3LKXA

Human nac dimerization domain
Total Genus 10
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
10
sequence length
66
structure length
65
Chain Sequence
VNNISGIEEVNMFTNQGTVIHFNNPKVQASLANTFTITGHAETKQLTEMLPSILNQLGADSLTSL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Chaperone
molecule keywords Transcription factor BTF3
publication title The crystal structure of the human nascent polypeptide-associated complex domain reveals a nucleic acid-binding region on the NACA subunit
pubmed doi rcsb
source organism Homo sapiens
total genus 10
structure length 65
sequence length 66
ec nomenclature
pdb deposition date 2010-01-28
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.20.70.30 Mainly Beta Single Sheet Ubiquitin Ligase Nedd4; Chain: W; Ubiquitin Ligase Nedd4; Chain: W; 3lkxA00
1TR8A 3MCBA 3LKXA 3MCBB 3LKXB
chains in the Genus database with same CATH superfamily
1K9QA 1RP5A 5E65A 2ZQVA 2DK1A 3KCEA 2XPAA 1JMQA 3KAIA 4A0TA 2ITKA 3M7NA 2ZAJA 2M8JA 1ZCNA 1I5HW 3FS8A 3PQHA 2F21A 3NTPA 4GLXA 2JV4A 2YSHA 2WAEA 2XP8A 2YSIA 3KABA 3KAFA 2ZR6A 2QRVA 3ODKA 2XPBA 2JX8A 1TK7A 2JXWA 2L4JA 4U86A 5AHTA 2YSFA 2OWOA 2JMFA 2DMVA 2ZQSA 2M8IA 3MCBB 2ZR4A 3TDBA 5CQ2A 2M3OW 2LAJA 1EG3A 3L4HA 1FLCA 2XP7A 3CNGA 3FSBA 3LKXB 3KAHA 2DWVA 3KADA 5U47A 4A0UA 5E66A 3WH0A 3MCBA 2BA1A 4REXA 2XP4A 2YAJB 1PINA 1O6WA 4U85A 4QIBA 5E64A 2XP5A 2ZQUA 3LKXA 3OOBA 2DJYA 2ZR5A 2DK7A 1TR8A 2RE3A 2ZQTA 4U84A 3MQHA 1EG4A 1NMVA 3KAGA 5E62A 2E45A 1WR7A 2XP9A 2EZ5W 4E5RA 3FSCA 2YSGA 1WMVA 3LE4A 3MQGA 2YSBA 2KXQA 2MDIA 3TC5A 5E5WA 3TCZA 1YW5A 2XP3A 2WADA 1F8AB 2XP6A 1K9RA 2Y8NB 2Q5AA 3M85A
chains in the Genus database with same CATH topology
1K9QA 1RP5A 5E65A 2ZQVA 2DK1A 3KCEA 2XPAA 1JMQA 3KAIA 4A0TA 2ITKA 3M7NA 2ZAJA 2M8JA 1ZCNA 1I5HW 3FS8A 3PQHA 2F21A 3NTPA 4GLXA 2JV4A 2YSHA 2WAEA 2XP8A 2YSIA 3KABA 3KAFA 2ZR6A 2QRVA 3ODKA 2XPBA 2JX8A 1TK7A 2JXWA 2L4JA 4U86A 5AHTA 2YSFA 2OWOA 2JMFA 2DMVA 2ZQSA 2M8IA 3MCBB 2ZR4A 3TDBA 5CQ2A 2M3OW 2LAJA 1EG3A 3L4HA 1FLCA 2XP7A 3CNGA 3FSBA 3LKXB 3KAHA 2DWVA 3KADA 5U47A 4A0UA 5E66A 3WH0A 3MCBA 2BA1A 4REXA 2XP4A 2YAJB 1PINA 1O6WA 4U85A 4QIBA 5E64A 2XP5A 2ZQUA 3LKXA 3OOBA 2DJYA 2ZR5A 2DK7A 1TR8A 2RE3A 2ZQTA 4U84A 3MQHA 1EG4A 1NMVA 3KAGA 5E62A 2E45A 1WR7A 2XP9A 2EZ5W 4E5RA 3FSCA 2YSGA 1WMVA 3LE4A 3MQGA 2YSBA 2KXQA 2MDIA 3TC5A 5E5WA 3TCZA 1YW5A 2XP3A 2WADA 1F8AB 2XP6A 1K9RA 2Y8NB 2Q5AA 3M85A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1TR8 A;  3MCB A;  3LKX A;  3MCB B;  3LKX B; 
#chains in the Genus database with same CATH topology
 1K9Q A;  1RP5 A;  5E65 A;  2ZQV A;  2DK1 A;  3KCE A;  2XPA A;  1JMQ A;  3KAI A;  4A0T A;  2ITK A;  3M7N A;  2ZAJ A;  2M8J A;  1ZCN A;  1I5H W;  3FS8 A;  3PQH A;  2F21 A;  3NTP A;  4GLX A;  2JV4 A;  2YSH A;  2WAE A;  2XP8 A;  2YSI A;  3KAB A;  3KAF A;  2ZR6 A;  2QRV A;  3ODK A;  2XPB A;  2JX8 A;  1TK7 A;  2JXW A;  2L4J A;  4U86 A;  5AHT A;  2YSF A;  2OWO A;  2JMF A;  2DMV A;  2ZQS A;  2M8I A;  3MCB B;  2ZR4 A;  3TDB A;  5CQ2 A;  2M3O W;  2LAJ A;  1EG3 A;  3L4H A;  1FLC A;  2XP7 A;  3CNG A;  3FSB A;  3LKX B;  3KAH A;  2DWV A;  3KAD A;  5U47 A;  4A0U A;  5E66 A;  3WH0 A;  3MCB A;  2BA1 A;  4REX A;  2XP4 A;  2YAJ B;  1PIN A;  1O6W A;  4U85 A;  4QIB A;  5E64 A;  2XP5 A;  2ZQU A;  3LKX A;  3OOB A;  2DJY A;  2ZR5 A;  2DK7 A;  1TR8 A;  2RE3 A;  2ZQT A;  4U84 A;  3MQH A;  1EG4 A;  1NMV A;  3KAG A;  5E62 A;  2E45 A;  1WR7 A;  2XP9 A;  2EZ5 W;  4E5R A;  3FSC A;  2YSG A;  1WMV A;  3LE4 A;  3MQG A;  2YSB A;  2KXQ A;  2MDI A;  3TC5 A;  5E5W A;  3TCZ A;  1YW5 A;  2XP3 A;  2WAD A;  1F8A B;  2XP6 A;  1K9R A;  2Y8N B;  2Q5A A;  3M85 A; 
#chains in the Genus database with same CATH homology
 1K9Q A;  1RP5 A;  5E65 A;  2ZQV A;  2DK1 A;  3KCE A;  2XPA A;  1JMQ A;  3KAI A;  4A0T A;  2ITK A;  3M7N A;  2ZAJ A;  2M8J A;  1ZCN A;  1I5H W;  3FS8 A;  3PQH A;  2F21 A;  3NTP A;  4GLX A;  2JV4 A;  2YSH A;  2WAE A;  2XP8 A;  2YSI A;  3KAB A;  3KAF A;  2ZR6 A;  2QRV A;  3ODK A;  2XPB A;  2JX8 A;  1TK7 A;  2JXW A;  2L4J A;  4U86 A;  5AHT A;  2YSF A;  2OWO A;  2JMF A;  2DMV A;  2ZQS A;  2M8I A;  3MCB B;  2ZR4 A;  3TDB A;  5CQ2 A;  2M3O W;  2LAJ A;  1EG3 A;  3L4H A;  1FLC A;  2XP7 A;  3CNG A;  3FSB A;  3LKX B;  3KAH A;  2DWV A;  3KAD A;  5U47 A;  4A0U A;  5E66 A;  3WH0 A;  3MCB A;  2BA1 A;  4REX A;  2XP4 A;  2YAJ B;  1PIN A;  1O6W A;  4U85 A;  4QIB A;  5E64 A;  2XP5 A;  2ZQU A;  3LKX A;  3OOB A;  2DJY A;  2ZR5 A;  2DK7 A;  1TR8 A;  2RE3 A;  2ZQT A;  4U84 A;  3MQH A;  1EG4 A;  1NMV A;  3KAG A;  5E62 A;  2E45 A;  1WR7 A;  2XP9 A;  2EZ5 W;  4E5R A;  3FSC A;  2YSG A;  1WMV A;  3LE4 A;  3MQG A;  2YSB A;  2KXQ A;  2MDI A;  3TC5 A;  5E5W A;  3TCZ A;  1YW5 A;  2XP3 A;  2WAD A;  1F8A B;  2XP6 A;  1K9R A;  2Y8N B;  2Q5A A;  3M85 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...