2XP4A

Discovery of cell-active phenyl-imidazole pin1 inhibitors by structure-guided fragment evolution
Total Genus 46
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
46
sequence length
157
structure length
144
Chain Sequence
LPPGWEKAMSRSSGRVYYFNHITNASQWERPEPARVRCSHLLVKHSQSRRPSSWRQEKITRTKEEALELINGYIQKIKSGEEDFESLASQFSDCSSAKARGDLGAFSRGQMQKPFEDASFALRTGEMSGPVFTDSGIHIILRTE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Discovery of Cell-Active Phenyl-Imidazole Pin1 Inhibitors by Structure-Guided Fragment Evolution.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Isomerase
molecule keywords PEPTIDYL-PROLYL CIS-TRANS ISOMERASE NIMA-INTERACTING 1
total genus 46
structure length 144
sequence length 157
ec nomenclature ec 5.2.1.8: Peptidylprolyl isomerase.
pdb deposition date 2010-08-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00397 WW WW domain
A PF00639 Rotamase PPIC-type PPIASE domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.20.70.10 Mainly Beta Single Sheet Ubiquitin Ligase Nedd4; Chain: W; Ubiquitin Ligase Nedd4; Chain: W; 2xp4A01
3.10.50.40 Alpha Beta Roll Chitinase A; domain 3 Chitinase A; domain 3 2xp4A02
4C02B 4ODKA 2BA1A 4DRKA 3MDYB 4DRNA 2ZR5A 3O5GA 2Y78A 2XP4A 2PV3A 5I98A 2Q5AA 3KADA 3O5QA 5HWCA 2YSHA 2OFNA 3KABA 3KACA 5DITA 2RQSA 2KR7A 4JFIA 4ODLA 1JMQA 2KI3A 5DIVA 2LAJA 3OOBA 3LUOA 1D7IA 4LAYA 4DROA 1ZCNA 5HW8A 2M2AA 2F21A 2ITKA 3LE4A 3M85A 3O5PA 3UF8A 2DWVA 2RUDA 3JXVA 4IQCA 4JFKA 1EYMA 2DK1A 2YSFA 2LJ4A 2VCDA 1HXVA 1KT1A 1JVWA 4J4OA 3KCEA 4LAVA 4MGVA 4DRMA 3KAIA 2RE3A 1WMVA 2MF9A 2F2DA 3IHZA 4IQ2A 1D6OA 5D75A 4REXA 1QPLA 1Y0OA 4QIBA 1QPFA 1BKFA 2KXQA 1R9HA 4MSPA 3IKDA 3PRBA 2LKNA 4DRQA 4IPXA 1BL4A 4N19A 2RSEA 4TX0A 4BF8A 1Q6HA 2M8IA 1FKRA 4U86A 1PINA 4ITZA 4TNSA 2MLXA 4FN2A 1FKJA 1N1AA 3IK8A 1J4IA 3O5RA 4TW7A 1K9RA 4W9QA 5B8IC 1EG4A 2E45A 2XP5A 2XP9A 3CGMA 2MLZA 3NTPA 1P5QA 3KAHA 1FKKA 2YSIA 2ZAJA 2ZR6A 1FKSA 4J4NA 4ODQA 4W9PA 2DG4A 4DRIA 3O5JA 1F8AB 2KFWA 1L1PA 1D7HA 3L4HA 4G2PA 2M3OW 3KAFA 2LGOA 1FJDA 3UI6A 5AHTA 1I5HW 3O5OA 3ODKA 4U84A 2VN1A 3WH0A 2PPNA 4TW6A 4DZ3A 2DK7A 3I6CA 1FKTA 1M5YA 2IF4A 4U85A 2XP3A 2UZ5A 3KZ7A 1JNTA 2RUCA 4TW8A 1FKDA 2YSGA 4G50A 3H9RB 2F4EA 3O5EA 1T11A 2ZQUA 2N87A 3GPKA 4ODNA 1ROUA 5HKGA 3UQIA 3UQAA 3FAPA 2MPHA 3TDBA 1TCOC 2PPOA 4O2TA 3JYMA 4DRHA 2D9FA 1JNSA 2DG3A 3UQBA 2XP7A 3NI6A 3VAWA 2KGJA 3O5IA 2YSBA 2L4JA 1ZK6A 5HTGA 2RURA 4DIPA 5HUAA 4JFMA 4FAPA 5HWBA 3EY6A 2K8IA 3O5DA 2M8JA 4ODPA 2JX8A 1Q1CA 2JZVA 1YATA 1A7XA 4JYSA 4ODMA 2XPBA 3O5LA 3PRDA 2JV4A 2JXWA 1EG3A 1FKIA 1NMVA 2M08A 5GPGA 4DH0A 2PV1A 5HW6A 3RFWA 1Q6UA 2KE0A 2L2SA 2XP6A 5BXJA 1O6WA 5CQ2A 2XP8A 1FAPA 4DRJA 5HW7A 4ODRA 4JFJA 3UI5A 2DJYA 2ZQTA 1W26A 3O5MA 3O5KA 2ZR4A 4LAXA 2MDIA 1TK7A 1ROTA 1D7JA 1FD9A 2FKEA 2PPPA 5HT1A 4GIVA 1NMWA 1FKHA 2M1IA 4R0XA 1WR7A 2MLYA 3CNGA 5J6EA 3RGCA 4E5RA 4JFLA 2ZQVA 2PBCA 4QT3A 3IKGA 1PBKA 4DT4A 2JMFA 1U79A 1KT0A 1K9QA 2KO7A 2FAPA 4DRPA 1EQ3A 1J4RA 3JYJA 2ZQSA 4GGQA 4ODOA 3NRKA 4TYOA 3TC5A 2RUQA 1YW5A 2XPAA 3KAGA 3TCZA 1FKLA 1NSGA 3CGNA 3O5FA 4QT2A 1F40A 4LAWA 3M7NA 1FKGA 2MNTA 4DZ2A 2DG9A 2LPVA 4NNRA 3UI4A 2EZ5W 1QZ2A 3PA7A 3B7XA 1J6YA 1B6CA 2PV2A 1J4HA 2AWGA 1FKFA 1FKBA 4W9OA 5DIUA 2DMVA 1Q6IA 1C9HA
chains in the Genus database with same CATH superfamily
4DRKA 3CHDA 4DRNA 2ZR5A 3WKZA 3O5QA 5DITA 5DIVA 4WIWA 4QZVB 4LAYA 5HW8A 2WK2A 3B9EA 1W1PA 3KCEA 2MF9A 2F2DA 4ZPTR 1BKFA 2KXQA 4MPKA 1CTNA 2LKNA 1BL4A 2AOSA 4TX0A 5E64A 2FDMA 1EHNA 4ITZA 4XAKA 3ARWA 1N1AA 3IK8A 3O5RA 1ZBWA 1UR8A 1NWTA 4NSBA 3CGMA 1P5QA 4J4NA 2ZR6A 4W9PA 3O5JA 4LGXA 4P8UA 2M3OW 3KAFA 1FJDA 5DF0A 2VN1A 4HBEA 2IF4A 2A3EA 2UZ5A 4TW8A 3KZ7A 2RUCA 1LL4A 1GUVA 4G50A 4ODNA 1T11A 1TFVA 1W1VA 1NWUA 2PPOA 4Z2HA 3JYMA 5GQBA 2EULA 3NI6A 2PN0A 3ARTA 3WD0A 3O5IA 2YSBA 2L4JA 5HTGA 4DIPA 5HUAA 4JFMA 3O5DA 1Q1CA 5E66A 1ZU8A 1WAWA 2G41A 3W4RA 3CHEA 2JV4A 2WLYA 2QRVA 2WADA 5CQ2A 3ARVA 1HKKA 1XRVA 2DT0A 2MDIA 1SYTA 3EIPA 3BMBA 1NMWA 4R0XA 2MLYA 3CNGA 3ALGA 4Q7NA 3RGCA 4E5RA 4JFLA 4QT3A 3IKGA 2ETNA 1IX5A 2O92A 1WNOA 2B31A 1RD6A 2FAPA 3JYJA 4GGQA 5DEZA 3NRKA 1W1YA 1ZB5A 1FKLA 3CGNA 3MCBB 4LAWA 3M7NA 1FKGA 4IT4A 2DG9A 5DIUA 3PR9A 2DMVA 4IT6A 3B8SA 1FFRA 4HARA 1O6IA 2OLHA 3O5GA 3ARPA 3WD4A 2PV3A 5I98A 2Q5AA 3AS1A 3WIJA 2OFNA 3KABA 2RQSA 4JFIA 1JMQA 5HWCA 3LUOA 3RM8A 1ZCNA 2Y8NB 2M2AA 4ML4A 4KQZA 2ITKA 3LE4A 3O5PA 2DWVA 4IQCA 4JFKA 1W9UA 2YAJB 5E62A 4LAVA 3ALFA 5HBFA 4IQ2A 4ZPVR 1D6OA 5GPRA 5D75A 4REXA 1Y0OA 1R9HA 3PRBA 4UDMA 1XHGA 2RSEA 3FS8A 2QF8A 1Q6HA 4MTVA 1NWRA 3RMEA 4BF8A 4U86A 4AY1A 1FKJA 4DWSB 4P8VA 2E45A 2XP5A 1H0GA 3ARXA 2DSZA 4ODQA 2ZAJA 1L1PA 1FLCA 2DG4A 1F8AB 3OA5A 1D7HA 2O9OA 2IUZA 3FSBA 3ODKA 2PPNA 4DZ3A 3QOKA 3I6CA 4WKFA 3CHCA 1FKDA 2YSGA 3H9RB 2ZQUA 3BXWA 3UQAA 3UQIA 2YBTA 2DG3A 4DWSA 1HJWA 1ZK6A 1HJVA 3FSCA 2K8IA 2M8JA 2JZVA 1YATA 1X6NA 4JYSA 4URIA 2XPBA 3O5LA 3PRDA 2JXWA 1ZL1A 1EG3A 2M08A 3AQUA 3RFWA 1UR9A 5HW7A 1FAPA 1H0IA 4JFJA 4P8XA 4L3NA 2ZQTA 5JH8A 3FY1A 1ROTA 4C02B 1FD9A 2PPPA 4GIVA 2DPEA 1WR7A 3CHFA 1LJYA 1U79A 1EQ3A 4MNMA 3ARRA 2ZQSA 4TYOA 1D2KA 2RUQA 3TCZA 1NSGA 1F40A 3O5FA 1JNDA 2MNTA 3RM9A 4NNRA 3UI4A 2A3CA 1B6CA 2WM0A 3GU0A 1SR0A 4W9OA 1W26A 2B5UB 4ODKA 2Y78A 1E15A 4Z2LA 3B9AA 2YSHA 3AS0A 3KACA 2DT2A 4ODLA 2KI3A 2LAJA 3OOBA 4DROA 1D7IA 1LG2A 1ITXA 1HKJA 4R5EA 3UF8A 2OWOA 2DSWA 2DT1A 2DK1A 1HKIA 2VCDA 3CH9A 1HXVA 1KT1A 4J4OA 3WD2A 4MGVA 1OGBA 3KAIA 2RE3A 1JCHB 4A0UA 2WAEA 4MSPA 4DRQA 1E44A 4ZS6A 2M8IA 1FKRA 1PINA 4TNSA 4FN2A 4Z2JA 4Z2GA 1J4IA 4TW7A 1K9RA 4DWSD 3MCBA 1OGGA 2MLZA 2A3AA 1X6LA 3KAHA 1FKKA 2YSIA 4DRIA 1WB0A 4G2PA 2LGOA 3PQHA 3UI6A 4TW6A 1TR8A 4U84A 3B9DA 2DSUA 1JNTA 2F4EA 2N87A 3GPKA 5HKGA 1ROUA 3FAPA 3TDBA 4DRHA 2D9FA 4WKHA 2XP7A 3WD3A 1LL6A 4FAPA 3G6MA 5HWBA 3EY6A 4ODPA 4ODMA 5U47A 4DH0A 1JNEA 1NMVA 4WKAA 2L2SA 5BXJA 1O6WA 4DRJA 4ODRA 3UI5A 4ZPWR 3O5MA 3O5KA 1TK7A 1D7JA 5HT1A 1HKMA 1FKHA 2M1IA 5J6EA 2ZQVA 1NWSA 2JMFA 1KT0A 1K9QA 4DRPA 2A3BA 3LKXB 4S3KA 1GOIA 3TC5A 1YW5A 2XPAA 3KAGA 4QT2A 1EDQA 4DZ2A 2LPVA 3ARYA 5E65A 3B7XA 1LL7A 1EIBA 2PV2A 3AS3A 2AWGA 1OWQA 4MNLA 1GRJA 1E6PA 1C9HA 2YBUA 2ESCA 2BA1A 4A0TA 3MDYB 2XP4A 3KADA 4W5UA 1ZBVA 2F23A 2KR7A 5E5WA 1GPFA 3ARUA 2F21A 4MNKA 1E6ZA 3M85A 3WQVA 2RUDA 3JXVA 1EYMA 2LJ4A 2YSFA 1VF8A 1JVWA 1W9VA 4DRMA 4S3JA 1WMVA 3IHZA 1QPLA 4QIBA 4MNJA 3ARQA 1QPFA 4Z2KA 3IKDA 4IPXA 4N19A 3WL1A 4WK9A 3WQWA 2MLXA 1E9LA 5B8IC 4W9QA 1EG4A 2XP9A 4Z2IA 3NTPA 1FKSA 4HBOA 3RM4A 2KFWA 3L4HA 4PTMA 5AHTA 1I5HW 1FFQA 3O5OA 3WH0A 2DK7A 1FKTA 1M5YA 1K9TA 4Q22A 4U85A 2XP3A 1W9PA 5DO2A 3ARSA 3O5EA 1RP5A 2G8ZA 2MPHA 2PI6A 1TCOC 3ARZA 4O2TA 4WJXA 1JNSA 1HJXA 3UQBA 2DSVA 3G6LA 3VAWA 2KGJA 1LG1A 2RURA 3AS2A 1NH6A 2DT3A 1KFWA 2JX8A 4DWSC 1A7XA 3LKXA 2P4VA 5GPGA 1W1TA 1FKIA 5HW6A 3MQHA 2PV1A 1Q6UA 2KE0A 2XP6A 2XP8A 1E6RA 4NZCA 2DJYA 3GTYX 2ZR4A 4LAXA 4GLXA 2FKEA 3PRAA 3CZ8A 3WD1A 1ZBKA 2WLZA 4DT4A 2PBCA 1PBKA 1E6NA 2KO7A 1J4RA 4ODOA 1ZBCA 4KR0B 4P8WA 3MQGA 3AROA 2EZ5W 1QZ2A 3PA7A 1J6YA 3WL0A 1J4HA 4L72B 1FKFA 1FKBA 4MAVA 3FXYA 1Q6IA 1LQ0A
chains in the Genus database with same CATH topology
4DRKA 3CHDA 4DRNA 2ZR5A 3WKZA 3O5QA 5DITA 5DIVA 4WIWA 4QZVB 4LAYA 5HW8A 2WK2A 3B9EA 1W1PA 3KCEA 2MF9A 2F2DA 4ZPTR 1BKFA 2KXQA 4MPKA 1CTNA 2LKNA 1BL4A 2AOSA 4TX0A 5E64A 2FDMA 1EHNA 4ITZA 4XAKA 3ARWA 1N1AA 3IK8A 3O5RA 1ZBWA 1UR8A 1NWTA 4NSBA 3CGMA 1P5QA 4J4NA 2ZR6A 4W9PA 3O5JA 4LGXA 4P8UA 2M3OW 3KAFA 1FJDA 5DF0A 2VN1A 4HBEA 2IF4A 2A3EA 2UZ5A 4TW8A 3KZ7A 2RUCA 1LL4A 1GUVA 4G50A 4ODNA 1T11A 1TFVA 1W1VA 1NWUA 2PPOA 4Z2HA 3JYMA 5GQBA 3NI6A 3ARTA 3WD0A 3O5IA 2YSBA 2L4JA 5HTGA 4DIPA 5HUAA 4JFMA 3O5DA 1Q1CA 5E66A 1ZU8A 1WAWA 2G41A 3W4RA 3CHEA 2JV4A 2WLYA 2QRVA 2WADA 5CQ2A 3ARVA 1HKKA 1XRVA 2DT0A 2MDIA 1SYTA 1NMWA 4R0XA 2MLYA 3CNGA 3ALGA 4Q7NA 3RGCA 4E5RA 4JFLA 4QT3A 3IKGA 1IX5A 2O92A 1WNOA 2B31A 1RD6A 2FAPA 3JYJA 4GGQA 5DEZA 3NRKA 1W1YA 1ZB5A 1FKLA 3CGNA 3MCBB 4LAWA 3M7NA 1FKGA 4IT4A 2DG9A 5DIUA 3PR9A 2DMVA 4IT6A 3B8SA 1FFRA 4HARA 1O6IA 2OLHA 3O5GA 3ARPA 3WD4A 2PV3A 5I98A 2Q5AA 3AS1A 3WIJA 2OFNA 3KABA 2RQSA 4JFIA 1JMQA 5HWCA 3LUOA 3RM8A 1ZCNA 2Y8NB 2M2AA 4ML4A 4KQZA 2ITKA 3LE4A 3O5PA 2DWVA 4IQCA 4JFKA 1W9UA 2YAJB 5E62A 4LAVA 3ALFA 5HBFA 4IQ2A 4ZPVR 1D6OA 5GPRA 5D75A 4REXA 1Y0OA 1R9HA 3PRBA 1XHGA 2RSEA 3FS8A 2QF8A 1Q6HA 4MTVA 1NWRA 3RMEA 4BF8A 4U86A 4AY1A 1FKJA 4DWSB 4P8VA 2E45A 2XP5A 1H0GA 3ARXA 2DSZA 4ODQA 2ZAJA 1L1PA 1FLCA 2DG4A 1F8AB 3OA5A 1D7HA 2O9OA 2IUZA 3FSBA 3ODKA 2PPNA 4DZ3A 3QOKA 3I6CA 4WKFA 3CHCA 1FKDA 2YSGA 3H9RB 2ZQUA 3BXWA 3UQAA 3UQIA 2YBTA 2DG3A 4DWSA 1HJWA 1ZK6A 1HJVA 3FSCA 2K8IA 2M8JA 2JZVA 1YATA 1X6NA 4JYSA 4URIA 2XPBA 3O5LA 3PRDA 2JXWA 1ZL1A 1EG3A 2M08A 3AQUA 3RFWA 1UR9A 5HW7A 1FAPA 1H0IA 4JFJA 4P8XA 4L3NA 2ZQTA 5JH8A 3FY1A 1ROTA 4C02B 1FD9A 2PPPA 4GIVA 2DPEA 1WR7A 3CHFA 1LJYA 1U79A 1EQ3A 4MNMA 3ARRA 2ZQSA 4TYOA 1D2KA 2RUQA 3TCZA 1NSGA 1F40A 3O5FA 1JNDA 2MNTA 3RM9A 4NNRA 3UI4A 2A3CA 1B6CA 2WM0A 1SR0A 4W9OA 1W26A 4ODKA 2Y78A 1E15A 4Z2LA 3B9AA 2YSHA 3AS0A 3KACA 2DT2A 4ODLA 2KI3A 2LAJA 3OOBA 4DROA 1D7IA 1LG2A 1ITXA 1HKJA 4R5EA 3UF8A 2OWOA 2DSWA 2DT1A 2DK1A 1HKIA 2VCDA 3CH9A 1HXVA 1KT1A 4J4OA 3WD2A 4MGVA 1OGBA 3KAIA 2RE3A 4A0UA 2WAEA 4MSPA 4DRQA 4ZS6A 2M8IA 1FKRA 1PINA 4TNSA 4FN2A 4Z2JA 4Z2GA 1J4IA 4TW7A 1K9RA 4DWSD 3MCBA 1OGGA 2MLZA 2A3AA 1X6LA 3KAHA 1FKKA 2YSIA 4DRIA 1WB0A 4G2PA 2LGOA 3PQHA 3UI6A 4TW6A 1TR8A 4U84A 3B9DA 2DSUA 1JNTA 2F4EA 2N87A 3GPKA 5HKGA 1ROUA 3FAPA 3TDBA 4DRHA 2D9FA 4WKHA 2XP7A 3WD3A 1LL6A 4FAPA 3G6MA 5HWBA 3EY6A 4ODPA 4ODMA 5U47A 4DH0A 1JNEA 1NMVA 4WKAA 2L2SA 5BXJA 1O6WA 4DRJA 4ODRA 3UI5A 4ZPWR 3O5MA 3O5KA 1TK7A 1D7JA 5HT1A 1HKMA 1FKHA 2M1IA 5J6EA 2ZQVA 1NWSA 2JMFA 1KT0A 1K9QA 4DRPA 2A3BA 3LKXB 4S3KA 1GOIA 3TC5A 1YW5A 2XPAA 3KAGA 4QT2A 1EDQA 4DZ2A 2LPVA 3ARYA 5E65A 3B7XA 1LL7A 1EIBA 2PV2A 3AS3A 2AWGA 1OWQA 4MNLA 1E6PA 1C9HA 2YBUA 2ESCA 2BA1A 4A0TA 3MDYB 2XP4A 3KADA 4W5UA 1ZBVA 2KR7A 5E5WA 1GPFA 3ARUA 2F21A 4MNKA 1E6ZA 3M85A 3WQVA 2RUDA 3JXVA 1EYMA 2LJ4A 2YSFA 1VF8A 1JVWA 1W9VA 4DRMA 4S3JA 1WMVA 3IHZA 1QPLA 4QIBA 4MNJA 3ARQA 1QPFA 4Z2KA 3IKDA 4IPXA 4N19A 3WL1A 4WK9A 3WQWA 2MLXA 1E9LA 5B8IC 4W9QA 1EG4A 2XP9A 4Z2IA 3NTPA 1FKSA 4HBOA 3RM4A 2KFWA 3L4HA 4PTMA 5AHTA 1I5HW 1FFQA 3O5OA 3WH0A 2DK7A 1FKTA 1M5YA 1K9TA 4Q22A 4U85A 2XP3A 1W9PA 5DO2A 3ARSA 3O5EA 1RP5A 2G8ZA 2MPHA 2PI6A 1TCOC 3ARZA 4O2TA 4WJXA 1JNSA 1HJXA 3UQBA 2DSVA 3G6LA 3VAWA 2KGJA 1LG1A 2RURA 3AS2A 1NH6A 2DT3A 1KFWA 2JX8A 4DWSC 1A7XA 3LKXA 5GPGA 1W1TA 1FKIA 5HW6A 3MQHA 2PV1A 1Q6UA 2KE0A 2XP6A 2XP8A 1E6RA 4NZCA 2DJYA 2ZR4A 4LAXA 4GLXA 2FKEA 3PRAA 3CZ8A 3WD1A 1ZBKA 2WLZA 4DT4A 2PBCA 1PBKA 1E6NA 2KO7A 1J4RA 4ODOA 1ZBCA 4KR0B 4P8WA 3MQGA 3AROA 2EZ5W 1QZ2A 3PA7A 1J6YA 3WL0A 1J4HA 4L72B 1FKFA 1FKBA 4MAVA 3FXYA 1Q6IA 1LQ0A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4C02 B;  4ODK A;  2BA1 A;  4DRK A;  3MDY B;  4DRN A;  2ZR5 A;  3O5G A;  2Y78 A;  2XP4 A;  2PV3 A;  5I98 A;  2Q5A A;  3KAD A;  3O5Q A;  5HWC A;  2YSH A;  2OFN A;  3KAB A;  3KAC A;  5DIT A;  2RQS A;  2KR7 A;  4JFI A;  4ODL A;  1JMQ A;  2KI3 A;  5DIV A;  2LAJ A;  3OOB A;  3LUO A;  1D7I A;  4LAY A;  4DRO A;  1ZCN A;  5HW8 A;  2M2A A;  2F21 A;  2ITK A;  3LE4 A;  3M85 A;  3O5P A;  3UF8 A;  2DWV A;  2RUD A;  3JXV A;  4IQC A;  4JFK A;  1EYM A;  2DK1 A;  2YSF A;  2LJ4 A;  2VCD A;  1HXV A;  1KT1 A;  1JVW A;  4J4O A;  3KCE A;  4LAV A;  4MGV A;  4DRM A;  3KAI A;  2RE3 A;  1WMV A;  2MF9 A;  2F2D A;  3IHZ A;  4IQ2 A;  1D6O A;  5D75 A;  4REX A;  1QPL A;  1Y0O A;  4QIB A;  1QPF A;  1BKF A;  2KXQ A;  1R9H A;  4MSP A;  3IKD A;  3PRB A;  2LKN A;  4DRQ A;  4IPX A;  1BL4 A;  4N19 A;  2RSE A;  4TX0 A;  4BF8 A;  1Q6H A;  2M8I A;  1FKR A;  4U86 A;  1PIN A;  4ITZ A;  4TNS A;  2MLX A;  4FN2 A;  1FKJ A;  1N1A A;  3IK8 A;  1J4I A;  3O5R A;  4TW7 A;  1K9R A;  4W9Q A;  5B8I C;  1EG4 A;  2E45 A;  2XP5 A;  2XP9 A;  3CGM A;  2MLZ A;  3NTP A;  1P5Q A;  3KAH A;  1FKK A;  2YSI A;  2ZAJ A;  2ZR6 A;  1FKS A;  4J4N A;  4ODQ A;  4W9P A;  2DG4 A;  4DRI A;  3O5J A;  1F8A B;  2KFW A;  1L1P A;  1D7H A;  3L4H A;  4G2P A;  2M3O W;  3KAF A;  2LGO A;  1FJD A;  3UI6 A;  5AHT A;  1I5H W;  3O5O A;  3ODK A;  4U84 A;  2VN1 A;  3WH0 A;  2PPN A;  4TW6 A;  4DZ3 A;  2DK7 A;  3I6C A;  1FKT A;  1M5Y A;  2IF4 A;  4U85 A;  2XP3 A;  2UZ5 A;  3KZ7 A;  1JNT A;  2RUC A;  4TW8 A;  1FKD A;  2YSG A;  4G50 A;  3H9R B;  2F4E A;  3O5E A;  1T11 A;  2ZQU A;  2N87 A;  3GPK A;  4ODN A;  1ROU A;  5HKG A;  3UQI A;  3UQA A;  3FAP A;  2MPH A;  3TDB A;  1TCO C;  2PPO A;  4O2T A;  3JYM A;  4DRH A;  2D9F A;  1JNS A;  2DG3 A;  3UQB A;  2XP7 A;  3NI6 A;  3VAW A;  2KGJ A;  3O5I A;  2YSB A;  2L4J A;  1ZK6 A;  5HTG A;  2RUR A;  4DIP A;  5HUA A;  4JFM A;  4FAP A;  5HWB A;  3EY6 A;  2K8I A;  3O5D A;  2M8J A;  4ODP A;  2JX8 A;  1Q1C A;  2JZV A;  1YAT A;  1A7X A;  4JYS A;  4ODM A;  2XPB A;  3O5L A;  3PRD A;  2JV4 A;  2JXW A;  1EG3 A;  1FKI A;  1NMV A;  2M08 A;  5GPG A;  4DH0 A;  2PV1 A;  5HW6 A;  3RFW A;  1Q6U A;  2KE0 A;  2L2S A;  2XP6 A;  5BXJ A;  1O6W A;  5CQ2 A;  2XP8 A;  1FAP A;  4DRJ A;  5HW7 A;  4ODR A;  4JFJ A;  3UI5 A;  2DJY A;  2ZQT A;  1W26 A;  3O5M A;  3O5K A;  2ZR4 A;  4LAX A;  2MDI A;  1TK7 A;  1ROT A;  1D7J A;  1FD9 A;  2FKE A;  2PPP A;  5HT1 A;  4GIV A;  1NMW A;  1FKH A;  2M1I A;  4R0X A;  1WR7 A;  2MLY A;  3CNG A;  5J6E A;  3RGC A;  4E5R A;  4JFL A;  2ZQV A;  2PBC A;  4QT3 A;  3IKG A;  1PBK A;  4DT4 A;  2JMF A;  1U79 A;  1KT0 A;  1K9Q A;  2KO7 A;  2FAP A;  4DRP A;  1EQ3 A;  1J4R A;  3JYJ A;  2ZQS A;  4GGQ A;  4ODO A;  3NRK A;  4TYO A;  3TC5 A;  2RUQ A;  1YW5 A;  2XPA A;  3KAG A;  3TCZ A;  1FKL A;  1NSG A;  3CGN A;  3O5F A;  4QT2 A;  1F40 A;  4LAW A;  3M7N A;  1FKG A;  2MNT A;  4DZ2 A;  2DG9 A;  2LPV A;  4NNR A;  3UI4 A;  2EZ5 W;  1QZ2 A;  3PA7 A;  3B7X A;  1J6Y A;  1B6C A;  2PV2 A;  1J4H A;  2AWG A;  1FKF A;  1FKB A;  4W9O A;  5DIU A;  2DMV A;  1Q6I A;  1C9H A; 
#chains in the Genus database with same CATH topology
 4DRK A;  3CHD A;  4DRN A;  2ZR5 A;  3WKZ A;  3O5Q A;  5DIT A;  5DIV A;  4WIW A;  4QZV B;  4LAY A;  5HW8 A;  2WK2 A;  3B9E A;  1W1P A;  3KCE A;  2MF9 A;  2F2D A;  4ZPT R;  1BKF A;  2KXQ A;  4MPK A;  1CTN A;  2LKN A;  1BL4 A;  2AOS A;  4TX0 A;  5E64 A;  2FDM A;  1EHN A;  4ITZ A;  4XAK A;  3ARW A;  1N1A A;  3IK8 A;  3O5R A;  1ZBW A;  1UR8 A;  1NWT A;  4NSB A;  3CGM A;  1P5Q A;  4J4N A;  2ZR6 A;  4W9P A;  3O5J A;  4LGX A;  4P8U A;  2M3O W;  3KAF A;  1FJD A;  5DF0 A;  2VN1 A;  4HBE A;  2IF4 A;  2A3E A;  2UZ5 A;  4TW8 A;  3KZ7 A;  2RUC A;  1LL4 A;  1GUV A;  4G50 A;  4ODN A;  1T11 A;  1TFV A;  1W1V A;  1NWU A;  2PPO A;  4Z2H A;  3JYM A;  5GQB A;  2EUL A;  3NI6 A;  2PN0 A;  3ART A;  3WD0 A;  3O5I A;  2YSB A;  2L4J A;  5HTG A;  4DIP A;  5HUA A;  4JFM A;  3O5D A;  1Q1C A;  5E66 A;  1ZU8 A;  1WAW A;  2G41 A;  3W4R A;  3CHE A;  2JV4 A;  2WLY A;  2QRV A;  2WAD A;  5CQ2 A;  3ARV A;  1HKK A;  1XRV A;  2DT0 A;  2MDI A;  1SYT A;  3EIP A;  3BMB A;  1NMW A;  4R0X A;  2MLY A;  3CNG A;  3ALG A;  4Q7N A;  3RGC A;  4E5R A;  4JFL A;  4QT3 A;  3IKG A;  2ETN A;  1IX5 A;  2O92 A;  1WNO A;  2B31 A;  1RD6 A;  2FAP A;  3JYJ A;  4GGQ A;  5DEZ A;  3NRK A;  1W1Y A;  1ZB5 A;  1FKL A;  3CGN A;  3MCB B;  4LAW A;  3M7N A;  1FKG A;  4IT4 A;  2DG9 A;  5DIU A;  3PR9 A;  2DMV A;  4IT6 A;  3B8S A;  1FFR A;  4HAR A;  1O6I A;  2OLH A;  3O5G A;  3ARP A;  3WD4 A;  2PV3 A;  5I98 A;  2Q5A A;  3AS1 A;  3WIJ A;  2OFN A;  3KAB A;  2RQS A;  4JFI A;  1JMQ A;  5HWC A;  3LUO A;  3RM8 A;  1ZCN A;  2Y8N B;  2M2A A;  4ML4 A;  4KQZ A;  2ITK A;  3LE4 A;  3O5P A;  2DWV A;  4IQC A;  4JFK A;  1W9U A;  2YAJ B;  5E62 A;  4LAV A;  3ALF A;  5HBF A;  4IQ2 A;  4ZPV R;  1D6O A;  5GPR A;  5D75 A;  4REX A;  1Y0O A;  1R9H A;  3PRB A;  4UDM A;  1XHG A;  2RSE A;  3FS8 A;  2QF8 A;  1Q6H A;  4MTV A;  1NWR A;  3RME A;  4BF8 A;  4U86 A;  4AY1 A;  1FKJ A;  4DWS B;  4P8V A;  2E45 A;  2XP5 A;  1H0G A;  3ARX A;  2DSZ A;  4ODQ A;  2ZAJ A;  1L1P A;  1FLC A;  2DG4 A;  1F8A B;  3OA5 A;  1D7H A;  2O9O A;  2IUZ A;  3FSB A;  3ODK A;  2PPN A;  4DZ3 A;  3QOK A;  3I6C A;  4WKF A;  3CHC A;  1FKD A;  2YSG A;  3H9R B;  2ZQU A;  3BXW A;  3UQA A;  3UQI A;  2YBT A;  2DG3 A;  4DWS A;  1HJW A;  1ZK6 A;  1HJV A;  3FSC A;  2K8I A;  2M8J A;  2JZV A;  1YAT A;  1X6N A;  4JYS A;  4URI A;  2XPB A;  3O5L A;  3PRD A;  2JXW A;  1ZL1 A;  1EG3 A;  2M08 A;  3AQU A;  3RFW A;  1UR9 A;  5HW7 A;  1FAP A;  1H0I A;  4JFJ A;  4P8X A;  4L3N A;  2ZQT A;  5JH8 A;  3FY1 A;  1ROT A;  4C02 B;  1FD9 A;  2PPP A;  4GIV A;  2DPE A;  1WR7 A;  3CHF A;  1LJY A;  1U79 A;  1EQ3 A;  4MNM A;  3ARR A;  2ZQS A;  4TYO A;  1D2K A;  2RUQ A;  3TCZ A;  1NSG A;  1F40 A;  3O5F A;  1JND A;  2MNT A;  3RM9 A;  4NNR A;  3UI4 A;  2A3C A;  1B6C A;  2WM0 A;  3GU0 A;  1SR0 A;  4W9O A;  1W26 A;  2B5U B;  4ODK A;  2Y78 A;  1E15 A;  4Z2L A;  3B9A A;  2YSH A;  3AS0 A;  3KAC A;  2DT2 A;  4ODL A;  2KI3 A;  2LAJ A;  3OOB A;  4DRO A;  1D7I A;  1LG2 A;  1ITX A;  1HKJ A;  4R5E A;  3UF8 A;  2OWO A;  2DSW A;  2DT1 A;  2DK1 A;  1HKI A;  2VCD A;  3CH9 A;  1HXV A;  1KT1 A;  4J4O A;  3WD2 A;  4MGV A;  1OGB A;  3KAI A;  2RE3 A;  1JCH B;  4A0U A;  2WAE A;  4MSP A;  4DRQ A;  1E44 A;  4ZS6 A;  2M8I A;  1FKR A;  1PIN A;  4TNS A;  4FN2 A;  4Z2J A;  4Z2G A;  1J4I A;  4TW7 A;  1K9R A;  4DWS D;  3MCB A;  1OGG A;  2MLZ A;  2A3A A;  1X6L A;  3KAH A;  1FKK A;  2YSI A;  4DRI A;  1WB0 A;  4G2P A;  2LGO A;  3PQH A;  3UI6 A;  4TW6 A;  1TR8 A;  4U84 A;  3B9D A;  2DSU A;  1JNT A;  2F4E A;  2N87 A;  3GPK A;  5HKG A;  1ROU A;  3FAP A;  3TDB A;  4DRH A;  2D9F A;  4WKH A;  2XP7 A;  3WD3 A;  1LL6 A;  4FAP A;  3G6M A;  5HWB A;  3EY6 A;  4ODP A;  4ODM A;  5U47 A;  4DH0 A;  1JNE A;  1NMV A;  4WKA A;  2L2S A;  5BXJ A;  1O6W A;  4DRJ A;  4ODR A;  3UI5 A;  4ZPW R;  3O5M A;  3O5K A;  1TK7 A;  1D7J A;  5HT1 A;  1HKM A;  1FKH A;  2M1I A;  5J6E A;  2ZQV A;  1NWS A;  2JMF A;  1KT0 A;  1K9Q A;  4DRP A;  2A3B A;  3LKX B;  4S3K A;  1GOI A;  3TC5 A;  1YW5 A;  2XPA A;  3KAG A;  4QT2 A;  1EDQ A;  4DZ2 A;  2LPV A;  3ARY A;  5E65 A;  3B7X A;  1LL7 A;  1EIB A;  2PV2 A;  3AS3 A;  2AWG A;  1OWQ A;  4MNL A;  1GRJ A;  1E6P A;  1C9H A;  2YBU A;  2ESC A;  2BA1 A;  4A0T A;  3MDY B;  2XP4 A;  3KAD A;  4W5U A;  1ZBV A;  2F23 A;  2KR7 A;  5E5W A;  1GPF A;  3ARU A;  2F21 A;  4MNK A;  1E6Z A;  3M85 A;  3WQV A;  2RUD A;  3JXV A;  1EYM A;  2LJ4 A;  2YSF A;  1VF8 A;  1JVW A;  1W9V A;  4DRM A;  4S3J A;  1WMV A;  3IHZ A;  1QPL A;  4QIB A;  4MNJ A;  3ARQ A;  1QPF A;  4Z2K A;  3IKD A;  4IPX A;  4N19 A;  3WL1 A;  4WK9 A;  3WQW A;  2MLX A;  1E9L A;  5B8I C;  4W9Q A;  1EG4 A;  2XP9 A;  4Z2I A;  3NTP A;  1FKS A;  4HBO A;  3RM4 A;  2KFW A;  3L4H A;  4PTM A;  5AHT A;  1I5H W;  1FFQ A;  3O5O A;  3WH0 A;  2DK7 A;  1FKT A;  1M5Y A;  1K9T A;  4Q22 A;  4U85 A;  2XP3 A;  1W9P A;  5DO2 A;  3ARS A;  3O5E A;  1RP5 A;  2G8Z A;  2MPH A;  2PI6 A;  1TCO C;  3ARZ A;  4O2T A;  4WJX A;  1JNS A;  1HJX A;  3UQB A;  2DSV A;  3G6L A;  3VAW A;  2KGJ A;  1LG1 A;  2RUR A;  3AS2 A;  1NH6 A;  2DT3 A;  1KFW A;  2JX8 A;  4DWS C;  1A7X A;  3LKX A;  2P4V A;  5GPG A;  1W1T A;  1FKI A;  5HW6 A;  3MQH A;  2PV1 A;  1Q6U A;  2KE0 A;  2XP6 A;  2XP8 A;  1E6R A;  4NZC A;  2DJY A;  3GTY X;  2ZR4 A;  4LAX A;  4GLX A;  2FKE A;  3PRA A;  3CZ8 A;  3WD1 A;  1ZBK A;  2WLZ A;  4DT4 A;  2PBC A;  1PBK A;  1E6N A;  2KO7 A;  1J4R A;  4ODO A;  1ZBC A;  4KR0 B;  4P8W A;  3MQG A;  3ARO A;  2EZ5 W;  1QZ2 A;  3PA7 A;  1J6Y A;  3WL0 A;  1J4H A;  4L72 B;  1FKF A;  1FKB A;  4MAV A;  3FXY A;  1Q6I A;  1LQ0 A; 
#chains in the Genus database with same CATH homology
 4DRK A;  3CHD A;  4DRN A;  2ZR5 A;  3WKZ A;  3O5Q A;  5DIT A;  5DIV A;  4WIW A;  4QZV B;  4LAY A;  5HW8 A;  2WK2 A;  3B9E A;  1W1P A;  3KCE A;  2MF9 A;  2F2D A;  4ZPT R;  1BKF A;  2KXQ A;  4MPK A;  1CTN A;  2LKN A;  1BL4 A;  2AOS A;  4TX0 A;  5E64 A;  2FDM A;  1EHN A;  4ITZ A;  4XAK A;  3ARW A;  1N1A A;  3IK8 A;  3O5R A;  1ZBW A;  1UR8 A;  1NWT A;  4NSB A;  3CGM A;  1P5Q A;  4J4N A;  2ZR6 A;  4W9P A;  3O5J A;  4LGX A;  4P8U A;  2M3O W;  3KAF A;  1FJD A;  5DF0 A;  2VN1 A;  4HBE A;  2IF4 A;  2A3E A;  2UZ5 A;  4TW8 A;  3KZ7 A;  2RUC A;  1LL4 A;  1GUV A;  4G50 A;  4ODN A;  1T11 A;  1TFV A;  1W1V A;  1NWU A;  2PPO A;  4Z2H A;  3JYM A;  5GQB A;  3NI6 A;  3ART A;  3WD0 A;  3O5I A;  2YSB A;  2L4J A;  5HTG A;  4DIP A;  5HUA A;  4JFM A;  3O5D A;  1Q1C A;  5E66 A;  1ZU8 A;  1WAW A;  2G41 A;  3W4R A;  3CHE A;  2JV4 A;  2WLY A;  2QRV A;  2WAD A;  5CQ2 A;  3ARV A;  1HKK A;  1XRV A;  2DT0 A;  2MDI A;  1SYT A;  1NMW A;  4R0X A;  2MLY A;  3CNG A;  3ALG A;  4Q7N A;  3RGC A;  4E5R A;  4JFL A;  4QT3 A;  3IKG A;  1IX5 A;  2O92 A;  1WNO A;  2B31 A;  1RD6 A;  2FAP A;  3JYJ A;  4GGQ A;  5DEZ A;  3NRK A;  1W1Y A;  1ZB5 A;  1FKL A;  3CGN A;  3MCB B;  4LAW A;  3M7N A;  1FKG A;  4IT4 A;  2DG9 A;  5DIU A;  3PR9 A;  2DMV A;  4IT6 A;  3B8S A;  1FFR A;  4HAR A;  1O6I A;  2OLH A;  3O5G A;  3ARP A;  3WD4 A;  2PV3 A;  5I98 A;  2Q5A A;  3AS1 A;  3WIJ A;  2OFN A;  3KAB A;  2RQS A;  4JFI A;  1JMQ A;  5HWC A;  3LUO A;  3RM8 A;  1ZCN A;  2Y8N B;  2M2A A;  4ML4 A;  4KQZ A;  2ITK A;  3LE4 A;  3O5P A;  2DWV A;  4IQC A;  4JFK A;  1W9U A;  2YAJ B;  5E62 A;  4LAV A;  3ALF A;  5HBF A;  4IQ2 A;  4ZPV R;  1D6O A;  5GPR A;  5D75 A;  4REX A;  1Y0O A;  1R9H A;  3PRB A;  1XHG A;  2RSE A;  3FS8 A;  2QF8 A;  1Q6H A;  4MTV A;  1NWR A;  3RME A;  4BF8 A;  4U86 A;  4AY1 A;  1FKJ A;  4DWS B;  4P8V A;  2E45 A;  2XP5 A;  1H0G A;  3ARX A;  2DSZ A;  4ODQ A;  2ZAJ A;  1L1P A;  1FLC A;  2DG4 A;  1F8A B;  3OA5 A;  1D7H A;  2O9O A;  2IUZ A;  3FSB A;  3ODK A;  2PPN A;  4DZ3 A;  3QOK A;  3I6C A;  4WKF A;  3CHC A;  1FKD A;  2YSG A;  3H9R B;  2ZQU A;  3BXW A;  3UQA A;  3UQI A;  2YBT A;  2DG3 A;  4DWS A;  1HJW A;  1ZK6 A;  1HJV A;  3FSC A;  2K8I A;  2M8J A;  2JZV A;  1YAT A;  1X6N A;  4JYS A;  4URI A;  2XPB A;  3O5L A;  3PRD A;  2JXW A;  1ZL1 A;  1EG3 A;  2M08 A;  3AQU A;  3RFW A;  1UR9 A;  5HW7 A;  1FAP A;  1H0I A;  4JFJ A;  4P8X A;  4L3N A;  2ZQT A;  5JH8 A;  3FY1 A;  1ROT A;  4C02 B;  1FD9 A;  2PPP A;  4GIV A;  2DPE A;  1WR7 A;  3CHF A;  1LJY A;  1U79 A;  1EQ3 A;  4MNM A;  3ARR A;  2ZQS A;  4TYO A;  1D2K A;  2RUQ A;  3TCZ A;  1NSG A;  1F40 A;  3O5F A;  1JND A;  2MNT A;  3RM9 A;  4NNR A;  3UI4 A;  2A3C A;  1B6C A;  2WM0 A;  1SR0 A;  4W9O A;  1W26 A;  4ODK A;  2Y78 A;  1E15 A;  4Z2L A;  3B9A A;  2YSH A;  3AS0 A;  3KAC A;  2DT2 A;  4ODL A;  2KI3 A;  2LAJ A;  3OOB A;  4DRO A;  1D7I A;  1LG2 A;  1ITX A;  1HKJ A;  4R5E A;  3UF8 A;  2OWO A;  2DSW A;  2DT1 A;  2DK1 A;  1HKI A;  2VCD A;  3CH9 A;  1HXV A;  1KT1 A;  4J4O A;  3WD2 A;  4MGV A;  1OGB A;  3KAI A;  2RE3 A;  4A0U A;  2WAE A;  4MSP A;  4DRQ A;  4ZS6 A;  2M8I A;  1FKR A;  1PIN A;  4TNS A;  4FN2 A;  4Z2J A;  4Z2G A;  1J4I A;  4TW7 A;  1K9R A;  4DWS D;  3MCB A;  1OGG A;  2MLZ A;  2A3A A;  1X6L A;  3KAH A;  1FKK A;  2YSI A;  4DRI A;  1WB0 A;  4G2P A;  2LGO A;  3PQH A;  3UI6 A;  4TW6 A;  1TR8 A;  4U84 A;  3B9D A;  2DSU A;  1JNT A;  2F4E A;  2N87 A;  3GPK A;  5HKG A;  1ROU A;  3FAP A;  3TDB A;  4DRH A;  2D9F A;  4WKH A;  2XP7 A;  3WD3 A;  1LL6 A;  4FAP A;  3G6M A;  5HWB A;  3EY6 A;  4ODP A;  4ODM A;  5U47 A;  4DH0 A;  1JNE A;  1NMV A;  4WKA A;  2L2S A;  5BXJ A;  1O6W A;  4DRJ A;  4ODR A;  3UI5 A;  4ZPW R;  3O5M A;  3O5K A;  1TK7 A;  1D7J A;  5HT1 A;  1HKM A;  1FKH A;  2M1I A;  5J6E A;  2ZQV A;  1NWS A;  2JMF A;  1KT0 A;  1K9Q A;  4DRP A;  2A3B A;  3LKX B;  4S3K A;  1GOI A;  3TC5 A;  1YW5 A;  2XPA A;  3KAG A;  4QT2 A;  1EDQ A;  4DZ2 A;  2LPV A;  3ARY A;  5E65 A;  3B7X A;  1LL7 A;  1EIB A;  2PV2 A;  3AS3 A;  2AWG A;  1OWQ A;  4MNL A;  1E6P A;  1C9H A;  2YBU A;  2ESC A;  2BA1 A;  4A0T A;  3MDY B;  2XP4 A;  3KAD A;  4W5U A;  1ZBV A;  2KR7 A;  5E5W A;  1GPF A;  3ARU A;  2F21 A;  4MNK A;  1E6Z A;  3M85 A;  3WQV A;  2RUD A;  3JXV A;  1EYM A;  2LJ4 A;  2YSF A;  1VF8 A;  1JVW A;  1W9V A;  4DRM A;  4S3J A;  1WMV A;  3IHZ A;  1QPL A;  4QIB A;  4MNJ A;  3ARQ A;  1QPF A;  4Z2K A;  3IKD A;  4IPX A;  4N19 A;  3WL1 A;  4WK9 A;  3WQW A;  2MLX A;  1E9L A;  5B8I C;  4W9Q A;  1EG4 A;  2XP9 A;  4Z2I A;  3NTP A;  1FKS A;  4HBO A;  3RM4 A;  2KFW A;  3L4H A;  4PTM A;  5AHT A;  1I5H W;  1FFQ A;  3O5O A;  3WH0 A;  2DK7 A;  1FKT A;  1M5Y A;  1K9T A;  4Q22 A;  4U85 A;  2XP3 A;  1W9P A;  5DO2 A;  3ARS A;  3O5E A;  1RP5 A;  2G8Z A;  2MPH A;  2PI6 A;  1TCO C;  3ARZ A;  4O2T A;  4WJX A;  1JNS A;  1HJX A;  3UQB A;  2DSV A;  3G6L A;  3VAW A;  2KGJ A;  1LG1 A;  2RUR A;  3AS2 A;  1NH6 A;  2DT3 A;  1KFW A;  2JX8 A;  4DWS C;  1A7X A;  3LKX A;  5GPG A;  1W1T A;  1FKI A;  5HW6 A;  3MQH A;  2PV1 A;  1Q6U A;  2KE0 A;  2XP6 A;  2XP8 A;  1E6R A;  4NZC A;  2DJY A;  2ZR4 A;  4LAX A;  4GLX A;  2FKE A;  3PRA A;  3CZ8 A;  3WD1 A;  1ZBK A;  2WLZ A;  4DT4 A;  2PBC A;  1PBK A;  1E6N A;  2KO7 A;  1J4R A;  4ODO A;  1ZBC A;  4KR0 B;  4P8W A;  3MQG A;  3ARO A;  2EZ5 W;  1QZ2 A;  3PA7 A;  1J6Y A;  3WL0 A;  1J4H A;  4L72 B;  1FKF A;  1FKB A;  4MAV A;  3FXY A;  1Q6I A;  1LQ0 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...