1K9QA

Yap65 ww domain complexed to n-(n-octyl)-gpppy-nh2
Total Genus 4
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
4
sequence length
40
structure length
40
Chain Sequence
FEIPDDVPLPAGWEMAKTSSGQRYFLNHIDQTTTWQDPRK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Structural protein
molecule keywords 65 kDa Yes-associated protein
publication title Solution structures of the YAP65 WW domain and the variant L30 K in complex with the peptides GTPPPPYTVG, N-(n-octyl)-GPPPY and PLPPY and the application of peptide libraries reveal a minimal binding epitope.
pubmed doi rcsb
total genus 4
structure length 40
sequence length 40
ec nomenclature
pdb deposition date 2001-10-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00397 WW WW domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.20.70.10 Mainly Beta Single Sheet Ubiquitin Ligase Nedd4; Chain: W; Ubiquitin Ligase Nedd4; Chain: W; 1k9qA00
3CNGA 2DK7A 1WR7A 1TK7A 2YSBA 2ZR5A 3TDBA 5AHTA 2XP3A 2YSHA 1PINA 3TCZA 2Q5AA 2MDIA 2KXQA 2M8JA 3KAHA 2M3OW 1K9QA 1WMVA 2DK1A 1JMQA 3NTPA 3LE4A 2BA1A 2ZR6A 2L4JA 3ODKA 2JX8A 3KADA 1ZCNA 2ZQSA 4U86A 1O6WA 3KAFA 2ZQUA 4QIBA 2XP4A 2JMFA 3TC5A 2DMVA 2ITKA 2JV4A 2YSGA 2ZAJA 4U84A 2YSIA 1I5HW 2F21A 3KCEA 1K9RA 3OOBA 3KAGA 3WH0A 2E45A 1NMVA 1EG4A 4E5RA 2ZR4A 4REXA 3M85A 3M7NA 2DJYA 2XP7A 2XP6A 2ZQTA 2XPBA 2LAJA 2DWVA 2XP9A 2M8IA 1EG3A 1YW5A 1F8AB 3KABA 5CQ2A 2XP5A 4U85A 2XPAA 2RE3A 2XP8A 3KAIA 2JXWA 2ZQVA 2YSFA 3L4HA 2EZ5W
chains in the Genus database with same CATH superfamily
3CNGA 2DK7A 5E5WA 1WR7A 3MQGA 1TK7A 2YSBA 2ZR5A 3TDBA 5AHTA 2XP3A 2YSHA 1PINA 4GLXA 3TCZA 2Q5AA 2MDIA 2KXQA 2M8JA 3KAHA 5E62A 2M3OW 1K9QA 1WMVA 2DK1A 1JMQA 3NTPA 3LE4A 3LKXA 2BA1A 2ZR6A 2L4JA 3ODKA 2JX8A 3KADA 1ZCNA 2ZQSA 4U86A 1O6WA 3KAFA 2ZQUA 4QIBA 2XP4A 2JMFA 3TC5A 2DMVA 2ITKA 2JV4A 2YSGA 1TR8A 2ZAJA 3MQHA 4U84A 2QRVA 2YSIA 2WAEA 1I5HW 2F21A 3KCEA 1K9RA 5U47A 1FLCA 3KAGA 3OOBA 3WH0A 2E45A 3FS8A 1NMVA 5E64A 1EG4A 4E5RA 2ZR4A 4REXA 3M85A 5E66A 3M7NA 2DJYA 3FSCA 2XP7A 2XP6A 2Y8NB 2ZQTA 2XPBA 2LAJA 2DWVA 2XP9A 3MCBB 2M8IA 1EG3A 1YW5A 4A0TA 1F8AB 3MCBA 4A0UA 3KABA 5CQ2A 2OWOA 2XP5A 3PQHA 4U85A 2WADA 2XPAA 2RE3A 2XP8A 2YAJB 3FSBA 3KAIA 3LKXB 2JXWA 1RP5A 2ZQVA 2YSFA 5E65A 3L4HA 2EZ5W
chains in the Genus database with same CATH topology
3CNGA 2DK7A 5E5WA 1WR7A 3MQGA 1TK7A 2YSBA 2ZR5A 3TDBA 5AHTA 2XP3A 2YSHA 1PINA 4GLXA 3TCZA 2Q5AA 2MDIA 2KXQA 2M8JA 3KAHA 5E62A 2M3OW 1K9QA 1WMVA 2DK1A 1JMQA 3NTPA 3LE4A 3LKXA 2BA1A 2ZR6A 2L4JA 3ODKA 2JX8A 3KADA 1ZCNA 2ZQSA 4U86A 1O6WA 3KAFA 2ZQUA 4QIBA 2XP4A 2JMFA 3TC5A 2DMVA 2ITKA 2JV4A 2YSGA 1TR8A 2ZAJA 3MQHA 4U84A 2QRVA 2YSIA 2WAEA 1I5HW 2F21A 3KCEA 1K9RA 5U47A 1FLCA 3KAGA 3OOBA 3WH0A 2E45A 3FS8A 1NMVA 5E64A 1EG4A 4E5RA 2ZR4A 4REXA 3M85A 5E66A 3M7NA 2DJYA 3FSCA 2XP7A 2XP6A 2Y8NB 2ZQTA 2XPBA 2LAJA 2DWVA 2XP9A 3MCBB 2M8IA 1EG3A 1YW5A 4A0TA 1F8AB 3MCBA 4A0UA 3KABA 5CQ2A 2OWOA 2XP5A 3PQHA 4U85A 2WADA 2XPAA 2RE3A 2XP8A 2YAJB 3FSBA 3KAIA 3LKXB 2JXWA 1RP5A 2ZQVA 2YSFA 5E65A 3L4HA 2EZ5W
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3CNG A;  2DK7 A;  1WR7 A;  1TK7 A;  2YSB A;  2ZR5 A;  3TDB A;  5AHT A;  2XP3 A;  2YSH A;  1PIN A;  3TCZ A;  2Q5A A;  2MDI A;  2KXQ A;  2M8J A;  3KAH A;  2M3O W;  1K9Q A;  1WMV A;  2DK1 A;  1JMQ A;  3NTP A;  3LE4 A;  2BA1 A;  2ZR6 A;  2L4J A;  3ODK A;  2JX8 A;  3KAD A;  1ZCN A;  2ZQS A;  4U86 A;  1O6W A;  3KAF A;  2ZQU A;  4QIB A;  2XP4 A;  2JMF A;  3TC5 A;  2DMV A;  2ITK A;  2JV4 A;  2YSG A;  2ZAJ A;  4U84 A;  2YSI A;  1I5H W;  2F21 A;  3KCE A;  1K9R A;  3OOB A;  3KAG A;  3WH0 A;  2E45 A;  1NMV A;  1EG4 A;  4E5R A;  2ZR4 A;  4REX A;  3M85 A;  3M7N A;  2DJY A;  2XP7 A;  2XP6 A;  2ZQT A;  2XPB A;  2LAJ A;  2DWV A;  2XP9 A;  2M8I A;  1EG3 A;  1YW5 A;  1F8A B;  3KAB A;  5CQ2 A;  2XP5 A;  4U85 A;  2XPA A;  2RE3 A;  2XP8 A;  3KAI A;  2JXW A;  2ZQV A;  2YSF A;  3L4H A;  2EZ5 W; 
#chains in the Genus database with same CATH topology
 3CNG A;  2DK7 A;  5E5W A;  1WR7 A;  3MQG A;  1TK7 A;  2YSB A;  2ZR5 A;  3TDB A;  5AHT A;  2XP3 A;  2YSH A;  1PIN A;  4GLX A;  3TCZ A;  2Q5A A;  2MDI A;  2KXQ A;  2M8J A;  3KAH A;  5E62 A;  2M3O W;  1K9Q A;  1WMV A;  2DK1 A;  1JMQ A;  3NTP A;  3LE4 A;  3LKX A;  2BA1 A;  2ZR6 A;  2L4J A;  3ODK A;  2JX8 A;  3KAD A;  1ZCN A;  2ZQS A;  4U86 A;  1O6W A;  3KAF A;  2ZQU A;  4QIB A;  2XP4 A;  2JMF A;  3TC5 A;  2DMV A;  2ITK A;  2JV4 A;  2YSG A;  1TR8 A;  2ZAJ A;  3MQH A;  4U84 A;  2QRV A;  2YSI A;  2WAE A;  1I5H W;  2F21 A;  3KCE A;  1K9R A;  5U47 A;  1FLC A;  3KAG A;  3OOB A;  3WH0 A;  2E45 A;  3FS8 A;  1NMV A;  5E64 A;  1EG4 A;  4E5R A;  2ZR4 A;  4REX A;  3M85 A;  5E66 A;  3M7N A;  2DJY A;  3FSC A;  2XP7 A;  2XP6 A;  2Y8N B;  2ZQT A;  2XPB A;  2LAJ A;  2DWV A;  2XP9 A;  3MCB B;  2M8I A;  1EG3 A;  1YW5 A;  4A0T A;  1F8A B;  3MCB A;  4A0U A;  3KAB A;  5CQ2 A;  2OWO A;  2XP5 A;  3PQH A;  4U85 A;  2WAD A;  2XPA A;  2RE3 A;  2XP8 A;  2YAJ B;  3FSB A;  3KAI A;  3LKX B;  2JXW A;  1RP5 A;  2ZQV A;  2YSF A;  5E65 A;  3L4H A;  2EZ5 W; 
#chains in the Genus database with same CATH homology
 3CNG A;  2DK7 A;  5E5W A;  1WR7 A;  3MQG A;  1TK7 A;  2YSB A;  2ZR5 A;  3TDB A;  5AHT A;  2XP3 A;  2YSH A;  1PIN A;  4GLX A;  3TCZ A;  2Q5A A;  2MDI A;  2KXQ A;  2M8J A;  3KAH A;  5E62 A;  2M3O W;  1K9Q A;  1WMV A;  2DK1 A;  1JMQ A;  3NTP A;  3LE4 A;  3LKX A;  2BA1 A;  2ZR6 A;  2L4J A;  3ODK A;  2JX8 A;  3KAD A;  1ZCN A;  2ZQS A;  4U86 A;  1O6W A;  3KAF A;  2ZQU A;  4QIB A;  2XP4 A;  2JMF A;  3TC5 A;  2DMV A;  2ITK A;  2JV4 A;  2YSG A;  1TR8 A;  2ZAJ A;  3MQH A;  4U84 A;  2QRV A;  2YSI A;  2WAE A;  1I5H W;  2F21 A;  3KCE A;  1K9R A;  5U47 A;  1FLC A;  3KAG A;  3OOB A;  3WH0 A;  2E45 A;  3FS8 A;  1NMV A;  5E64 A;  1EG4 A;  4E5R A;  2ZR4 A;  4REX A;  3M85 A;  5E66 A;  3M7N A;  2DJY A;  3FSC A;  2XP7 A;  2XP6 A;  2Y8N B;  2ZQT A;  2XPB A;  2LAJ A;  2DWV A;  2XP9 A;  3MCB B;  2M8I A;  1EG3 A;  1YW5 A;  4A0T A;  1F8A B;  3MCB A;  4A0U A;  3KAB A;  5CQ2 A;  2OWO A;  2XP5 A;  3PQH A;  4U85 A;  2WAD A;  2XPA A;  2RE3 A;  2XP8 A;  2YAJ B;  3FSB A;  3KAI A;  3LKX B;  2JXW A;  1RP5 A;  2ZQV A;  2YSF A;  5E65 A;  3L4H A;  2EZ5 W; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...