2JXWA

Solution structure of the tandem ww domains of fbp21
Total Genus 2
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
2
sequence length
75
structure length
75
Chain Sequence
DPSKGRWVEGITSEGYHYYYDLISGASQWEKPEGFQGDLKKTAVKTVWVEGLSEDGFTYYYNTETGESRWEKPDD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Formin binding protein
molecule keywords WW domain-binding protein 4
publication title Structure and function of the two tandem WW domains of the pre-mRNA splicing factor FBP21 (formin-binding protein 21)
pubmed doi rcsb
source organism Homo sapiens
total genus 2
structure length 75
sequence length 75
ec nomenclature
pdb deposition date 2007-11-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00397 WW WW domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.20.70.10 Mainly Beta Single Sheet Ubiquitin Ligase Nedd4; Chain: W; Ubiquitin Ligase Nedd4; Chain: W; 2jxwA00
1WR7A 2YSHA 1ZCNA 2RE3A 2ZQTA 3KABA 3WH0A 3M85A 2JMFA 2JV4A 2ZR6A 3KAFA 2ZQUA 3TDBA 3M7NA 1K9RA 2Q5AA 1K9QA 1F8AB 1NMVA 1EG3A 2F21A 2MDIA 2XP8A 4U86A 3KAHA 3TCZA 2ZQSA 2YSFA 3CNGA 4QIBA 3L4HA 1EG4A 1WMVA 4U84A 3KADA 1YW5A 2DWVA 5CQ2A 5AHTA 2JXWA 1I5HW 2YSIA 2ZAJA 4REXA 2EZ5W 2XP4A 4U85A 2ZR5A 3ODKA 2XP9A 2ZQVA 2M3OW 3KAIA 2E45A 2BA1A 2L4JA 2LAJA 1JMQA 3OOBA 2JX8A 1PINA 2M8JA 2DMVA 2XP6A 2YSBA 2XP5A 2ZR4A 3TC5A 3LE4A 2XPAA 4E5RA 2DK7A 2XPBA 1O6WA 2DK1A 3KCEA 2XP7A 2YSGA 1TK7A 2M8IA 3NTPA 2KXQA 2DJYA 2ITKA 3KAGA 2XP3A
chains in the Genus database with same CATH superfamily
1WR7A 2YSHA 1ZCNA 2RE3A 2ZQTA 3KABA 3WH0A 3M85A 2JMFA 3MCBA 2JV4A 2ZR6A 3KAFA 2ZQUA 3TDBA 3M7NA 1K9RA 2WAEA 2Q5AA 1K9QA 1F8AB 1TR8A 3MQHA 1NMVA 1EG3A 2F21A 1FLCA 4A0TA 2MDIA 2XP8A 4U86A 3KAHA 3TCZA 2ZQSA 3FS8A 2YSFA 3CNGA 4QIBA 3L4HA 1EG4A 1WMVA 4U84A 3KADA 1YW5A 2DWVA 5CQ2A 5AHTA 2JXWA 1I5HW 2YSIA 2ZAJA 3MQGA 4REXA 2OWOA 2EZ5W 2XP4A 5E5WA 5U47A 4U85A 2ZR5A 3ODKA 2XP9A 3FSCA 2ZQVA 2WADA 3LKXB 2M3OW 3KAIA 2E45A 2BA1A 2L4JA 2LAJA 1JMQA 3OOBA 2JX8A 1PINA 2M8JA 2DMVA 2Y8NB 2XP6A 2YAJB 3PQHA 2YSBA 2XP5A 5E64A 3FSBA 2ZR4A 3TC5A 4GLXA 3MCBB 3LE4A 2XPAA 4A0UA 5E62A 4E5RA 1RP5A 3LKXA 2DK7A 2XPBA 1O6WA 5E65A 2DK1A 3KCEA 2XP7A 2YSGA 1TK7A 2M8IA 3NTPA 2KXQA 2DJYA 5E66A 2QRVA 2ITKA 3KAGA 2XP3A
chains in the Genus database with same CATH topology
1WR7A 2YSHA 1ZCNA 2RE3A 2ZQTA 3KABA 3WH0A 3M85A 2JMFA 3MCBA 2JV4A 2ZR6A 3KAFA 2ZQUA 3TDBA 3M7NA 1K9RA 2WAEA 2Q5AA 1K9QA 1F8AB 1TR8A 3MQHA 1NMVA 1EG3A 2F21A 1FLCA 4A0TA 2MDIA 2XP8A 4U86A 3KAHA 3TCZA 2ZQSA 3FS8A 2YSFA 3CNGA 4QIBA 3L4HA 1EG4A 1WMVA 4U84A 3KADA 1YW5A 2DWVA 5CQ2A 5AHTA 2JXWA 1I5HW 2YSIA 2ZAJA 3MQGA 4REXA 2OWOA 2EZ5W 2XP4A 5E5WA 5U47A 4U85A 2ZR5A 3ODKA 2XP9A 3FSCA 2ZQVA 2WADA 3LKXB 2M3OW 3KAIA 2E45A 2BA1A 2L4JA 2LAJA 1JMQA 3OOBA 2JX8A 1PINA 2M8JA 2DMVA 2Y8NB 2XP6A 2YAJB 3PQHA 2YSBA 2XP5A 5E64A 3FSBA 2ZR4A 3TC5A 4GLXA 3MCBB 3LE4A 2XPAA 4A0UA 5E62A 4E5RA 1RP5A 3LKXA 2DK7A 2XPBA 1O6WA 5E65A 2DK1A 3KCEA 2XP7A 2YSGA 1TK7A 2M8IA 3NTPA 2KXQA 2DJYA 5E66A 2QRVA 2ITKA 3KAGA 2XP3A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1WR7 A;  2YSH A;  1ZCN A;  2RE3 A;  2ZQT A;  3KAB A;  3WH0 A;  3M85 A;  2JMF A;  2JV4 A;  2ZR6 A;  3KAF A;  2ZQU A;  3TDB A;  3M7N A;  1K9R A;  2Q5A A;  1K9Q A;  1F8A B;  1NMV A;  1EG3 A;  2F21 A;  2MDI A;  2XP8 A;  4U86 A;  3KAH A;  3TCZ A;  2ZQS A;  2YSF A;  3CNG A;  4QIB A;  3L4H A;  1EG4 A;  1WMV A;  4U84 A;  3KAD A;  1YW5 A;  2DWV A;  5CQ2 A;  5AHT A;  2JXW A;  1I5H W;  2YSI A;  2ZAJ A;  4REX A;  2EZ5 W;  2XP4 A;  4U85 A;  2ZR5 A;  3ODK A;  2XP9 A;  2ZQV A;  2M3O W;  3KAI A;  2E45 A;  2BA1 A;  2L4J A;  2LAJ A;  1JMQ A;  3OOB A;  2JX8 A;  1PIN A;  2M8J A;  2DMV A;  2XP6 A;  2YSB A;  2XP5 A;  2ZR4 A;  3TC5 A;  3LE4 A;  2XPA A;  4E5R A;  2DK7 A;  2XPB A;  1O6W A;  2DK1 A;  3KCE A;  2XP7 A;  2YSG A;  1TK7 A;  2M8I A;  3NTP A;  2KXQ A;  2DJY A;  2ITK A;  3KAG A;  2XP3 A; 
#chains in the Genus database with same CATH topology
 1WR7 A;  2YSH A;  1ZCN A;  2RE3 A;  2ZQT A;  3KAB A;  3WH0 A;  3M85 A;  2JMF A;  3MCB A;  2JV4 A;  2ZR6 A;  3KAF A;  2ZQU A;  3TDB A;  3M7N A;  1K9R A;  2WAE A;  2Q5A A;  1K9Q A;  1F8A B;  1TR8 A;  3MQH A;  1NMV A;  1EG3 A;  2F21 A;  1FLC A;  4A0T A;  2MDI A;  2XP8 A;  4U86 A;  3KAH A;  3TCZ A;  2ZQS A;  3FS8 A;  2YSF A;  3CNG A;  4QIB A;  3L4H A;  1EG4 A;  1WMV A;  4U84 A;  3KAD A;  1YW5 A;  2DWV A;  5CQ2 A;  5AHT A;  2JXW A;  1I5H W;  2YSI A;  2ZAJ A;  3MQG A;  4REX A;  2OWO A;  2EZ5 W;  2XP4 A;  5E5W A;  5U47 A;  4U85 A;  2ZR5 A;  3ODK A;  2XP9 A;  3FSC A;  2ZQV A;  2WAD A;  3LKX B;  2M3O W;  3KAI A;  2E45 A;  2BA1 A;  2L4J A;  2LAJ A;  1JMQ A;  3OOB A;  2JX8 A;  1PIN A;  2M8J A;  2DMV A;  2Y8N B;  2XP6 A;  2YAJ B;  3PQH A;  2YSB A;  2XP5 A;  5E64 A;  3FSB A;  2ZR4 A;  3TC5 A;  4GLX A;  3MCB B;  3LE4 A;  2XPA A;  4A0U A;  5E62 A;  4E5R A;  1RP5 A;  3LKX A;  2DK7 A;  2XPB A;  1O6W A;  5E65 A;  2DK1 A;  3KCE A;  2XP7 A;  2YSG A;  1TK7 A;  2M8I A;  3NTP A;  2KXQ A;  2DJY A;  5E66 A;  2QRV A;  2ITK A;  3KAG A;  2XP3 A; 
#chains in the Genus database with same CATH homology
 1WR7 A;  2YSH A;  1ZCN A;  2RE3 A;  2ZQT A;  3KAB A;  3WH0 A;  3M85 A;  2JMF A;  3MCB A;  2JV4 A;  2ZR6 A;  3KAF A;  2ZQU A;  3TDB A;  3M7N A;  1K9R A;  2WAE A;  2Q5A A;  1K9Q A;  1F8A B;  1TR8 A;  3MQH A;  1NMV A;  1EG3 A;  2F21 A;  1FLC A;  4A0T A;  2MDI A;  2XP8 A;  4U86 A;  3KAH A;  3TCZ A;  2ZQS A;  3FS8 A;  2YSF A;  3CNG A;  4QIB A;  3L4H A;  1EG4 A;  1WMV A;  4U84 A;  3KAD A;  1YW5 A;  2DWV A;  5CQ2 A;  5AHT A;  2JXW A;  1I5H W;  2YSI A;  2ZAJ A;  3MQG A;  4REX A;  2OWO A;  2EZ5 W;  2XP4 A;  5E5W A;  5U47 A;  4U85 A;  2ZR5 A;  3ODK A;  2XP9 A;  3FSC A;  2ZQV A;  2WAD A;  3LKX B;  2M3O W;  3KAI A;  2E45 A;  2BA1 A;  2L4J A;  2LAJ A;  1JMQ A;  3OOB A;  2JX8 A;  1PIN A;  2M8J A;  2DMV A;  2Y8N B;  2XP6 A;  2YAJ B;  3PQH A;  2YSB A;  2XP5 A;  5E64 A;  3FSB A;  2ZR4 A;  3TC5 A;  4GLX A;  3MCB B;  3LE4 A;  2XPA A;  4A0U A;  5E62 A;  4E5R A;  1RP5 A;  3LKX A;  2DK7 A;  2XPB A;  1O6W A;  5E65 A;  2DK1 A;  3KCE A;  2XP7 A;  2YSG A;  1TK7 A;  2M8I A;  3NTP A;  2KXQ A;  2DJY A;  5E66 A;  2QRV A;  2ITK A;  3KAG A;  2XP3 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...