2XP4A

Discovery of cell-active phenyl-imidazole pin1 inhibitors by structure-guided fragment evolution
Total Genus 46
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
46
sequence length
157
structure length
144
Chain Sequence
LPPGWEKAMSRSSGRVYYFNHITNASQWERPEPARVRCSHLLVKHSQSRRPSSWRQEKITRTKEEALELINGYIQKIKSGEEDFESLASQFSDCSSAKARGDLGAFSRGQMQKPFEDASFALRTGEMSGPVFTDSGIHIILRTE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Discovery of Cell-Active Phenyl-Imidazole Pin1 Inhibitors by Structure-Guided Fragment Evolution.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Isomerase
molecule keywords PEPTIDYL-PROLYL CIS-TRANS ISOMERASE NIMA-INTERACTING 1
total genus 46
structure length 144
sequence length 157
ec nomenclature ec 5.2.1.8: Peptidylprolyl isomerase.
pdb deposition date 2010-08-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00397 WW WW domain
A PF00639 Rotamase PPIC-type PPIASE domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.20.70.10 Mainly Beta Single Sheet Ubiquitin Ligase Nedd4; Chain: W; Ubiquitin Ligase Nedd4; Chain: W; 2xp4A01
3.10.50.40 Alpha Beta Roll Chitinase A; domain 3 Chitinase A; domain 3 2xp4A02
4FN2A 2K8IA 1BKFA 1QPLA 4W9PA 1HXVA 3M7NA 2AWGA 3O5EA 2DMVA 3CNGA 3O5DA 3NTPA 2MF9A 4JFIA 3UF8A 1I5HW 5HW6A 4G2PA 4TW6A 1KT1A 1ROTA 1JMQA 1U79A 2PPOA 4JFLA 4JYSA 1FKRA 5DITA 2JV4A 2F21A 2YSGA 2D9FA 3JYMA 4G50A 4W9OA 1FKFA 3IK8A 1YW5A 1EG3A 2M8JA 2ZR6A 1D7JA 3KADA 1NMWA 2YSIA 2DG4A 2KR7A 3JXVA 4ODNA 1Q1CA 2BA1A 3CGNA 4REXA 4DRQA 1F40A 3FAPA 3KAFA 1FKGA 2F2DA 2LJ4A 2JMFA 3TCZA 4TW7A 5D75A 3KAHA 3TC5A 3PRBA 2LPVA 2MLZA 1A7XA 4LAXA 4ODKA 5BXJA 1FJDA 5GPGA 2KFWA 4O2TA 2JXWA 1B6CA 4DRKA 2M08A 2UZ5A 3IHZA 4TNSA 2DK7A 4IPXA 4LAYA 5B8IC 2ZQSA 2DG9A 5DIUA 3RFWA 2XP5A 1YATA 2FAPA 3O5GA 3L4HA 3UQAA 4QIBA 1FD9A 1Q6HA 1J6YA 4TX0A 1J4HA 1QPFA 3O5LA 4C02B 5HW8A 3EY6A 3KABA 3O5FA 3UI6A 2ZR5A 1FAPA 1FKJA 2F4EA 3IKDA 3KACA 4DRIA 1FKDA 2RUQA 4LAVA 1WR7A 3UQIA 2KE0A 4GGQA 4GIVA 4DH0A 3O5KA 2RE3A 2XPBA 1J4RA 2JZVA 4ITZA 1EQ3A 1NMVA 2PBCA 3NI6A 2DK1A 3O5MA 4DT4A 2DJYA 3KZ7A 1Q6UA 1PBKA 1Y0OA 4ODLA 4LAWA 5HW7A 3KAGA 2MLXA 3CGMA 4DZ2A 2LAJA 2XP8A 2XPAA 2XP7A 2Y78A 4U84A 2MLYA 1FKSA 1PINA 2OFNA 2RUCA 2VCDA 4N19A 4ODPA 4TYOA 1C9HA 1FKBA 1JVWA 4IQ2A 4ODRA 4W9QA 3RGCA 2XP3A 3LUOA 2PPPA 5HWCA 2N87A 2M8IA 2YSHA 1FKIA 3MDYB 4FAPA 1N1AA 1TK7A 3UI4A 4DROA 2PV1A 4JFJA 5CQ2A 1O6WA 3I6CA 2ZQVA 4DRMA 1JNTA 1M5YA 2KO7A 3PRDA 2ZQTA 4E5RA 2MNTA 5J6EA 3NRKA 4MSPA 4ODMA 2ITKA 1BL4A 5DIVA 2ZR4A 2XP6A 3GPKA 3O5RA 2YSFA 1ROUA 2PPNA 2KXQA 2YSBA 2XP9A 1F8AB 3TDBA 1J4IA 1FKHA 1R9HA 4J4OA 3O5JA 4IQCA 3PA7A 2DG3A 4JFMA 2DWVA 1EYMA 3KAIA 3H9RB 3WH0A 2M1IA 3ODKA 3VAWA 2LKNA 2Q5AA 2IF4A 2RQSA 2VN1A 1KT0A 5HTGA 2EZ5W 1WMVA 4QT2A 4NNRA 1D6OA 1NSGA 3B7XA 3JYJA 4BF8A 1JNSA 2KI3A 1K9RA 4J4NA 4MGVA 1QZ2A 1W26A 1FKLA 3KCEA 5HKGA 5HUAA 1T11A 4DZ3A 2ZQUA 3LE4A 3O5OA 2MDIA 3O5QA 4DIPA 4TW8A 2MPHA 3OOBA 4ODOA 4U86A 2XP4A 5AHTA 1FKTA 2RUDA 3IKGA 2JX8A 2PV3A 3O5PA 3UQBA 4DRNA 1ZCNA 2E45A 2RURA 2LGOA 4DRJA 2PV2A 2RSEA 2M2AA 1D7HA 2FKEA 4ODQA 1TCOC 4R0XA 1Q6IA 2ZAJA 1P5QA 5I98A 1L1PA 2L4JA 1EG4A 3UI5A 3O5IA 5HT1A 3M85A 1ZK6A 4DRHA 1FKKA 4JFKA 1K9QA 4QT3A 1D7IA 4DRPA 2KGJA 4U85A 2L2SA 5HWBA 2M3OW
chains in the Genus database with same CATH superfamily
1BKFA 4W9PA 1K9TA 3FS8A 3M7NA 1WNOA 2MF9A 4GLXA 1I5HW 1KT1A 1ROTA 1JMQA 3RM8A 5E5WA 1HJWA 2F21A 2WK2A 3IK8A 4TYOA 2KR7A 4P8UA 2DG4A 2YSIA 4L72B 1KFWA 2PN0A 3LKXB 4REXA 4KQZA 1FKGA 3CHEA 5HKGA 2LPVA 4LAXA 1LG2A 2YBUA 3BMBA 4O2TA 1RD6A 3FY1A 2UZ5A 4WJXA 3FSBA 4WIWA 5B8IC 4MNJA 2DG9A 3ARZA 2FAPA 3L4HA 1UR8A 1Q6HA 1QPFA 3O5LA 3EY6A 3KABA 3IKDA 2KE0A 4GIVA 1IX5A 3O5KA 2RE3A 4ITZA 1EQ3A 1NMVA 4DT4A 2DJYA 3KAGA 3PRAA 4DZ2A 5DITA 2Y78A 2MLYA 3AQUA 2VCDA 4DIPA 1FLCA 1C9HA 1WAWA 4IQ2A 2XP3A 1FFQA 2A3BA 3BXWA 3AS3A 2M8IA 2OLHA 1W1VA 2PV1A 3I6CA 4URIA 1FFRA 3NRKA 1EIBA 1ZU8A 4W5UA 5DIVA 2ZR4A 2O9OA 3O5RA 4QZVB 1ROUA 2PPNA 3TDBA 4J4OA 1F8AB 3ARSA 3ARTA 2DG3A 4Z2IA 3ODKA 4HBEA 2RQSA 3B9DA 1LJYA 4QT2A 4NNRA 1NSGA 3B7XA 1E6NA 4BF8A 2KI3A 3KCEA 3WQVA 4DZ3A 1LQ0A 4TW8A 5E65A 2MPHA 4Z2KA 2G8ZA 3WD1A 2JX8A 1E6RA 3UQBA 2RURA 1ZBVA 4XAKA 1D7HA 4NZCA 3MCBB 4ODQA 4ZS6A 1Q6IA 1SYTA 3ARWA 5HT1A 2YAJB 2DT3A 1D7IA 2KGJA 2L2SA 4L3NA 1NWTA 1HKJA 1QPLA 4S3JA 2AWGA 2DMVA 2ESCA 3CHCA 4JFIA 4TW6A 1U79A 5JH8A 2PPOA 4JFLA 4JYSA 1ZBKA 1FKRA 1FJDA 4DRMA 2D9FA 2M8JA 1D7JA 4ODNA 3GU0A 4WK9A 2P4VA 2Y8NB 2BA1A 1GPFA 3CGNA 3KAFA 3KAHA 4ODKA 5BXJA 3WD0A 1CTNA 5GPGA 3FSCA 3PQHA 2WM0A 4UDMA 1B6CA 1X6NA 3IHZA 3W4RA 4A0TA 4LAYA 4HARA 3WQWA 1GUVA 5DIUA 3ARPA 2XP5A 1YATA 1FD9A 2ETNA 1GOIA 2DT1A 4TX0A 5HBFA 1HKIA 2ZR5A 2F4EA 2RUQA 1LL6A 3UQIA 4GGQA 2IUZA 2DT2A 1J4RA 2JZVA 1OGBA 1PBKA 1Y0OA 5HW7A 3LKXA 2LAJA 2XP7A 3LUOA 4N19A 4U84A 2OFNA 4ZPTR 2RUCA 1JVWA 4MNMA 3AS1A 3CZ8A 3WL1A 2PPPA 1H0GA 1LL7A 2N87A 1FKIA 3MDYB 1XHGA 1TK7A 3UI4A 5CQ2A 1H0IA 2ZQVA 2KO7A 2ZQTA 4E5RA 2MNTA 5J6EA 4MSPA 3ALGA 1BL4A 4P8XA 2YSFA 4JFMA 4R0XA 2KXQA 1FKHA 3ARRA 2DWVA 3H9RB 2M1IA 2WLYA 3CH9A 3QOKA 4AY1A 2VN1A 1HJXA 1W9UA 4J4NA 4MTVA 2OWOA 2ZQUA 3O5OA 3O5QA 2PI6A 3ALFA 1W9VA 3OOBA 3ARXA 3CHDA 3WD4A 2E45A 3WIJA 1XRVA 4DRJA 2PV2A 2RSEA 2M2AA 3ARYA 1E9LA 1OGGA 1TCOC 1HKKA 4A0UA 1LG1A 2ZAJA 2L4JA 3G6LA 4QT3A 5GQBA 4U85A 1EDQA 4Q7NA 2K8IA 3O5DA 5HW6A 4G2PA 5E62A 3G6MA 1E44A 4Z2GA 2JV4A 3JYMA 4G50A 4ZPVR 1FKFA 5DO2A 1YW5A 2ZR6A 1TFVA 4C02B 1RP5A 3ARQA 3FAPA 2LJ4A 5D75A 2JMFA 2DT0A 1E6PA 3TC5A 2MLZA 1A7XA 3FXYA 2KFWA 1ZBCA 2JXWA 4DRKA 2M08A 2WLZA 4TNSA 4IPXA 4MNLA 3CHFA 1O6IA 3RFWA 1NWUA 2A3EA 1J6YA 4QIBA 1J4HA 4DWSB 3O5FA 1FAPA 1FKJA 3KACA 4DRIA 4LAVA 1WR7A 5GPRA 3GTYX 4DH0A 5E64A 2XPBA 3RM9A 4KR0B 3PR9A 3O5MA 3KZ7A 1Q6UA 3MCBA 2QRVA 4LAWA 1JNDA 4WKHA 1FKSA 1PINA 2DPEA 5HWCA 4W9QA 2A3CA 4ODRA 3RMEA 2YSHA 2B31A 1N1AA 4Z2LA 4DROA 4JFJA 1O6WA 2YBTA 4Q22A 2ITKA 2XP6A 3GPKA 2XP9A 3WD3A 1WB0A 3O5JA 4Z2JA 1NWRA 1EYMA 3KAIA 3WH0A 1OWQA 2LKNA 2Q5AA 2DSVA 2IF4A 2EULA 4PTMA 5HTGA 1WMVA 3ARUA 1ITXA 1D6OA 1TR8A 4MGVA 1QZ2A 4IT6A 3LE4A 2MDIA 4ODOA 4U86A 2XP4A 1FKTA 2RUDA 3O5PA 2PV3A 1W9PA 4DRNA 2B5UB 1P5QA 1L1PA 1W1PA 1ZK6A 4S3KA 4DRHA 1FKKA 4JFKA 4DRPA 4WKAA 3MQHA 4NSBA 3RM4A 5HWBA 2M3OW 4FN2A 1HXVA 4P8WA 3O5EA 3CNGA 3NTPA 2DSUA 3UF8A 2G41A 1E6ZA 5DF0A 2YSGA 4MAVA 4W9OA 5HW8A 3UI6A 1EG3A 1JNEA 1NMWA 3JXVA 3KADA 1Q1CA 2F23A 1NH6A 4IT4A 4DWSD 4DRQA 4HBOA 1F40A 2QF8A 2F2DA 1GRJA 3TCZA 4TW7A 3PRBA 4P8VA 1HKMA 1HJVA 1EHNA 2DK7A 4R5EA 5DEZA 2ZQSA 4MPKA 3O5GA 3UQAA 3B8SA 3B9EA 1FKDA 1UR9A 2AOSA 2PBCA 3NI6A 1ZL1A 2DK1A 4Z2HA 2FDMA 4ODLA 2MLXA 3CGMA 2XP8A 2XPAA 4ODPA 1JNSA 1FKBA 3RGCA 5E66A 1ZB5A 1JCHB 4DWSA 4DWSC 4WKFA 1W1TA 3ARVA 3WL0A 4FAPA 3AROA 3EIPA 1JNTA 1M5YA 1LL4A 3PRDA 3WKZA 3WD2A 3OA5A 5U47A 4ODMA 2A3AA 2DSZA 1W1YA 3UI5A 4MNKA 4LGXA 1J4IA 2YSBA 1R9HA 4IQCA 3PA7A 3VAWA 1KT0A 2DSWA 2EZ5W 3JYJA 1K9RA 3B9AA 1W26A 4ML4A 1D2KA 1FKLA 1SR0A 1NWSA 1T11A 5HUAA 1X6LA 1E15A 5AHTA 3IKGA 1ZCNA 2O92A 2LGOA 1ZBWA 4ZPWR 2FKEA 2WAEA 3AS0A 5I98A 1EG4A 3AS2A 3O5IA 3M85A 1K9QA 1VF8A 3MQGA 2WADA
chains in the Genus database with same CATH topology
1BKFA 4W9PA 1K9TA 3FS8A 3M7NA 1WNOA 2MF9A 4GLXA 1I5HW 1KT1A 1ROTA 1JMQA 3RM8A 5E5WA 1HJWA 2F21A 2WK2A 3IK8A 4TYOA 2KR7A 4P8UA 2DG4A 2YSIA 4L72B 1KFWA 3LKXB 4REXA 4KQZA 1FKGA 3CHEA 5HKGA 2LPVA 4LAXA 1LG2A 2YBUA 4O2TA 1RD6A 3FY1A 2UZ5A 4WJXA 3FSBA 4WIWA 5B8IC 4MNJA 2DG9A 3ARZA 2FAPA 3L4HA 1UR8A 1Q6HA 1QPFA 3O5LA 3EY6A 3KABA 3IKDA 2KE0A 4GIVA 1IX5A 3O5KA 2RE3A 4ITZA 1EQ3A 1NMVA 4DT4A 2DJYA 3KAGA 3PRAA 4DZ2A 5DITA 2Y78A 2MLYA 3AQUA 2VCDA 4DIPA 1FLCA 1C9HA 1WAWA 4IQ2A 2XP3A 1FFQA 2A3BA 3BXWA 3AS3A 2M8IA 2OLHA 1W1VA 2PV1A 3I6CA 4URIA 1FFRA 3NRKA 1EIBA 1ZU8A 4W5UA 5DIVA 2ZR4A 2O9OA 3O5RA 4QZVB 1ROUA 2PPNA 3TDBA 4J4OA 1F8AB 3ARSA 3ARTA 2DG3A 4Z2IA 3ODKA 4HBEA 2RQSA 3B9DA 1LJYA 4QT2A 4NNRA 1NSGA 3B7XA 1E6NA 4BF8A 2KI3A 3KCEA 3WQVA 4DZ3A 1LQ0A 4TW8A 5E65A 2MPHA 4Z2KA 2G8ZA 3WD1A 2JX8A 1E6RA 3UQBA 2RURA 1ZBVA 4XAKA 1D7HA 4NZCA 3MCBB 4ODQA 4ZS6A 1Q6IA 1SYTA 3ARWA 5HT1A 2YAJB 2DT3A 1D7IA 2KGJA 2L2SA 4L3NA 1NWTA 1HKJA 1QPLA 4S3JA 2AWGA 2DMVA 2ESCA 3CHCA 4JFIA 4TW6A 1U79A 5JH8A 2PPOA 4JFLA 4JYSA 1ZBKA 1FKRA 1FJDA 4DRMA 2D9FA 2M8JA 1D7JA 4ODNA 4WK9A 2Y8NB 2BA1A 1GPFA 3CGNA 3KAFA 3KAHA 4ODKA 5BXJA 3WD0A 1CTNA 5GPGA 3FSCA 3PQHA 2WM0A 1B6CA 1X6NA 3IHZA 3W4RA 4A0TA 4LAYA 4HARA 3WQWA 1GUVA 5DIUA 3ARPA 2XP5A 1YATA 1FD9A 5HBFA 1GOIA 2DT1A 4TX0A 1HKIA 2ZR5A 2F4EA 2RUQA 1LL6A 3UQIA 4GGQA 2IUZA 2DT2A 1J4RA 2JZVA 1OGBA 1PBKA 1Y0OA 5HW7A 3LKXA 2LAJA 2XP7A 3LUOA 4N19A 4U84A 2OFNA 4ZPTR 2RUCA 1JVWA 4MNMA 3AS1A 3CZ8A 3WL1A 2PPPA 1H0GA 1LL7A 2N87A 1FKIA 3MDYB 1XHGA 1TK7A 3UI4A 5CQ2A 1H0IA 2ZQVA 2KO7A 2ZQTA 4E5RA 2MNTA 5J6EA 4MSPA 3ALGA 1BL4A 4P8XA 2YSFA 4JFMA 4R0XA 2KXQA 1FKHA 3ARRA 2DWVA 3H9RB 2M1IA 2WLYA 3CH9A 3QOKA 4AY1A 2VN1A 1HJXA 1W9UA 4J4NA 4MTVA 2OWOA 2ZQUA 3O5OA 3O5QA 2PI6A 3ALFA 1W9VA 3OOBA 3ARXA 3CHDA 3WD4A 2E45A 3WIJA 1XRVA 4DRJA 2PV2A 2RSEA 2M2AA 3ARYA 1E9LA 1OGGA 1TCOC 1HKKA 4A0UA 1LG1A 2ZAJA 2L4JA 3G6LA 4QT3A 5GQBA 4U85A 1EDQA 4Q7NA 2K8IA 3O5DA 5HW6A 4G2PA 5E62A 3G6MA 4Z2GA 2JV4A 3JYMA 4G50A 4ZPVR 1FKFA 5DO2A 1YW5A 2ZR6A 1TFVA 4C02B 1RP5A 3ARQA 3FAPA 2LJ4A 5D75A 2JMFA 2DT0A 1E6PA 3TC5A 2MLZA 1A7XA 3FXYA 2KFWA 1ZBCA 2JXWA 4DRKA 2M08A 2WLZA 4TNSA 4IPXA 4MNLA 3CHFA 1O6IA 3RFWA 1NWUA 2A3EA 1J6YA 4QIBA 1J4HA 4DWSB 3O5FA 1FAPA 1FKJA 3KACA 4DRIA 4LAVA 1WR7A 5GPRA 4DH0A 5E64A 2XPBA 3RM9A 4KR0B 3PR9A 3O5MA 3KZ7A 1Q6UA 3MCBA 2QRVA 4LAWA 1JNDA 4WKHA 1FKSA 1PINA 2DPEA 5HWCA 4W9QA 2A3CA 4ODRA 3RMEA 2YSHA 2B31A 1N1AA 4Z2LA 4DROA 4JFJA 1O6WA 2YBTA 4Q22A 2ITKA 2XP6A 3GPKA 2XP9A 3WD3A 1WB0A 3O5JA 4Z2JA 1NWRA 1EYMA 3KAIA 3WH0A 1OWQA 2LKNA 2Q5AA 2DSVA 2IF4A 4PTMA 5HTGA 1WMVA 3ARUA 1ITXA 1D6OA 1TR8A 4MGVA 1QZ2A 4IT6A 3LE4A 2MDIA 4ODOA 4U86A 2XP4A 1FKTA 2RUDA 3O5PA 2PV3A 1W9PA 4DRNA 1P5QA 1L1PA 1W1PA 1ZK6A 4S3KA 4DRHA 1FKKA 4JFKA 4DRPA 4WKAA 3MQHA 4NSBA 3RM4A 5HWBA 2M3OW 4FN2A 1HXVA 4P8WA 3O5EA 3CNGA 3NTPA 2DSUA 3UF8A 2G41A 1E6ZA 5DF0A 2YSGA 4MAVA 4W9OA 5HW8A 3UI6A 1EG3A 1JNEA 1NMWA 3JXVA 3KADA 1Q1CA 1NH6A 4IT4A 4DWSD 4DRQA 4HBOA 1F40A 2QF8A 2F2DA 3TCZA 4TW7A 3PRBA 4P8VA 1HKMA 1HJVA 1EHNA 2DK7A 4R5EA 5DEZA 2ZQSA 4MPKA 3O5GA 3UQAA 3B8SA 3B9EA 1FKDA 1UR9A 2AOSA 2PBCA 3NI6A 1ZL1A 2DK1A 4Z2HA 2FDMA 4ODLA 2MLXA 3CGMA 2XP8A 2XPAA 4ODPA 1JNSA 1FKBA 3RGCA 5E66A 1ZB5A 4DWSA 4DWSC 4WKFA 1W1TA 3ARVA 3WL0A 4FAPA 3AROA 1JNTA 1M5YA 1LL4A 3PRDA 3WKZA 3WD2A 3OA5A 5U47A 4ODMA 2A3AA 2DSZA 1W1YA 3UI5A 4MNKA 4LGXA 1J4IA 2YSBA 1R9HA 4IQCA 3PA7A 3VAWA 1KT0A 2DSWA 2EZ5W 3JYJA 1K9RA 3B9AA 1W26A 4ML4A 1D2KA 1FKLA 1SR0A 1NWSA 1T11A 5HUAA 1X6LA 1E15A 5AHTA 3IKGA 1ZCNA 2O92A 2LGOA 1ZBWA 4ZPWR 2FKEA 2WAEA 3AS0A 5I98A 1EG4A 3AS2A 3O5IA 3M85A 1K9QA 1VF8A 3MQGA 2WADA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4FN2 A;  2K8I A;  1BKF A;  1QPL A;  4W9P A;  1HXV A;  3M7N A;  2AWG A;  3O5E A;  2DMV A;  3CNG A;  3O5D A;  3NTP A;  2MF9 A;  4JFI A;  3UF8 A;  1I5H W;  5HW6 A;  4G2P A;  4TW6 A;  1KT1 A;  1ROT A;  1JMQ A;  1U79 A;  2PPO A;  4JFL A;  4JYS A;  1FKR A;  5DIT A;  2JV4 A;  2F21 A;  2YSG A;  2D9F A;  3JYM A;  4G50 A;  4W9O A;  1FKF A;  3IK8 A;  1YW5 A;  1EG3 A;  2M8J A;  2ZR6 A;  1D7J A;  3KAD A;  1NMW A;  2YSI A;  2DG4 A;  2KR7 A;  3JXV A;  4ODN A;  1Q1C A;  2BA1 A;  3CGN A;  4REX A;  4DRQ A;  1F40 A;  3FAP A;  3KAF A;  1FKG A;  2F2D A;  2LJ4 A;  2JMF A;  3TCZ A;  4TW7 A;  5D75 A;  3KAH A;  3TC5 A;  3PRB A;  2LPV A;  2MLZ A;  1A7X A;  4LAX A;  4ODK A;  5BXJ A;  1FJD A;  5GPG A;  2KFW A;  4O2T A;  2JXW A;  1B6C A;  4DRK A;  2M08 A;  2UZ5 A;  3IHZ A;  4TNS A;  2DK7 A;  4IPX A;  4LAY A;  5B8I C;  2ZQS A;  2DG9 A;  5DIU A;  3RFW A;  2XP5 A;  1YAT A;  2FAP A;  3O5G A;  3L4H A;  3UQA A;  4QIB A;  1FD9 A;  1Q6H A;  1J6Y A;  4TX0 A;  1J4H A;  1QPF A;  3O5L A;  4C02 B;  5HW8 A;  3EY6 A;  3KAB A;  3O5F A;  3UI6 A;  2ZR5 A;  1FAP A;  1FKJ A;  2F4E A;  3IKD A;  3KAC A;  4DRI A;  1FKD A;  2RUQ A;  4LAV A;  1WR7 A;  3UQI A;  2KE0 A;  4GGQ A;  4GIV A;  4DH0 A;  3O5K A;  2RE3 A;  2XPB A;  1J4R A;  2JZV A;  4ITZ A;  1EQ3 A;  1NMV A;  2PBC A;  3NI6 A;  2DK1 A;  3O5M A;  4DT4 A;  2DJY A;  3KZ7 A;  1Q6U A;  1PBK A;  1Y0O A;  4ODL A;  4LAW A;  5HW7 A;  3KAG A;  2MLX A;  3CGM A;  4DZ2 A;  2LAJ A;  2XP8 A;  2XPA A;  2XP7 A;  2Y78 A;  4U84 A;  2MLY A;  1FKS A;  1PIN A;  2OFN A;  2RUC A;  2VCD A;  4N19 A;  4ODP A;  4TYO A;  1C9H A;  1FKB A;  1JVW A;  4IQ2 A;  4ODR A;  4W9Q A;  3RGC A;  2XP3 A;  3LUO A;  2PPP A;  5HWC A;  2N87 A;  2M8I A;  2YSH A;  1FKI A;  3MDY B;  4FAP A;  1N1A A;  1TK7 A;  3UI4 A;  4DRO A;  2PV1 A;  4JFJ A;  5CQ2 A;  1O6W A;  3I6C A;  2ZQV A;  4DRM A;  1JNT A;  1M5Y A;  2KO7 A;  3PRD A;  2ZQT A;  4E5R A;  2MNT A;  5J6E A;  3NRK A;  4MSP A;  4ODM A;  2ITK A;  1BL4 A;  5DIV A;  2ZR4 A;  2XP6 A;  3GPK A;  3O5R A;  2YSF A;  1ROU A;  2PPN A;  2KXQ A;  2YSB A;  2XP9 A;  1F8A B;  3TDB A;  1J4I A;  1FKH A;  1R9H A;  4J4O A;  3O5J A;  4IQC A;  3PA7 A;  2DG3 A;  4JFM A;  2DWV A;  1EYM A;  3KAI A;  3H9R B;  3WH0 A;  2M1I A;  3ODK A;  3VAW A;  2LKN A;  2Q5A A;  2IF4 A;  2RQS A;  2VN1 A;  1KT0 A;  5HTG A;  2EZ5 W;  1WMV A;  4QT2 A;  4NNR A;  1D6O A;  1NSG A;  3B7X A;  3JYJ A;  4BF8 A;  1JNS A;  2KI3 A;  1K9R A;  4J4N A;  4MGV A;  1QZ2 A;  1W26 A;  1FKL A;  3KCE A;  5HKG A;  5HUA A;  1T11 A;  4DZ3 A;  2ZQU A;  3LE4 A;  3O5O A;  2MDI A;  3O5Q A;  4DIP A;  4TW8 A;  2MPH A;  3OOB A;  4ODO A;  4U86 A;  2XP4 A;  5AHT A;  1FKT A;  2RUD A;  3IKG A;  2JX8 A;  2PV3 A;  3O5P A;  3UQB A;  4DRN A;  1ZCN A;  2E45 A;  2RUR A;  2LGO A;  4DRJ A;  2PV2 A;  2RSE A;  2M2A A;  1D7H A;  2FKE A;  4ODQ A;  1TCO C;  4R0X A;  1Q6I A;  2ZAJ A;  1P5Q A;  5I98 A;  1L1P A;  2L4J A;  1EG4 A;  3UI5 A;  3O5I A;  5HT1 A;  3M85 A;  1ZK6 A;  4DRH A;  1FKK A;  4JFK A;  1K9Q A;  4QT3 A;  1D7I A;  4DRP A;  2KGJ A;  4U85 A;  2L2S A;  5HWB A;  2M3O W; 
#chains in the Genus database with same CATH topology
 1BKF A;  4W9P A;  1K9T A;  3FS8 A;  3M7N A;  1WNO A;  2MF9 A;  4GLX A;  1I5H W;  1KT1 A;  1ROT A;  1JMQ A;  3RM8 A;  5E5W A;  1HJW A;  2F21 A;  2WK2 A;  3IK8 A;  4TYO A;  2KR7 A;  4P8U A;  2DG4 A;  2YSI A;  4L72 B;  1KFW A;  2PN0 A;  3LKX B;  4REX A;  4KQZ A;  1FKG A;  3CHE A;  5HKG A;  2LPV A;  4LAX A;  1LG2 A;  2YBU A;  3BMB A;  4O2T A;  1RD6 A;  3FY1 A;  2UZ5 A;  4WJX A;  3FSB A;  4WIW A;  5B8I C;  4MNJ A;  2DG9 A;  3ARZ A;  2FAP A;  3L4H A;  1UR8 A;  1Q6H A;  1QPF A;  3O5L A;  3EY6 A;  3KAB A;  3IKD A;  2KE0 A;  4GIV A;  1IX5 A;  3O5K A;  2RE3 A;  4ITZ A;  1EQ3 A;  1NMV A;  4DT4 A;  2DJY A;  3KAG A;  3PRA A;  4DZ2 A;  5DIT A;  2Y78 A;  2MLY A;  3AQU A;  2VCD A;  4DIP A;  1FLC A;  1C9H A;  1WAW A;  4IQ2 A;  2XP3 A;  1FFQ A;  2A3B A;  3BXW A;  3AS3 A;  2M8I A;  2OLH A;  1W1V A;  2PV1 A;  3I6C A;  4URI A;  1FFR A;  3NRK A;  1EIB A;  1ZU8 A;  4W5U A;  5DIV A;  2ZR4 A;  2O9O A;  3O5R A;  4QZV B;  1ROU A;  2PPN A;  3TDB A;  4J4O A;  1F8A B;  3ARS A;  3ART A;  2DG3 A;  4Z2I A;  3ODK A;  4HBE A;  2RQS A;  3B9D A;  1LJY A;  4QT2 A;  4NNR A;  1NSG A;  3B7X A;  1E6N A;  4BF8 A;  2KI3 A;  3KCE A;  3WQV A;  4DZ3 A;  1LQ0 A;  4TW8 A;  5E65 A;  2MPH A;  4Z2K A;  2G8Z A;  3WD1 A;  2JX8 A;  1E6R A;  3UQB A;  2RUR A;  1ZBV A;  4XAK A;  1D7H A;  4NZC A;  3MCB B;  4ODQ A;  4ZS6 A;  1Q6I A;  1SYT A;  3ARW A;  5HT1 A;  2YAJ B;  2DT3 A;  1D7I A;  2KGJ A;  2L2S A;  4L3N A;  1NWT A;  1HKJ A;  1QPL A;  4S3J A;  2AWG A;  2DMV A;  2ESC A;  3CHC A;  4JFI A;  4TW6 A;  1U79 A;  5JH8 A;  2PPO A;  4JFL A;  4JYS A;  1ZBK A;  1FKR A;  1FJD A;  4DRM A;  2D9F A;  2M8J A;  1D7J A;  4ODN A;  3GU0 A;  4WK9 A;  2P4V A;  2Y8N B;  2BA1 A;  1GPF A;  3CGN A;  3KAF A;  3KAH A;  4ODK A;  5BXJ A;  3WD0 A;  1CTN A;  5GPG A;  3FSC A;  3PQH A;  2WM0 A;  4UDM A;  1B6C A;  1X6N A;  3IHZ A;  3W4R A;  4A0T A;  4LAY A;  4HAR A;  3WQW A;  1GUV A;  5DIU A;  3ARP A;  2XP5 A;  1YAT A;  1FD9 A;  2ETN A;  1GOI A;  2DT1 A;  4TX0 A;  5HBF A;  1HKI A;  2ZR5 A;  2F4E A;  2RUQ A;  1LL6 A;  3UQI A;  4GGQ A;  2IUZ A;  2DT2 A;  1J4R A;  2JZV A;  1OGB A;  1PBK A;  1Y0O A;  5HW7 A;  3LKX A;  2LAJ A;  2XP7 A;  3LUO A;  4N19 A;  4U84 A;  2OFN A;  4ZPT R;  2RUC A;  1JVW A;  4MNM A;  3AS1 A;  3CZ8 A;  3WL1 A;  2PPP A;  1H0G A;  1LL7 A;  2N87 A;  1FKI A;  3MDY B;  1XHG A;  1TK7 A;  3UI4 A;  5CQ2 A;  1H0I A;  2ZQV A;  2KO7 A;  2ZQT A;  4E5R A;  2MNT A;  5J6E A;  4MSP A;  3ALG A;  1BL4 A;  4P8X A;  2YSF A;  4JFM A;  4R0X A;  2KXQ A;  1FKH A;  3ARR A;  2DWV A;  3H9R B;  2M1I A;  2WLY A;  3CH9 A;  3QOK A;  4AY1 A;  2VN1 A;  1HJX A;  1W9U A;  4J4N A;  4MTV A;  2OWO A;  2ZQU A;  3O5O A;  3O5Q A;  2PI6 A;  3ALF A;  1W9V A;  3OOB A;  3ARX A;  3CHD A;  3WD4 A;  2E45 A;  3WIJ A;  1XRV A;  4DRJ A;  2PV2 A;  2RSE A;  2M2A A;  3ARY A;  1E9L A;  1OGG A;  1TCO C;  1HKK A;  4A0U A;  1LG1 A;  2ZAJ A;  2L4J A;  3G6L A;  4QT3 A;  5GQB A;  4U85 A;  1EDQ A;  4Q7N A;  2K8I A;  3O5D A;  5HW6 A;  4G2P A;  5E62 A;  3G6M A;  1E44 A;  4Z2G A;  2JV4 A;  3JYM A;  4G50 A;  4ZPV R;  1FKF A;  5DO2 A;  1YW5 A;  2ZR6 A;  1TFV A;  4C02 B;  1RP5 A;  3ARQ A;  3FAP A;  2LJ4 A;  5D75 A;  2JMF A;  2DT0 A;  1E6P A;  3TC5 A;  2MLZ A;  1A7X A;  3FXY A;  2KFW A;  1ZBC A;  2JXW A;  4DRK A;  2M08 A;  2WLZ A;  4TNS A;  4IPX A;  4MNL A;  3CHF A;  1O6I A;  3RFW A;  1NWU A;  2A3E A;  1J6Y A;  4QIB A;  1J4H A;  4DWS B;  3O5F A;  1FAP A;  1FKJ A;  3KAC A;  4DRI A;  4LAV A;  1WR7 A;  5GPR A;  3GTY X;  4DH0 A;  5E64 A;  2XPB A;  3RM9 A;  4KR0 B;  3PR9 A;  3O5M A;  3KZ7 A;  1Q6U A;  3MCB A;  2QRV A;  4LAW A;  1JND A;  4WKH A;  1FKS A;  1PIN A;  2DPE A;  5HWC A;  4W9Q A;  2A3C A;  4ODR A;  3RME A;  2YSH A;  2B31 A;  1N1A A;  4Z2L A;  4DRO A;  4JFJ A;  1O6W A;  2YBT A;  4Q22 A;  2ITK A;  2XP6 A;  3GPK A;  2XP9 A;  3WD3 A;  1WB0 A;  3O5J A;  4Z2J A;  1NWR A;  1EYM A;  3KAI A;  3WH0 A;  1OWQ A;  2LKN A;  2Q5A A;  2DSV A;  2IF4 A;  2EUL A;  4PTM A;  5HTG A;  1WMV A;  3ARU A;  1ITX A;  1D6O A;  1TR8 A;  4MGV A;  1QZ2 A;  4IT6 A;  3LE4 A;  2MDI A;  4ODO A;  4U86 A;  2XP4 A;  1FKT A;  2RUD A;  3O5P A;  2PV3 A;  1W9P A;  4DRN A;  2B5U B;  1P5Q A;  1L1P A;  1W1P A;  1ZK6 A;  4S3K A;  4DRH A;  1FKK A;  4JFK A;  4DRP A;  4WKA A;  3MQH A;  4NSB A;  3RM4 A;  5HWB A;  2M3O W;  4FN2 A;  1HXV A;  4P8W A;  3O5E A;  3CNG A;  3NTP A;  2DSU A;  3UF8 A;  2G41 A;  1E6Z A;  5DF0 A;  2YSG A;  4MAV A;  4W9O A;  5HW8 A;  3UI6 A;  1EG3 A;  1JNE A;  1NMW A;  3JXV A;  3KAD A;  1Q1C A;  2F23 A;  1NH6 A;  4IT4 A;  4DWS D;  4DRQ A;  4HBO A;  1F40 A;  2QF8 A;  2F2D A;  1GRJ A;  3TCZ A;  4TW7 A;  3PRB A;  4P8V A;  1HKM A;  1HJV A;  1EHN A;  2DK7 A;  4R5E A;  5DEZ A;  2ZQS A;  4MPK A;  3O5G A;  3UQA A;  3B8S A;  3B9E A;  1FKD A;  1UR9 A;  2AOS A;  2PBC A;  3NI6 A;  1ZL1 A;  2DK1 A;  4Z2H A;  2FDM A;  4ODL A;  2MLX A;  3CGM A;  2XP8 A;  2XPA A;  4ODP A;  1JNS A;  1FKB A;  3RGC A;  5E66 A;  1ZB5 A;  1JCH B;  4DWS A;  4DWS C;  4WKF A;  1W1T A;  3ARV A;  3WL0 A;  4FAP A;  3ARO A;  3EIP A;  1JNT A;  1M5Y A;  1LL4 A;  3PRD A;  3WKZ A;  3WD2 A;  3OA5 A;  5U47 A;  4ODM A;  2A3A A;  2DSZ A;  1W1Y A;  3UI5 A;  4MNK A;  4LGX A;  1J4I A;  2YSB A;  1R9H A;  4IQC A;  3PA7 A;  3VAW A;  1KT0 A;  2DSW A;  2EZ5 W;  3JYJ A;  1K9R A;  3B9A A;  1W26 A;  4ML4 A;  1D2K A;  1FKL A;  1SR0 A;  1NWS A;  1T11 A;  5HUA A;  1X6L A;  1E15 A;  5AHT A;  3IKG A;  1ZCN A;  2O92 A;  2LGO A;  1ZBW A;  4ZPW R;  2FKE A;  2WAE A;  3AS0 A;  5I98 A;  1EG4 A;  3AS2 A;  3O5I A;  3M85 A;  1K9Q A;  1VF8 A;  3MQG A;  2WAD A; 
#chains in the Genus database with same CATH homology
 1BKF A;  4W9P A;  1K9T A;  3FS8 A;  3M7N A;  1WNO A;  2MF9 A;  4GLX A;  1I5H W;  1KT1 A;  1ROT A;  1JMQ A;  3RM8 A;  5E5W A;  1HJW A;  2F21 A;  2WK2 A;  3IK8 A;  4TYO A;  2KR7 A;  4P8U A;  2DG4 A;  2YSI A;  4L72 B;  1KFW A;  3LKX B;  4REX A;  4KQZ A;  1FKG A;  3CHE A;  5HKG A;  2LPV A;  4LAX A;  1LG2 A;  2YBU A;  4O2T A;  1RD6 A;  3FY1 A;  2UZ5 A;  4WJX A;  3FSB A;  4WIW A;  5B8I C;  4MNJ A;  2DG9 A;  3ARZ A;  2FAP A;  3L4H A;  1UR8 A;  1Q6H A;  1QPF A;  3O5L A;  3EY6 A;  3KAB A;  3IKD A;  2KE0 A;  4GIV A;  1IX5 A;  3O5K A;  2RE3 A;  4ITZ A;  1EQ3 A;  1NMV A;  4DT4 A;  2DJY A;  3KAG A;  3PRA A;  4DZ2 A;  5DIT A;  2Y78 A;  2MLY A;  3AQU A;  2VCD A;  4DIP A;  1FLC A;  1C9H A;  1WAW A;  4IQ2 A;  2XP3 A;  1FFQ A;  2A3B A;  3BXW A;  3AS3 A;  2M8I A;  2OLH A;  1W1V A;  2PV1 A;  3I6C A;  4URI A;  1FFR A;  3NRK A;  1EIB A;  1ZU8 A;  4W5U A;  5DIV A;  2ZR4 A;  2O9O A;  3O5R A;  4QZV B;  1ROU A;  2PPN A;  3TDB A;  4J4O A;  1F8A B;  3ARS A;  3ART A;  2DG3 A;  4Z2I A;  3ODK A;  4HBE A;  2RQS A;  3B9D A;  1LJY A;  4QT2 A;  4NNR A;  1NSG A;  3B7X A;  1E6N A;  4BF8 A;  2KI3 A;  3KCE A;  3WQV A;  4DZ3 A;  1LQ0 A;  4TW8 A;  5E65 A;  2MPH A;  4Z2K A;  2G8Z A;  3WD1 A;  2JX8 A;  1E6R A;  3UQB A;  2RUR A;  1ZBV A;  4XAK A;  1D7H A;  4NZC A;  3MCB B;  4ODQ A;  4ZS6 A;  1Q6I A;  1SYT A;  3ARW A;  5HT1 A;  2YAJ B;  2DT3 A;  1D7I A;  2KGJ A;  2L2S A;  4L3N A;  1NWT A;  1HKJ A;  1QPL A;  4S3J A;  2AWG A;  2DMV A;  2ESC A;  3CHC A;  4JFI A;  4TW6 A;  1U79 A;  5JH8 A;  2PPO A;  4JFL A;  4JYS A;  1ZBK A;  1FKR A;  1FJD A;  4DRM A;  2D9F A;  2M8J A;  1D7J A;  4ODN A;  4WK9 A;  2Y8N B;  2BA1 A;  1GPF A;  3CGN A;  3KAF A;  3KAH A;  4ODK A;  5BXJ A;  3WD0 A;  1CTN A;  5GPG A;  3FSC A;  3PQH A;  2WM0 A;  1B6C A;  1X6N A;  3IHZ A;  3W4R A;  4A0T A;  4LAY A;  4HAR A;  3WQW A;  1GUV A;  5DIU A;  3ARP A;  2XP5 A;  1YAT A;  1FD9 A;  5HBF A;  1GOI A;  2DT1 A;  4TX0 A;  1HKI A;  2ZR5 A;  2F4E A;  2RUQ A;  1LL6 A;  3UQI A;  4GGQ A;  2IUZ A;  2DT2 A;  1J4R A;  2JZV A;  1OGB A;  1PBK A;  1Y0O A;  5HW7 A;  3LKX A;  2LAJ A;  2XP7 A;  3LUO A;  4N19 A;  4U84 A;  2OFN A;  4ZPT R;  2RUC A;  1JVW A;  4MNM A;  3AS1 A;  3CZ8 A;  3WL1 A;  2PPP A;  1H0G A;  1LL7 A;  2N87 A;  1FKI A;  3MDY B;  1XHG A;  1TK7 A;  3UI4 A;  5CQ2 A;  1H0I A;  2ZQV A;  2KO7 A;  2ZQT A;  4E5R A;  2MNT A;  5J6E A;  4MSP A;  3ALG A;  1BL4 A;  4P8X A;  2YSF A;  4JFM A;  4R0X A;  2KXQ A;  1FKH A;  3ARR A;  2DWV A;  3H9R B;  2M1I A;  2WLY A;  3CH9 A;  3QOK A;  4AY1 A;  2VN1 A;  1HJX A;  1W9U A;  4J4N A;  4MTV A;  2OWO A;  2ZQU A;  3O5O A;  3O5Q A;  2PI6 A;  3ALF A;  1W9V A;  3OOB A;  3ARX A;  3CHD A;  3WD4 A;  2E45 A;  3WIJ A;  1XRV A;  4DRJ A;  2PV2 A;  2RSE A;  2M2A A;  3ARY A;  1E9L A;  1OGG A;  1TCO C;  1HKK A;  4A0U A;  1LG1 A;  2ZAJ A;  2L4J A;  3G6L A;  4QT3 A;  5GQB A;  4U85 A;  1EDQ A;  4Q7N A;  2K8I A;  3O5D A;  5HW6 A;  4G2P A;  5E62 A;  3G6M A;  4Z2G A;  2JV4 A;  3JYM A;  4G50 A;  4ZPV R;  1FKF A;  5DO2 A;  1YW5 A;  2ZR6 A;  1TFV A;  4C02 B;  1RP5 A;  3ARQ A;  3FAP A;  2LJ4 A;  5D75 A;  2JMF A;  2DT0 A;  1E6P A;  3TC5 A;  2MLZ A;  1A7X A;  3FXY A;  2KFW A;  1ZBC A;  2JXW A;  4DRK A;  2M08 A;  2WLZ A;  4TNS A;  4IPX A;  4MNL A;  3CHF A;  1O6I A;  3RFW A;  1NWU A;  2A3E A;  1J6Y A;  4QIB A;  1J4H A;  4DWS B;  3O5F A;  1FAP A;  1FKJ A;  3KAC A;  4DRI A;  4LAV A;  1WR7 A;  5GPR A;  4DH0 A;  5E64 A;  2XPB A;  3RM9 A;  4KR0 B;  3PR9 A;  3O5M A;  3KZ7 A;  1Q6U A;  3MCB A;  2QRV A;  4LAW A;  1JND A;  4WKH A;  1FKS A;  1PIN A;  2DPE A;  5HWC A;  4W9Q A;  2A3C A;  4ODR A;  3RME A;  2YSH A;  2B31 A;  1N1A A;  4Z2L A;  4DRO A;  4JFJ A;  1O6W A;  2YBT A;  4Q22 A;  2ITK A;  2XP6 A;  3GPK A;  2XP9 A;  3WD3 A;  1WB0 A;  3O5J A;  4Z2J A;  1NWR A;  1EYM A;  3KAI A;  3WH0 A;  1OWQ A;  2LKN A;  2Q5A A;  2DSV A;  2IF4 A;  4PTM A;  5HTG A;  1WMV A;  3ARU A;  1ITX A;  1D6O A;  1TR8 A;  4MGV A;  1QZ2 A;  4IT6 A;  3LE4 A;  2MDI A;  4ODO A;  4U86 A;  2XP4 A;  1FKT A;  2RUD A;  3O5P A;  2PV3 A;  1W9P A;  4DRN A;  1P5Q A;  1L1P A;  1W1P A;  1ZK6 A;  4S3K A;  4DRH A;  1FKK A;  4JFK A;  4DRP A;  4WKA A;  3MQH A;  4NSB A;  3RM4 A;  5HWB A;  2M3O W;  4FN2 A;  1HXV A;  4P8W A;  3O5E A;  3CNG A;  3NTP A;  2DSU A;  3UF8 A;  2G41 A;  1E6Z A;  5DF0 A;  2YSG A;  4MAV A;  4W9O A;  5HW8 A;  3UI6 A;  1EG3 A;  1JNE A;  1NMW A;  3JXV A;  3KAD A;  1Q1C A;  1NH6 A;  4IT4 A;  4DWS D;  4DRQ A;  4HBO A;  1F40 A;  2QF8 A;  2F2D A;  3TCZ A;  4TW7 A;  3PRB A;  4P8V A;  1HKM A;  1HJV A;  1EHN A;  2DK7 A;  4R5E A;  5DEZ A;  2ZQS A;  4MPK A;  3O5G A;  3UQA A;  3B8S A;  3B9E A;  1FKD A;  1UR9 A;  2AOS A;  2PBC A;  3NI6 A;  1ZL1 A;  2DK1 A;  4Z2H A;  2FDM A;  4ODL A;  2MLX A;  3CGM A;  2XP8 A;  2XPA A;  4ODP A;  1JNS A;  1FKB A;  3RGC A;  5E66 A;  1ZB5 A;  4DWS A;  4DWS C;  4WKF A;  1W1T A;  3ARV A;  3WL0 A;  4FAP A;  3ARO A;  1JNT A;  1M5Y A;  1LL4 A;  3PRD A;  3WKZ A;  3WD2 A;  3OA5 A;  5U47 A;  4ODM A;  2A3A A;  2DSZ A;  1W1Y A;  3UI5 A;  4MNK A;  4LGX A;  1J4I A;  2YSB A;  1R9H A;  4IQC A;  3PA7 A;  3VAW A;  1KT0 A;  2DSW A;  2EZ5 W;  3JYJ A;  1K9R A;  3B9A A;  1W26 A;  4ML4 A;  1D2K A;  1FKL A;  1SR0 A;  1NWS A;  1T11 A;  5HUA A;  1X6L A;  1E15 A;  5AHT A;  3IKG A;  1ZCN A;  2O92 A;  2LGO A;  1ZBW A;  4ZPW R;  2FKE A;  2WAE A;  3AS0 A;  5I98 A;  1EG4 A;  3AS2 A;  3O5I A;  3M85 A;  1K9Q A;  1VF8 A;  3MQG A;  2WAD A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...