3LKXA

Human nac dimerization domain
Total Genus 10
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
10
sequence length
66
structure length
65
Chain Sequence
VNNISGIEEVNMFTNQGTVIHFNNPKVQASLANTFTITGHAETKQLTEMLPSILNQLGADSLTSL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Transcription factor BTF3
publication title The crystal structure of the human nascent polypeptide-associated complex domain reveals a nucleic acid-binding region on the NACA subunit
pubmed doi rcsb
source organism Homo sapiens
molecule tags Chaperone
total genus 10
structure length 65
sequence length 66
ec nomenclature
pdb deposition date 2010-01-28
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.20.70.30 Mainly Beta Single Sheet Ubiquitin Ligase Nedd4; Chain: W; Ubiquitin Ligase Nedd4; Chain: W; 3lkxA00
3LKXB 3MCBB 3LKXA 1TR8A 3MCBA
chains in the Genus database with same CATH superfamily
3ODKA 2XPBA 3KAHA 3MQGA 3OOBA 2YSHA 4U86A 2JXWA 3TC5A 4U84A 3M85A 4REXA 2ZQVA 4A0TA 2WAEA 5U47A 1RP5A 2XP3A 2ZQUA 2M3OW 2ZR4A 2WADA 2Y8NB 2EZ5W 2DWVA 3FSBA 3TDBA 5CQ2A 2ZR5A 2JV4A 2XP6A 3FSCA 2QRVA 5E62A 2YSIA 1I5HW 2L4JA 3MQHA 1K9QA 3LE4A 1ZCNA 2DK7A 1PINA 3KCEA 2ZQSA 1WR7A 1TK7A 2XP9A 3KAIA 5E65A 2YAJB 5E64A 4A0UA 2BA1A 4E5RA 1YW5A 4GLXA 2MDIA 1NMVA 2DJYA 1EG3A 2F21A 1F8AB 5E66A 5AHTA 2LAJA 3FS8A 2XP8A 4QIBA 2XP5A 2XPAA 3M7NA 2YSGA 1WMVA 3KAFA 2YSBA 2RE3A 2M8JA 1K9RA 3KABA 2Q5AA 3WH0A 2XP4A 2YSFA 2JMFA 4U85A 1JMQA 2ZR6A 5E5WA 3KAGA 2ITKA 3LKXB 3MCBB 3L4HA 3LKXA 1TR8A 3MCBA 2DMVA 2E45A 2ZAJA 1O6WA 3NTPA 3KADA 2DK1A 1EG4A 3CNGA 2JX8A 3PQHA 1FLCA 2OWOA 2XP7A 2ZQTA 2KXQA 2M8IA 3TCZA
chains in the Genus database with same CATH topology
3ODKA 2XPBA 3KAHA 3MQGA 3OOBA 2YSHA 4U86A 2JXWA 3TC5A 4U84A 3M85A 4REXA 2ZQVA 4A0TA 2WAEA 5U47A 1RP5A 2XP3A 2ZQUA 2M3OW 2ZR4A 2WADA 2Y8NB 2EZ5W 2DWVA 3FSBA 3TDBA 5CQ2A 2ZR5A 2JV4A 2XP6A 3FSCA 2QRVA 5E62A 2YSIA 1I5HW 2L4JA 3MQHA 1K9QA 3LE4A 1ZCNA 2DK7A 1PINA 3KCEA 2ZQSA 1WR7A 1TK7A 2XP9A 3KAIA 5E65A 2YAJB 5E64A 4A0UA 2BA1A 4E5RA 1YW5A 4GLXA 2MDIA 1NMVA 2DJYA 1EG3A 2F21A 1F8AB 5E66A 5AHTA 2LAJA 3FS8A 2XP8A 4QIBA 2XP5A 2XPAA 3M7NA 2YSGA 1WMVA 3KAFA 2YSBA 2RE3A 2M8JA 1K9RA 3KABA 2Q5AA 3WH0A 2XP4A 2YSFA 2JMFA 4U85A 1JMQA 2ZR6A 5E5WA 3KAGA 2ITKA 3LKXB 3MCBB 3L4HA 3LKXA 1TR8A 3MCBA 2DMVA 2E45A 2ZAJA 1O6WA 3NTPA 3KADA 2DK1A 1EG4A 3CNGA 2JX8A 3PQHA 1FLCA 2OWOA 2XP7A 2ZQTA 2KXQA 2M8IA 3TCZA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3LKX B;  3MCB B;  3LKX A;  1TR8 A;  3MCB A; 
#chains in the Genus database with same CATH topology
 3ODK A;  2XPB A;  3KAH A;  3MQG A;  3OOB A;  2YSH A;  4U86 A;  2JXW A;  3TC5 A;  4U84 A;  3M85 A;  4REX A;  2ZQV A;  4A0T A;  2WAE A;  5U47 A;  1RP5 A;  2XP3 A;  2ZQU A;  2M3O W;  2ZR4 A;  2WAD A;  2Y8N B;  2EZ5 W;  2DWV A;  3FSB A;  3TDB A;  5CQ2 A;  2ZR5 A;  2JV4 A;  2XP6 A;  3FSC A;  2QRV A;  5E62 A;  2YSI A;  1I5H W;  2L4J A;  3MQH A;  1K9Q A;  3LE4 A;  1ZCN A;  2DK7 A;  1PIN A;  3KCE A;  2ZQS A;  1WR7 A;  1TK7 A;  2XP9 A;  3KAI A;  5E65 A;  2YAJ B;  5E64 A;  4A0U A;  2BA1 A;  4E5R A;  1YW5 A;  4GLX A;  2MDI A;  1NMV A;  2DJY A;  1EG3 A;  2F21 A;  1F8A B;  5E66 A;  5AHT A;  2LAJ A;  3FS8 A;  2XP8 A;  4QIB A;  2XP5 A;  2XPA A;  3M7N A;  2YSG A;  1WMV A;  3KAF A;  2YSB A;  2RE3 A;  2M8J A;  1K9R A;  3KAB A;  2Q5A A;  3WH0 A;  2XP4 A;  2YSF A;  2JMF A;  4U85 A;  1JMQ A;  2ZR6 A;  5E5W A;  3KAG A;  2ITK A;  3LKX B;  3MCB B;  3L4H A;  3LKX A;  1TR8 A;  3MCB A;  2DMV A;  2E45 A;  2ZAJ A;  1O6W A;  3NTP A;  3KAD A;  2DK1 A;  1EG4 A;  3CNG A;  2JX8 A;  3PQH A;  1FLC A;  2OWO A;  2XP7 A;  2ZQT A;  2KXQ A;  2M8I A;  3TCZ A; 
#chains in the Genus database with same CATH homology
 3ODK A;  2XPB A;  3KAH A;  3MQG A;  3OOB A;  2YSH A;  4U86 A;  2JXW A;  3TC5 A;  4U84 A;  3M85 A;  4REX A;  2ZQV A;  4A0T A;  2WAE A;  5U47 A;  1RP5 A;  2XP3 A;  2ZQU A;  2M3O W;  2ZR4 A;  2WAD A;  2Y8N B;  2EZ5 W;  2DWV A;  3FSB A;  3TDB A;  5CQ2 A;  2ZR5 A;  2JV4 A;  2XP6 A;  3FSC A;  2QRV A;  5E62 A;  2YSI A;  1I5H W;  2L4J A;  3MQH A;  1K9Q A;  3LE4 A;  1ZCN A;  2DK7 A;  1PIN A;  3KCE A;  2ZQS A;  1WR7 A;  1TK7 A;  2XP9 A;  3KAI A;  5E65 A;  2YAJ B;  5E64 A;  4A0U A;  2BA1 A;  4E5R A;  1YW5 A;  4GLX A;  2MDI A;  1NMV A;  2DJY A;  1EG3 A;  2F21 A;  1F8A B;  5E66 A;  5AHT A;  2LAJ A;  3FS8 A;  2XP8 A;  4QIB A;  2XP5 A;  2XPA A;  3M7N A;  2YSG A;  1WMV A;  3KAF A;  2YSB A;  2RE3 A;  2M8J A;  1K9R A;  3KAB A;  2Q5A A;  3WH0 A;  2XP4 A;  2YSF A;  2JMF A;  4U85 A;  1JMQ A;  2ZR6 A;  5E5W A;  3KAG A;  2ITK A;  3LKX B;  3MCB B;  3L4H A;  3LKX A;  1TR8 A;  3MCB A;  2DMV A;  2E45 A;  2ZAJ A;  1O6W A;  3NTP A;  3KAD A;  2DK1 A;  1EG4 A;  3CNG A;  2JX8 A;  3PQH A;  1FLC A;  2OWO A;  2XP7 A;  2ZQT A;  2KXQ A;  2M8I A;  3TCZ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...