGA 3CGMA 4DRHA 1NWSA 3KADA 2KFWA 3M85A 1FKKA 3PRAA 4QIBA 3FSCA 1X6NA 3ARUA 2A3EA 2DK1A 4IQ2A 4WKAA 1GPFA 4Z2KA 2RURA 3O5JA 1HJWA 2DSVA 4Z2GA 3AROA 2F21A 3KAHA 2K8IA 2OWOA 3W4RA 2A3CA 1CTNA 4JFLA 4TW6A 1ZBWA 1M5YA 2YBTA 4ODRA 4ZPVR 2MLZA 1HXVA 2M8JA 1QZ2A 2O92A 3NTPA 1EQ3A 4Z2JA 4JFIA 1ZK6A 4G50A 4G2PA 4JFKA 1SR0A 3ARXA 2OFNA 3OOBA 2Y8NB 4KR0B 2UZ5A 2DWVA 1VF8A 1W1PA 4ODNA 2DG4A 4P8VA 4QT2A 4TYOA 1FFRA 4TX0A 4MSPA 1BL4A 5E64A 1E6NA 3CHEA 3M7NA 1Y0OA 2XP8A 2MF9A 2JZVA 2ITKA 4WJXA 3TDBA 1FKSA 4MAVA 4C02B 1J6YA 2DT2A 5AHTA 1I5HW 1EHNA 1O6WA 4ML4A 4NNRA 4MPKA 1WR7A 3G6LA 3WKZA 1LQ0A 2M2AA 3QOKA 3RFWA 4Z2IA 1RD6A 2PBCA 5E62A 3I6CA 4IQCA 4U84A 4DRIA 4A0UA 3ARYA 1JNDA 1K9RA 5E5WA 2QRVA 3IK8A 4DZ3A 1LL7A 4GGQA 1ZBCA 1FFQA 4S3KA 5DIVA 3ARVA 5HTGA 1A7XA 2A3AA 3LKXA 3AS2A 3RMEA 4DIPA 4PTMA 4FN2A 3UQIA 1H0IA 3O5PA 1LG2A 2ESCA 3O5QA 4ODQA 5JH8A 1ZBKA 1NWUA 4L3NA 5I98A 1OWQA 3VAWA 4A0TA 1HKMA 1KT1A 2DT3A 1KT0A 5E65A 4URIA 2DSUA 4P8XA 2BA1A 2YBUA 2PI6A 3WL0A 1RP5A 1JNEA 2MDIA 3B9DA 1W1VA 4P8WA 3ALGA 4MGVA 2B31A 1EIBA 1ITXA 2XP3A 3ARQA 2MPHA 3CZ8A 4N19A 1LL4A 1R9HA 3LKXB 3MCBA 1YATA 3UI4A 3AS3A 1D2KA 4MNLA 2LJ4A 3ARZA 2JXWA 3PRDA 5GPGA 1JNTA 5HUAA 1Q1CA 1WNOA 3O5RA 3ARTA 4O2TA 3IKGA 2OLHA 2ZAJA 1ROUA 4JFJA 1E9LA 2EZ5W 4IT6A 2DSZA 3CHCA 3EY6A 1HJXA 1N1AA 1TCOC 1FKDA 5HKGA 2AWGA 3FXYA 3WD1A 1NH6A 1Q6HA 3WQVA 4JYSA 1YW5A 1K9TA 4Q22A 2E45A 1NWTA 2JV4A 2ZQTA 5HBFA 2WM0A 3PA7A 2RSEA 2ZR4A 2IF4A 1GUVA 4XAKA 4QT3A 1JVWA 3B9EA 5E66A 3WIJA 3MQHA 1JNSA 2XP4A 3KACA 2QF8A 4DWSC 1C9HA 3UI5A 4Z2HA 4W5UA 3UQAA 4MNJA 3CGNA 1FKFA 5DITA 5B8IC 2RUCA 1LG1A 4LAXA 1WMVA 2MNTA 4MTVA 1FKJA 2PV3A 2DMVA 4S3JA 2DJYA 4BF8A 3NRKA 3KAGA 2WAEA 4P8UA 3O5IA 4GIVA 1E6ZA 5DF0A 2WLYA 2A3BA 3ALFA 1HKJA 1FD9A 4TW7A 2XPBA 1ZL1A 3BXWA 4Q7NA 1LJYA 3O5GA 1D7JA 5DEZA 2ZR6A 1WAWA 5GPRA 2DT0A 2AOSA 1FAPA 3FS8A 2DK7A 4J4OA 4LAYA 2KI3A 5U47A 3UI6A 3KAFA 4R0XA 2DSWA 2XP9A 4GLXA 1EYMA 1W9PA 3PR9A 2WADA 2PV2A 3GPKA 1F40A 3ODKA 4JFMA 4DT4A 2RQSA 2YSHA 3MQGA 1HKKA 4ODKA 5HW7A 4W9QA 2RUQA 3ARSA 1P5QA 2JX8A 4QZVB 5HW8A 1NMVA 2DPEA 4KQZA 4DRNA 2VN1A 2FKEA 3AQUA 5HWCA 2YSFA 4IPXA 4TNSA 3PQHA 3JYMA 4ODPA 4DRJA 4ZS6A 3RM8A 2L4JA 3UF8A 1EDQA 3KAIA 1TR8A 4DRPA 1JMQA 2VCDA 3WD3A 1Q6IA 1B6CA 2PV1A 3UQBA 1XHGA 1KFWA 5GQBA 4DWSD 2XPAA 4IT4A 3ARRA 2M08A 1T11A 1D6OA 1PINA 1FKIA 1L1PA 2O9OA 1ZU8A 1XRVA 3KCEA 2MLXA 3WD4A 4DRMA 4LGXA 1F8AB 1ZBVA 3FY1A 4WK9A 4ODLA 4DZ2A 2RUDA 2DG9A 3G6MA 3B7XA 4NSBA 2JMFA 4Z2LA 3CHFA 5BXJA 5DO2A 4W9OA 1FKLA 3PRBA 5HT1A 2LPVA 1NSGA 3IKDA 1ZB5A 3O5LA 4LAVA 2YAJB 2ZR5A 3WQWA 2WLZA 4HARA 2PPNA 3B8SA 3CNGA 1FKTA 3KZ7A 4AY1A 3O5MA 3MCBB 1E15A 3H9RB 4ZPTR 2XP5A 1X6LA 2F4EA 1Q6UA 3JXVA 5DIUA 2KR7A 2FDMA 1FLCA 4LAWA 1D7HA 4HBEA 3WD0A 3AS1A 1E6RA 2KGJA 4ITZA 1J4IA 1NWRA 1FKGA 3O5EA 1HJVA 3O5OA 3LE4A 3WH0A 2M3OW 3MDYB 4WKHA 1WB0A 2PPOA 3LUOA 4ZPWR 2L2SA 2YSIA 4U86A 1O6IA 2MLYA 2WK2A 2PPPA 1SYTA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3O5K A;  2ZQS A;  4J4N A;  2KO7 A;  2N87 A;  2D9F A;  1PBK A;  2Q5A A;  4FAP A;  1ROT A;  1FJD A;  3KAB A;  4REX A;  1BKF A;  4DH0 A;  4E5R A;  5HWB A;  4TW8 A;  1FKH A;  3FAP A;  2KXQ A;  5J6E A;  1J4H A;  1QPL A;  2LKN A;  2M1I A;  5CQ2 A;  3O5F A;  2KE0 A;  4DRO A;  1K9Q A;  2RE3 A;  2YSG A;  1U79 A;  2M8I A;  1TK7 A;  1QPF A;  3RGC A;  3JYJ A;  4DRQ A;  1FKR A;  1W26 A;  2F2D A;  3NI6 A;  4DRK A;  2XP6 A;  2LGO A;  5D75 A;  4U85 A;  3IHZ A;  2ZQV A;  1ZCN A;  2DG3 A;  5HW6 A;  4W9P A;  3L4H A;  3O5D A;  1J4R A;  2Y78 A;  4ODM A;  2XP7 A;  4ODO A;  1NMW A;  2LAJ A;  2ZQU A;  1D7I A;  2FAP A;  3TCZ A;  1EG4 A;  1FKB A;  3TC5 A;  1EG3 A;  2YSB A;  3CGM A;  4DRH A;  3KAD A;  3M85 A;  2KFW A;  1FKK A;  4QIB A;  2DK1 A;  4IQ2 A;  2RUR A;  3O5J A;  2F21 A;  3KAH A;  2K8I A;  4JFL A;  4TW6 A;  1M5Y A;  4ODR A;  2MLZ A;  1HXV A;  2M8J A;  1QZ2 A;  3NTP A;  1EQ3 A;  4JFI A;  1ZK6 A;  4G50 A;  4G2P A;  4JFK A;  2OFN A;  3OOB A;  2UZ5 A;  2DWV A;  4ODN A;  2DG4 A;  4QT2 A;  4TYO A;  4TX0 A;  4MSP A;  1BL4 A;  3M7N A;  1Y0O A;  2XP8 A;  2MF9 A;  2JZV A;  2ITK A;  3TDB A;  1FKS A;  4C02 B;  1J6Y A;  5AHT A;  1I5H W;  1O6W A;  4NNR A;  1WR7 A;  2M2A A;  3RFW A;  2PBC A;  3I6C A;  4IQC A;  4U84 A;  4DRI A;  1K9R A;  4DZ3 A;  4GGQ A;  5DIV A;  5HTG A;  1A7X A;  4DIP A;  3UQI A;  4FN2 A;  3O5P A;  3O5Q A;  4ODQ A;  5I98 A;  3VAW A;  1KT1 A;  1KT0 A;  2BA1 A;  2MDI A;  4MGV A;  2XP3 A;  2MPH A;  4N19 A;  1R9H A;  1YAT A;  3UI4 A;  5GPG A;  5HUA A;  2LJ4 A;  3PRD A;  2JXW A;  1JNT A;  1Q1C A;  3O5R A;  4O2T A;  3IKG A;  2ZAJ A;  1ROU A;  4JFJ A;  2EZ5 W;  3EY6 A;  1N1A A;  1TCO C;  1FKD A;  5HKG A;  2AWG A;  1Q6H A;  4JYS A;  1YW5 A;  2E45 A;  2JV4 A;  2ZQT A;  3PA7 A;  2RSE A;  2ZR4 A;  2IF4 A;  4QT3 A;  1JVW A;  1JNS A;  2XP4 A;  3KAC A;  1C9H A;  3UI5 A;  3UQA A;  3CGN A;  1FKF A;  5DIT A;  5B8I C;  2RUC A;  4LAX A;  1WMV A;  2MNT A;  1FKJ A;  2PV3 A;  2DMV A;  2DJY A;  4BF8 A;  3NRK A;  3KAG A;  3O5I A;  4GIV A;  1FD9 A;  4TW7 A;  2XPB A;  3O5G A;  1D7J A;  2ZR6 A;  1FAP A;  2DK7 A;  4J4O A;  4LAY A;  2KI3 A;  3UI6 A;  3KAF A;  4R0X A;  2XP9 A;  1EYM A;  2PV2 A;  3GPK A;  1F40 A;  3ODK A;  4JFM A;  4DT4 A;  2RQS A;  2YSH A;  4ODK A;  5HW7 A;  4W9Q A;  2RUQ A;  1P5Q A;  2JX8 A;  5HW8 A;  1NMV A;  4DRN A;  2VN1 A;  2FKE A;  5HWC A;  2YSF A;  4IPX A;  4TNS A;  3JYM A;  4ODP A;  4DRJ A;  2L4J A;  3UF8 A;  3KAI A;  4DRP A;  1JMQ A;  2VCD A;  1Q6I A;  1B6C A;  2PV1 A;  3UQB A;  2XPA A;  2M08 A;  1T11 A;  1D6O A;  1PIN A;  1FKI A;  1L1P A;  3KCE A;  2MLX A;  4DRM A;  1F8A B;  4ODL A;  4DZ2 A;  2RUD A;  2DG9 A;  3B7X A;  2JMF A;  5BXJ A;  4W9O A;  1FKL A;  3PRB A;  5HT1 A;  2LPV A;  1NSG A;  3IKD A;  3O5L A;  4LAV A;  2ZR5 A;  2PPN A;  3CNG A;  1FKT A;  3KZ7 A;  3O5M A;  3H9R B;  2XP5 A;  2F4E A;  1Q6U A;  3JXV A;  5DIU A;  2KR7 A;  4LAW A;  1D7H A;  2KGJ A;  4ITZ A;  1J4I A;  1FKG A;  3O5E A;  3O5O A;  3LE4 A;  3WH0 A;  2M3O W;  3MDY B;  2PPO A;  3LUO A;  2L2S A;  2YSI A;  4U86 A;  2MLY A;  3IK8 A;  2PPP A; 
#chains in the Genus database with same CATH topology
 3O5K A;  1E6P A;  2ZQS A;  3ARW A;  4J4N A;  2KO7 A;  2N87 A;  4HBO A;  1W9U A;  2D9F A;  4DWS A;  2G41 A;  1PBK A;  4MNK A;  2Q5A A;  4FAP A;  1ROT A;  1FJD A;  1W9V A;  3AS0 A;  3KAB A;  4REX A;  1BKF A;  4DH0 A;  4E5R A;  5HWB A;  4MNM A;  4TW8 A;  1FKH A;  3FAP A;  2KXQ A;  5J6E A;  1J4H A;  1H0G A;  1QPL A;  2LKN A;  2G8Z A;  2M1I A;  3RM9 A;  5CQ2 A;  1W1Y A;  2P4V A;  3O5F A;  1UR8 A;  3CH9 A;  4R5E A;  3CHD A;  3FSB A;  2KE0 A;  4DRO A;  1K9Q A;  2RE3 A;  4L72 B;  2YSG A;  1GOI A;  1U79 A;  2M8I A;  1TK7 A;  1QPF A;  2DT1 A;  3RGC A;  3JYJ A;  4DRQ A;  1FKR A;  4DWS B;  1W26 A;  3EIP A;  2F2D A;  3NI6 A;  3BMB A;  4NZC A;  4WKF A;  1JCH B;  2XP6 A;  4DRK A;  2ETN A;  1LL6 A;  1GRJ A;  4U85 A;  2LGO A;  5D75 A;  3IHZ A;  1IX5 A;  2ZQV A;  1ZCN A;  2DG3 A;  5HW6 A;  4W9P A;  3L4H A;  3O5D A;  1J4R A;  1HKI A;  2IUZ A;  2Y78 A;  4WIW A;  3WL1 A;  3B9A A;  4ODM A;  2XP7 A;  1W1T A;  4ODO A;  1NMW A;  2LAJ A;  2ZQU A;  1D7I A;  2FAP A;  3TCZ A;  1EG4 A;  1TFV A;  3WD2 A;  1OGB A;  1UR9 A;  1FKB A;  3OA5 A;  3TC5 A;  1EG3 A;  2YSB A;  3ARP A;  3RM4 A;  1OGG A;  3CGM A;  4DRH A;  1NWS A;  3KAD A;  2KFW A;  3M85 A;  1FKK A;  3PRA A;  4QIB A;  3FSC A;  1X6N A;  3ARU A;  2A3E A;  2DK1 A;  4IQ2 A;  4WKA A;  1GPF A;  4Z2K A;  2RUR A;  3O5J A;  1HJW A;  2DSV A;  4Z2G A;  3ARO A;  2F21 A;  3KAH A;  2K8I A;  2OWO A;  3W4R A;  2A3C A;  1CTN A;  4JFL A;  4TW6 A;  1ZBW A;  1M5Y A;  2YBT A;  4ODR A;  4ZPV R;  2MLZ A;  1HXV A;  2M8J A;  1QZ2 A;  2O92 A;  3NTP A;  1EQ3 A;  4Z2J A;  4JFI A;  1ZK6 A;  4G50 A;  4G2P A;  4JFK A;  1SR0 A;  3ARX A;  2OFN A;  3OOB A;  2Y8N B;  4KR0 B;  2EUL A;  2UZ5 A;  2DWV A;  1VF8 A;  1W1P A;  4ODN A;  2DG4 A;  4P8V A;  4QT2 A;  4TYO A;  1FFR A;  4TX0 A;  4MSP A;  1BL4 A;  5E64 A;  1E6N A;  3CHE A;  3M7N A;  1Y0O A;  2XP8 A;  2MF9 A;  2JZV A;  2ITK A;  4WJX A;  3TDB A;  1FKS A;  4MAV A;  4C02 B;  1J6Y A;  2DT2 A;  5AHT A;  1I5H W;  1EHN A;  1O6W A;  4ML4 A;  4NNR A;  4MPK A;  1WR7 A;  3G6L A;  3WKZ A;  1LQ0 A;  2M2A A;  3QOK A;  3RFW A;  4Z2I A;  1RD6 A;  2PBC A;  5E62 A;  3I6C A;  4IQC A;  4U84 A;  4DRI A;  4A0U A;  3ARY A;  1JND A;  1K9R A;  5E5W A;  2QRV A;  3IK8 A;  4DZ3 A;  1LL7 A;  4GGQ A;  1ZBC A;  1FFQ A;  4S3K A;  5DIV A;  3ARV A;  5HTG A;  1E44 A;  1A7X A;  2A3A A;  3LKX A;  3AS2 A;  3RME A;  4DIP A;  4PTM A;  4FN2 A;  3UQI A;  1H0I A;  3O5P A;  1LG2 A;  2ESC A;  3O5Q A;  4ODQ A;  5JH8 A;  1ZBK A;  1NWU A;  4L3N A;  5I98 A;  1OWQ A;  3VAW A;  4A0T A;  1HKM A;  1KT1 A;  2DT3 A;  2PN0 A;  1KT0 A;  5E65 A;  4URI A;  2B5U B;  2DSU A;  4P8X A;  2BA1 A;  2YBU A;  2PI6 A;  3WL0 A;  1RP5 A;  1JNE A;  2MDI A;  3B9D A;  1W1V A;  4P8W A;  3ALG A;  4MGV A;  2B31 A;  1EIB A;  1ITX A;  2XP3 A;  3ARQ A;  2MPH A;  3CZ8 A;  4N19 A;  1LL4 A;  1R9H A;  3LKX B;  3MCB A;  1YAT A;  3UI4 A;  3AS3 A;  1D2K A;  4MNL A;  2LJ4 A;  3ARZ A;  2JXW A;  3PRD A;  5GPG A;  1JNT A;  5HUA A;  3GU0 A;  1Q1C A;  1WNO A;  3O5R A;  3ART A;  4O2T A;  3IKG A;  2OLH A;  2ZAJ A;  1ROU A;  4JFJ A;  1E9L A;  2EZ5 W;  4IT6 A;  2DSZ A;  3CHC A;  3EY6 A;  1HJX A;  3GTY X;  1N1A A;  1TCO C;  1FKD A;  5HKG A;  2AWG A;  3FXY A;  3WD1 A;  1NH6 A;  1Q6H A;  3WQV A;  4JYS A;  1YW5 A;  1K9T A;  4Q22 A;  2E45 A;  1NWT A;  2JV4 A;  2ZQT A;  5HBF A;  2WM0 A;  3PA7 A;  2RSE A;  2ZR4 A;  2IF4 A;  1GUV A;  4XAK A;  4QT3 A;  1JVW A;  3B9E A;  5E66 A;  3WIJ A;  3MQH A;  1JNS A;  2XP4 A;  3KAC A;  2QF8 A;  4DWS C;  1C9H A;  3UI5 A;  4Z2H A;  4W5U A;  3UQA A;  4MNJ A;  3CGN A;  1FKF A;  5DIT A;  5B8I C;  2RUC A;  1LG1 A;  4LAX A;  1WMV A;  2MNT A;  4MTV A;  1FKJ A;  2PV3 A;  2DMV A;  4S3J A;  2DJY A;  4BF8 A;  3NRK A;  3KAG A;  2WAE A;  4P8U A;  3O5I A;  4GIV A;  1E6Z A;  5DF0 A;  2WLY A;  2A3B A;  3ALF A;  1HKJ A;  1FD9 A;  4TW7 A;  2XPB A;  1ZL1 A;  3BXW A;  4Q7N A;  1LJY A;  3O5G A;  1D7J A;  5DEZ A;  2ZR6 A;  1WAW A;  5GPR A;  2DT0 A;  2AOS A;  1FAP A;  3FS8 A;  2DK7 A;  4J4O A;  4LAY A;  2KI3 A;  5U47 A;  3UI6 A;  3KAF A;  4R0X A;  2DSW A;  2XP9 A;  4GLX A;  1EYM A;  1W9P A;  3PR9 A;  2WAD A;  2PV2 A;  3GPK A;  1F40 A;  3ODK A;  4JFM A;  4DT4 A;  2RQS A;  2YSH A;  3MQG A;  1HKK A;  4ODK A;  5HW7 A;  4W9Q A;  2RUQ A;  3ARS A;  1P5Q A;  2JX8 A;  4QZV B;  5HW8 A;  1NMV A;  2DPE A;  4KQZ A;  4DRN A;  2VN1 A;  2FKE A;  3AQU A;  5HWC A;  2YSF A;  4IPX A;  4TNS A;  3PQH A;  3JYM A;  4ODP A;  4DRJ A;  4ZS6 A;  3RM8 A;  2L4J A;  3UF8 A;  1EDQ A;  3KAI A;  1TR8 A;  4DRP A;  1JMQ A;  2VCD A;  3WD3 A;  1Q6I A;  1B6C A;  2PV1 A;  3UQB A;  1XHG A;  1KFW A;  5GQB A;  4DWS D;  2XPA A;  4IT4 A;  3ARR A;  2M08 A;  1T11 A;  1D6O A;  1PIN A;  1FKI A;  1L1P A;  2O9O A;  1ZU8 A;  1XRV A;  3KCE A;  2MLX A;  3WD4 A;  4DRM A;  4LGX A;  1F8A B;  1ZBV A;  3FY1 A;  4WK9 A;  4ODL A;  4DZ2 A;  2RUD A;  2DG9 A;  3G6M A;  3B7X A;  4NSB A;  2JMF A;  4Z2L A;  3CHF A;  5BXJ A;  5DO2 A;  4W9O A;  1FKL A;  3PRB A;  5HT1 A;  2LPV A;  1NSG A;  3IKD A;  1ZB5 A;  3O5L A;  4LAV A;  2YAJ B;  2ZR5 A;  3WQW A;  2WLZ A;  4HAR A;  2PPN A;  3B8S A;  3CNG A;  1FKT A;  3KZ7 A;  4AY1 A;  3O5M A;  3MCB B;  1E15 A;  3H9R B;  4ZPT R;  2XP5 A;  1X6L A;  2F4E A;  4UDM A;  1Q6U A;  3JXV A;  5DIU A;  2KR7 A;  2FDM A;  1FLC A;  4LAW A;  1D7H A;  4HBE A;  2F23 A;  3WD0 A;  3AS1 A;  1E6R A;  2KGJ A;  4ITZ A;  1J4I A;  1NWR A;  1FKG A;  3O5E A;  1HJV A;  3O5O A;  3LE4 A;  3WH0 A;  2M3O W;  3MDY B;  4WKH A;  1WB0 A;  2PPO A;  3LUO A;  4ZPW R;  2L2S A;  2YSI A;  4U86 A;  1O6I A;  2MLY A;  2WK2 A;  2PPP A;  1SYT A; 
#chains in the Genus database with same CATH homology
 3O5K A;  1E6P A;  2ZQS A;  3ARW A;  4J4N A;  2KO7 A;  2N87 A;  4HBO A;  1W9U A;  2D9F A;  4DWS A;  2G41 A;  1PBK A;  4MNK A;  2Q5A A;  4FAP A;  1ROT A;  1FJD A;  1W9V A;  3AS0 A;  3KAB A;  4REX A;  1BKF A;  4DH0 A;  4E5R A;  5HWB A;  4MNM A;  4TW8 A;  1FKH A;  3FAP A;  2KXQ A;  5J6E A;  1J4H A;  1H0G A;  1QPL A;  2LKN A;  2G8Z A;  2M1I A;  3RM9 A;  5CQ2 A;  1W1Y A;  3O5F A;  1UR8 A;  3CH9 A;  4R5E A;  3CHD A;  3FSB A;  2KE0 A;  4DRO A;  1K9Q A;  2RE3 A;  4L72 B;  2YSG A;  1GOI A;  1U79 A;  2M8I A;  1TK7 A;  1QPF A;  2DT1 A;  3RGC A;  3JYJ A;  4DRQ A;  1FKR A;  4DWS B;  1W26 A;  2F2D A;  3NI6 A;  4NZC A;  4WKF A;  4DRK A;  2XP6 A;  1LL6 A;  2LGO A;  4U85 A;  5D75 A;  3IHZ A;  1IX5 A;  2ZQV A;  1ZCN A;  2DG3 A;  5HW6 A;  4W9P A;  3L4H A;  3O5D A;  1J4R A;  1HKI A;  2IUZ A;  2Y78 A;  4WIW A;  3WL1 A;  3B9A A;  4ODM A;  2XP7 A;  1W1T A;  4ODO A;  1NMW A;  2LAJ A;  2ZQU A;  1D7I A;  2FAP A;  3TCZ A;  1EG4 A;  1TFV A;  3WD2 A;  1OGB A;  1UR9 A;  1FKB A;  3OA5 A;  3TC5 A;  1EG3 A;  2YSB A;  3ARP A;  3RM4 A;  1OGG A;  3CGM A;  4DRH A;  1NWS A;  3KAD A;  2KFW A;  3M85 A;  1FKK A;  3PRA A;  4QIB A;  3FSC A;  1X6N A;  3ARU A;  2A3E A;  2DK1 A;  4IQ2 A;  4WKA A;  1GPF A;  4Z2K A;  2RUR A;  3O5J A;  1HJW A;  2DSV A;  4Z2G A;  3ARO A;  2F21 A;  3KAH A;  2K8I A;  2OWO A;  3W4R A;  2A3C A;  1CTN A;  4JFL A;  4TW6 A;  1ZBW A;  1M5Y A;  2YBT A;  4ODR A;  4ZPV R;  2MLZ A;  1HXV A;  2M8J A;  1QZ2 A;  2O92 A;  3NTP A;  1EQ3 A;  4Z2J A;  4JFI A;  1ZK6 A;  4G50 A;  4G2P A;  4JFK A;  1SR0 A;  3ARX A;  2OFN A;  3OOB A;  2Y8N B;  4KR0 B;  2UZ5 A;  2DWV A;  1VF8 A;  1W1P A;  4ODN A;  2DG4 A;  4P8V A;  4QT2 A;  4TYO A;  1FFR A;  4TX0 A;  4MSP A;  1BL4 A;  5E64 A;  1E6N A;  3CHE A;  3M7N A;  1Y0O A;  2XP8 A;  2MF9 A;  2JZV A;  2ITK A;  4WJX A;  3TDB A;  1FKS A;  4MAV A;  4C02 B;  1J6Y A;  2DT2 A;  5AHT A;  1I5H W;  1EHN A;  1O6W A;  4ML4 A;  4NNR A;  4MPK A;  1WR7 A;  3G6L A;  3WKZ A;  1LQ0 A;  2M2A A;  3QOK A;  3RFW A;  4Z2I A;  1RD6 A;  2PBC A;  5E62 A;  3I6C A;  4IQC A;  4U84 A;  4DRI A;  4A0U A;  3ARY A;  1JND A;  1K9R A;  5E5W A;  2QRV A;  3IK8 A;  4DZ3 A;  1LL7 A;  4GGQ A;  1ZBC A;  1FFQ A;  4S3K A;  5DIV A;  3ARV A;  5HTG A;  1A7X A;  2A3A A;  3LKX A;  3AS2 A;  3RME A;  4DIP A;  4PTM A;  4FN2 A;  3UQI A;  1H0I A;  3O5P A;  1LG2 A;  2ESC A;  3O5Q A;  4ODQ A;  5JH8 A;  1ZBK A;  1NWU A;  4L3N A;  5I98 A;  1OWQ A;  3VAW A;  4A0T A;  1HKM A;  1KT1 A;  2DT3 A;  1KT0 A;  5E65 A;  4URI A;  2DSU A;  4P8X A;  2BA1 A;  2YBU A;  2PI6 A;  3WL0 A;  1RP5 A;  1JNE A;  2MDI A;  3B9D A;  1W1V A;  4P8W A;  3ALG A;  4MGV A;  2B31 A;  1EIB A;  1ITX A;  2XP3 A;  3ARQ A;  2MPH A;  3CZ8 A;  4N19 A;  1LL4 A;  1R9H A;  3LKX B;  3MCB A;  1YAT A;  3UI4 A;  3AS3 A;  1D2K A;  4MNL A;  2LJ4 A;  3ARZ A;  2JXW A;  3PRD A;  5GPG A;  1JNT A;  5HUA A;  1Q1C A;  1WNO A;  3O5R A;  3ART A;  4O2T A;  3IKG A;  2OLH A;  2ZAJ A;  1ROU A;  4JFJ A;  1E9L A;  2EZ5 W;  4IT6 A;  2DSZ A;  3CHC A;  3EY6 A;  1HJX A;  1N1A A;  1TCO C;  1FKD A;  5HKG A;  2AWG A;  3FXY A;  3WD1 A;  1NH6 A;  1Q6H A;  3WQV A;  4JYS A;  1YW5 A;  1K9T A;  4Q22 A;  2E45 A;  1NWT A;  2JV4 A;  2ZQT A;  5HBF A;  2WM0 A;  3PA7 A;  2RSE A;  2ZR4 A;  2IF4 A;  1GUV A;  4XAK A;  4QT3 A;  1JVW A;  3B9E A;  5E66 A;  3WIJ A;  3MQH A;  1JNS A;  2XP4 A;  3KAC A;  2QF8 A;  4DWS C;  1C9H A;  3UI5 A;  4Z2H A;  4W5U A;  3UQA A;  4MNJ A;  3CGN A;  1FKF A;  5DIT A;  5B8I C;  2RUC A;  1LG1 A;  4LAX A;  1WMV A;  2MNT A;  4MTV A;  1FKJ A;  2PV3 A;  2DMV A;  4S3J A;  2DJY A;  4BF8 A;  3NRK A;  3KAG A;  2WAE A;  4P8U A;  3O5I A;  4GIV A;  1E6Z A;  5DF0 A;  2WLY A;  2A3B A;  3ALF A;  1HKJ A;  1FD9 A;  4TW7 A;  2XPB A;  1ZL1 A;  3BXW A;  4Q7N A;  1LJY A;  3O5G A;  1D7J A;  5DEZ A;  2ZR6 A;  1WAW A;  5GPR A;  2DT0 A;  2AOS A;  1FAP A;  3FS8 A;  2DK7 A;  4J4O A;  4LAY A;  2KI3 A;  5U47 A;  3UI6 A;  3KAF A;  4R0X A;  2DSW A;  2XP9 A;  4GLX A;  1EYM A;  1W9P A;  3PR9 A;  2WAD A;  2PV2 A;  3GPK A;  1F40 A;  3ODK A;  4JFM A;  4DT4 A;  2RQS A;  2YSH A;  3MQG A;  1HKK A;  4ODK A;  5HW7 A;  4W9Q A;  2RUQ A;  3ARS A;  1P5Q A;  2JX8 A;  4QZV B;  5HW8 A;  1NMV A;  2DPE A;  4KQZ A;  4DRN A;  2VN1 A;  2FKE A;  3AQU A;  5HWC A;  2YSF A;  4IPX A;  4TNS A;  3PQH A;  3JYM A;  4ODP A;  4DRJ A;  4ZS6 A;  3RM8 A;  2L4J A;  3UF8 A;  1EDQ A;  3KAI A;  1TR8 A;  4DRP A;  1JMQ A;  2VCD A;  3WD3 A;  1Q6I A;  1B6C A;  2PV1 A;  3UQB A;  1XHG A;  1KFW A;  5GQB A;  4DWS D;  2XPA A;  4IT4 A;  3ARR A;  2M08 A;  1T11 A;  1D6O A;  1PIN A;  1FKI A;  1L1P A;  2O9O A;  1ZU8 A;  1XRV A;  3KCE A;  2MLX A;  3WD4 A;  4DRM A;  4LGX A;  1F8A B;  1ZBV A;  3FY1 A;  4WK9 A;  4ODL A;  4DZ2 A;  2RUD A;  2DG9 A;  3G6M A;  3B7X A;  4NSB A;  2JMF A;  4Z2L A;  3CHF A;  5BXJ A;  5DO2 A;  4W9O A;  1FKL A;  3PRB A;  5HT1 A;  2LPV A;  1NSG A;  3IKD A;  1ZB5 A;  3O5L A;  4LAV A;  2YAJ B;  2ZR5 A;  3WQW A;  2WLZ A;  4HAR A;  2PPN A;  3B8S A;  3CNG A;  1FKT A;  3KZ7 A;  4AY1 A;  3O5M A;  3MCB B;  1E15 A;  3H9R B;  4ZPT R;  2XP5 A;  1X6L A;  2F4E A;  1Q6U A;  3JXV A;  5DIU A;  2KR7 A;  2FDM A;  1FLC A;  4LAW A;  1D7H A;  4HBE A;  3WD0 A;  3AS1 A;  1E6R A;  2KGJ A;  4ITZ A;  1J4I A;  1NWR A;  1FKG A;  3O5E A;  1HJV A;  3O5O A;  3LE4 A;  3WH0 A;  2M3O W;  3MDY B;  4WKH A;  1WB0 A;  2PPO A;  3LUO A;  4ZPW R;  2L2S A;  2YSI A;  4U86 A;  1O6I A;  2MLY A;  2WK2 A;  2PPP A;  1SYT A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...