2JXWA

Solution structure of the tandem ww domains of fbp21
Total Genus 2
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
2
sequence length
75
structure length
75
Chain Sequence
DPSKGRWVEGITSEGYHYYYDLISGASQWEKPEGFQGDLKKTAVKTVWVEGLSEDGFTYYYNTETGESRWEKPDD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords WW domain-binding protein 4
publication title Structure and function of the two tandem WW domains of the pre-mRNA splicing factor FBP21 (formin-binding protein 21)
pubmed doi rcsb
source organism Homo sapiens
molecule tags Formin binding protein
total genus 2
structure length 75
sequence length 75
ec nomenclature
pdb deposition date 2007-11-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00397 WW WW domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.20.70.10 Mainly Beta Single Sheet Ubiquitin Ligase Nedd4; Chain: W; Ubiquitin Ligase Nedd4; Chain: W; 2jxwA00
1F8AB 3ODKA 4REXA 2E45A 2M3OW 4U85A 2DMVA 2MDIA 3OOBA 2YSHA 3KAFA 5CQ2A 2XP4A 2DK1A 2KXQA 2XP6A 2ZR5A 3M85A 2ZQSA 2ZQVA 3LE4A 2BA1A 2F21A 3KAHA 2YSBA 3KADA 3KAGA 1WR7A 2ZR6A 2YSIA 3TCZA 3L4HA 2L4JA 2M8IA 1ZCNA 2XPBA 1NMVA 2XP7A 2Q5AA 2DJYA 2XP8A 2XP5A 2JV4A 2XPAA 3TC5A 2JX8A 5AHTA 2YSGA 4U86A 1EG3A 1TK7A 2ZQUA 2DWVA 2ZAJA 3KCEA 1JMQA 1WMVA 3NTPA 2EZ5W 2ZR4A 3TDBA 4U84A 3WH0A 4E5RA 2ZQTA 1K9QA 4QIBA 1I5HW 1PINA 1YW5A 3KAIA 3KABA 1K9RA 3M7NA 2XP9A 2XP3A 1EG4A 3CNGA 2M8JA 2DK7A 2LAJA 2JXWA 2JMFA 2ITKA 2YSFA 1O6WA 2RE3A
chains in the Genus database with same CATH superfamily
1F8AB 1FLCA 3ODKA 3FS8A 2E45A 2M3OW 4REXA 4U85A 2DMVA 1TR8A 2MDIA 3OOBA 2YSHA 3KAFA 3MQHA 3LKXB 3LKXA 5CQ2A 2XP4A 2DK1A 5E62A 2KXQA 2XP6A 2ZR5A 3M85A 2ZQSA 4A0UA 2ZQVA 3LE4A 3FSCA 2WAEA 2BA1A 2F21A 3KAHA 2YSBA 3KADA 3KAGA 1WR7A 2ZR6A 2YSIA 3PQHA 3MQGA 3TCZA 3L4HA 5E5WA 2L4JA 2M8IA 1ZCNA 2XPBA 2QRVA 2WADA 1NMVA 2XP7A 2Q5AA 4GLXA 2DJYA 2XP8A 2XP5A 2JV4A 2XPAA 3TC5A 2JX8A 5AHTA 2YSGA 4U86A 5E66A 1EG3A 1TK7A 2YAJB 2DWVA 3KCEA 2ZAJA 2ZQUA 1JMQA 1WMVA 5U47A 3NTPA 2EZ5W 2ZR4A 3FSBA 3TDBA 4U84A 3WH0A 4E5RA 2ZQTA 1K9QA 4QIBA 1I5HW 5E64A 1PINA 2OWOA 1RP5A 1YW5A 3KAIA 3KABA 1K9RA 3M7NA 2XP9A 2XP3A 1EG4A 3CNGA 2M8JA 2DK7A 2LAJA 2Y8NB 4A0TA 3MCBA 3MCBB 2JXWA 2JMFA 5E65A 2ITKA 2YSFA 1O6WA 2RE3A
chains in the Genus database with same CATH topology
1F8AB 1FLCA 3ODKA 3FS8A 2E45A 2M3OW 4REXA 4U85A 2DMVA 1TR8A 2MDIA 3OOBA 2YSHA 3KAFA 3MQHA 3LKXB 3LKXA 5CQ2A 2XP4A 2DK1A 5E62A 2KXQA 2XP6A 2ZR5A 3M85A 2ZQSA 4A0UA 2ZQVA 3LE4A 3FSCA 2WAEA 2BA1A 2F21A 3KAHA 2YSBA 3KADA 3KAGA 1WR7A 2ZR6A 2YSIA 3PQHA 3MQGA 3TCZA 3L4HA 5E5WA 2L4JA 2M8IA 1ZCNA 2XPBA 2QRVA 2WADA 1NMVA 2XP7A 2Q5AA 4GLXA 2DJYA 2XP8A 2XP5A 2JV4A 2XPAA 3TC5A 2JX8A 5AHTA 2YSGA 4U86A 5E66A 1EG3A 1TK7A 2YAJB 2DWVA 3KCEA 2ZAJA 2ZQUA 1JMQA 1WMVA 5U47A 3NTPA 2EZ5W 2ZR4A 3FSBA 3TDBA 4U84A 3WH0A 4E5RA 2ZQTA 1K9QA 4QIBA 1I5HW 5E64A 1PINA 2OWOA 1RP5A 1YW5A 3KAIA 3KABA 1K9RA 3M7NA 2XP9A 2XP3A 1EG4A 3CNGA 2M8JA 2DK7A 2LAJA 2Y8NB 4A0TA 3MCBA 3MCBB 2JXWA 2JMFA 5E65A 2ITKA 2YSFA 1O6WA 2RE3A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1F8A B;  3ODK A;  4REX A;  2E45 A;  2M3O W;  4U85 A;  2DMV A;  2MDI A;  3OOB A;  2YSH A;  3KAF A;  5CQ2 A;  2XP4 A;  2DK1 A;  2KXQ A;  2XP6 A;  2ZR5 A;  3M85 A;  2ZQS A;  2ZQV A;  3LE4 A;  2BA1 A;  2F21 A;  3KAH A;  2YSB A;  3KAD A;  3KAG A;  1WR7 A;  2ZR6 A;  2YSI A;  3TCZ A;  3L4H A;  2L4J A;  2M8I A;  1ZCN A;  2XPB A;  1NMV A;  2XP7 A;  2Q5A A;  2DJY A;  2XP8 A;  2XP5 A;  2JV4 A;  2XPA A;  3TC5 A;  2JX8 A;  5AHT A;  2YSG A;  4U86 A;  1EG3 A;  1TK7 A;  2ZQU A;  2DWV A;  2ZAJ A;  3KCE A;  1JMQ A;  1WMV A;  3NTP A;  2EZ5 W;  2ZR4 A;  3TDB A;  4U84 A;  3WH0 A;  4E5R A;  2ZQT A;  1K9Q A;  4QIB A;  1I5H W;  1PIN A;  1YW5 A;  3KAI A;  3KAB A;  1K9R A;  3M7N A;  2XP9 A;  2XP3 A;  1EG4 A;  3CNG A;  2M8J A;  2DK7 A;  2LAJ A;  2JXW A;  2JMF A;  2ITK A;  2YSF A;  1O6W A;  2RE3 A; 
#chains in the Genus database with same CATH topology
 1F8A B;  1FLC A;  3ODK A;  3FS8 A;  2E45 A;  2M3O W;  4REX A;  4U85 A;  2DMV A;  1TR8 A;  2MDI A;  3OOB A;  2YSH A;  3KAF A;  3MQH A;  3LKX B;  3LKX A;  5CQ2 A;  2XP4 A;  2DK1 A;  5E62 A;  2KXQ A;  2XP6 A;  2ZR5 A;  3M85 A;  2ZQS A;  4A0U A;  2ZQV A;  3LE4 A;  3FSC A;  2WAE A;  2BA1 A;  2F21 A;  3KAH A;  2YSB A;  3KAD A;  3KAG A;  1WR7 A;  2ZR6 A;  2YSI A;  3PQH A;  3MQG A;  3TCZ A;  3L4H A;  5E5W A;  2L4J A;  2M8I A;  1ZCN A;  2XPB A;  2QRV A;  2WAD A;  1NMV A;  2XP7 A;  2Q5A A;  4GLX A;  2DJY A;  2XP8 A;  2XP5 A;  2JV4 A;  2XPA A;  3TC5 A;  2JX8 A;  5AHT A;  2YSG A;  4U86 A;  5E66 A;  1EG3 A;  1TK7 A;  2YAJ B;  2DWV A;  3KCE A;  2ZAJ A;  2ZQU A;  1JMQ A;  1WMV A;  5U47 A;  3NTP A;  2EZ5 W;  2ZR4 A;  3FSB A;  3TDB A;  4U84 A;  3WH0 A;  4E5R A;  2ZQT A;  1K9Q A;  4QIB A;  1I5H W;  5E64 A;  1PIN A;  2OWO A;  1RP5 A;  1YW5 A;  3KAI A;  3KAB A;  1K9R A;  3M7N A;  2XP9 A;  2XP3 A;  1EG4 A;  3CNG A;  2M8J A;  2DK7 A;  2LAJ A;  2Y8N B;  4A0T A;  3MCB A;  3MCB B;  2JXW A;  2JMF A;  5E65 A;  2ITK A;  2YSF A;  1O6W A;  2RE3 A; 
#chains in the Genus database with same CATH homology
 1F8A B;  1FLC A;  3ODK A;  3FS8 A;  2E45 A;  2M3O W;  4REX A;  4U85 A;  2DMV A;  1TR8 A;  2MDI A;  3OOB A;  2YSH A;  3KAF A;  3MQH A;  3LKX B;  3LKX A;  5CQ2 A;  2XP4 A;  2DK1 A;  5E62 A;  2KXQ A;  2XP6 A;  2ZR5 A;  3M85 A;  2ZQS A;  4A0U A;  2ZQV A;  3LE4 A;  3FSC A;  2WAE A;  2BA1 A;  2F21 A;  3KAH A;  2YSB A;  3KAD A;  3KAG A;  1WR7 A;  2ZR6 A;  2YSI A;  3PQH A;  3MQG A;  3TCZ A;  3L4H A;  5E5W A;  2L4J A;  2M8I A;  1ZCN A;  2XPB A;  2QRV A;  2WAD A;  1NMV A;  2XP7 A;  2Q5A A;  4GLX A;  2DJY A;  2XP8 A;  2XP5 A;  2JV4 A;  2XPA A;  3TC5 A;  2JX8 A;  5AHT A;  2YSG A;  4U86 A;  5E66 A;  1EG3 A;  1TK7 A;  2YAJ B;  2DWV A;  3KCE A;  2ZAJ A;  2ZQU A;  1JMQ A;  1WMV A;  5U47 A;  3NTP A;  2EZ5 W;  2ZR4 A;  3FSB A;  3TDB A;  4U84 A;  3WH0 A;  4E5R A;  2ZQT A;  1K9Q A;  4QIB A;  1I5H W;  5E64 A;  1PIN A;  2OWO A;  1RP5 A;  1YW5 A;  3KAI A;  3KAB A;  1K9R A;  3M7N A;  2XP9 A;  2XP3 A;  1EG4 A;  3CNG A;  2M8J A;  2DK7 A;  2LAJ A;  2Y8N B;  4A0T A;  3MCB A;  3MCB B;  2JXW A;  2JMF A;  5E65 A;  2ITK A;  2YSF A;  1O6W A;  2RE3 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...