3LKXA

Human nac dimerization domain
Total Genus 10
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
10
sequence length
66
structure length
65
Chain Sequence
VNNISGIEEVNMFTNQGTVIHFNNPKVQASLANTFTITGHAETKQLTEMLPSILNQLGADSLTSL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Transcription factor BTF3
publication title The crystal structure of the human nascent polypeptide-associated complex domain reveals a nucleic acid-binding region on the NACA subunit
pubmed doi rcsb
source organism Homo sapiens
molecule tags Chaperone
total genus 10
structure length 65
sequence length 66
ec nomenclature
pdb deposition date 2010-01-28
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.20.70.30 Mainly Beta Single Sheet Ubiquitin Ligase Nedd4; Chain: W; Ubiquitin Ligase Nedd4; Chain: W; 3lkxA00
3LKXB 3MCBA 1TR8A 3MCBB 3LKXA
chains in the Genus database with same CATH superfamily
2XP5A 5E62A 2JMFA 3CNGA 2YSIA 2M8JA 3MCBB 4U86A 2DWVA 3TC5A 2L4JA 2Q5AA 2F21A 2ZQVA 1FLCA 1I5HW 2M3OW 2XPBA 1RP5A 1TK7A 2ZQSA 3FSCA 2DJYA 2YSFA 5E65A 2JXWA 4U84A 2XP8A 3M7NA 3KCEA 3TDBA 1ZCNA 2Y8NB 2WADA 2MDIA 3PQHA 1O6WA 2JV4A 2BA1A 3FSBA 2QRVA 2OWOA 3LKXB 3LE4A 1WR7A 2EZ5W 5CQ2A 2YSBA 2DMVA 2YSGA 2ZQUA 3NTPA 3MCBA 1F8AB 1TR8A 2DK7A 1YW5A 2XP6A 4GLXA 5U47A 3KAIA 2ZR5A 3KAGA 2M8IA 2XPAA 3TCZA 2ZQTA 5E64A 3MQGA 3ODKA 2E45A 5E5WA 3MQHA 4REXA 3KAFA 4U85A 4A0UA 3L4HA 2JX8A 4A0TA 1EG4A 1K9RA 3KAHA 4QIBA 3WH0A 3KABA 2XP7A 2YSHA 1K9QA 2ZR6A 1NMVA 2XP9A 2ZAJA 2DK1A 2KXQA 2XP3A 1EG3A 5E66A 3LKXA 2RE3A 1WMVA 3M85A 4E5RA 2ITKA 1JMQA 5AHTA 2ZR4A 3OOBA 2WAEA 1PINA 3FS8A 2LAJA 2YAJB 3KADA 2XP4A
chains in the Genus database with same CATH topology
2XP5A 5E62A 2JMFA 3CNGA 2YSIA 2M8JA 3MCBB 4U86A 2DWVA 3TC5A 2L4JA 2Q5AA 2F21A 2ZQVA 1FLCA 1I5HW 2M3OW 2XPBA 1RP5A 1TK7A 2ZQSA 3FSCA 2DJYA 2YSFA 5E65A 2JXWA 4U84A 2XP8A 3M7NA 3KCEA 3TDBA 1ZCNA 2Y8NB 2WADA 2MDIA 3PQHA 1O6WA 2JV4A 2BA1A 3FSBA 2QRVA 2OWOA 3LKXB 3LE4A 1WR7A 2EZ5W 5CQ2A 2YSBA 2DMVA 2YSGA 2ZQUA 3NTPA 3MCBA 1F8AB 1TR8A 2DK7A 1YW5A 2XP6A 4GLXA 5U47A 3KAIA 2ZR5A 3KAGA 2M8IA 2XPAA 3TCZA 2ZQTA 5E64A 3MQGA 3ODKA 2E45A 5E5WA 3MQHA 4REXA 3KAFA 4U85A 4A0UA 3L4HA 2JX8A 4A0TA 1EG4A 1K9RA 3KAHA 4QIBA 3WH0A 3KABA 2XP7A 2YSHA 1K9QA 2ZR6A 1NMVA 2XP9A 2ZAJA 2DK1A 2KXQA 2XP3A 1EG3A 5E66A 3LKXA 2RE3A 1WMVA 3M85A 4E5RA 2ITKA 1JMQA 5AHTA 2ZR4A 3OOBA 2WAEA 1PINA 3FS8A 2LAJA 2YAJB 3KADA 2XP4A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3LKX B;  3MCB A;  1TR8 A;  3MCB B;  3LKX A; 
#chains in the Genus database with same CATH topology
 2XP5 A;  5E62 A;  2JMF A;  3CNG A;  2YSI A;  2M8J A;  3MCB B;  4U86 A;  2DWV A;  3TC5 A;  2L4J A;  2Q5A A;  2F21 A;  2ZQV A;  1FLC A;  1I5H W;  2M3O W;  2XPB A;  1RP5 A;  1TK7 A;  2ZQS A;  3FSC A;  2DJY A;  2YSF A;  5E65 A;  2JXW A;  4U84 A;  2XP8 A;  3M7N A;  3KCE A;  3TDB A;  1ZCN A;  2Y8N B;  2WAD A;  2MDI A;  3PQH A;  1O6W A;  2JV4 A;  2BA1 A;  3FSB A;  2QRV A;  2OWO A;  3LKX B;  3LE4 A;  1WR7 A;  2EZ5 W;  5CQ2 A;  2YSB A;  2DMV A;  2YSG A;  2ZQU A;  3NTP A;  3MCB A;  1F8A B;  1TR8 A;  2DK7 A;  1YW5 A;  2XP6 A;  4GLX A;  5U47 A;  3KAI A;  2ZR5 A;  3KAG A;  2M8I A;  2XPA A;  3TCZ A;  2ZQT A;  5E64 A;  3MQG A;  3ODK A;  2E45 A;  5E5W A;  3MQH A;  4REX A;  3KAF A;  4U85 A;  4A0U A;  3L4H A;  2JX8 A;  4A0T A;  1EG4 A;  1K9R A;  3KAH A;  4QIB A;  3WH0 A;  3KAB A;  2XP7 A;  2YSH A;  1K9Q A;  2ZR6 A;  1NMV A;  2XP9 A;  2ZAJ A;  2DK1 A;  2KXQ A;  2XP3 A;  1EG3 A;  5E66 A;  3LKX A;  2RE3 A;  1WMV A;  3M85 A;  4E5R A;  2ITK A;  1JMQ A;  5AHT A;  2ZR4 A;  3OOB A;  2WAE A;  1PIN A;  3FS8 A;  2LAJ A;  2YAJ B;  3KAD A;  2XP4 A; 
#chains in the Genus database with same CATH homology
 2XP5 A;  5E62 A;  2JMF A;  3CNG A;  2YSI A;  2M8J A;  3MCB B;  4U86 A;  2DWV A;  3TC5 A;  2L4J A;  2Q5A A;  2F21 A;  2ZQV A;  1FLC A;  1I5H W;  2M3O W;  2XPB A;  1RP5 A;  1TK7 A;  2ZQS A;  3FSC A;  2DJY A;  2YSF A;  5E65 A;  2JXW A;  4U84 A;  2XP8 A;  3M7N A;  3KCE A;  3TDB A;  1ZCN A;  2Y8N B;  2WAD A;  2MDI A;  3PQH A;  1O6W A;  2JV4 A;  2BA1 A;  3FSB A;  2QRV A;  2OWO A;  3LKX B;  3LE4 A;  1WR7 A;  2EZ5 W;  5CQ2 A;  2YSB A;  2DMV A;  2YSG A;  2ZQU A;  3NTP A;  3MCB A;  1F8A B;  1TR8 A;  2DK7 A;  1YW5 A;  2XP6 A;  4GLX A;  5U47 A;  3KAI A;  2ZR5 A;  3KAG A;  2M8I A;  2XPA A;  3TCZ A;  2ZQT A;  5E64 A;  3MQG A;  3ODK A;  2E45 A;  5E5W A;  3MQH A;  4REX A;  3KAF A;  4U85 A;  4A0U A;  3L4H A;  2JX8 A;  4A0T A;  1EG4 A;  1K9R A;  3KAH A;  4QIB A;  3WH0 A;  3KAB A;  2XP7 A;  2YSH A;  1K9Q A;  2ZR6 A;  1NMV A;  2XP9 A;  2ZAJ A;  2DK1 A;  2KXQ A;  2XP3 A;  1EG3 A;  5E66 A;  3LKX A;  2RE3 A;  1WMV A;  3M85 A;  4E5R A;  2ITK A;  1JMQ A;  5AHT A;  2ZR4 A;  3OOB A;  2WAE A;  1PIN A;  3FS8 A;  2LAJ A;  2YAJ B;  3KAD A;  2XP4 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...