2XP4A

Discovery of cell-active phenyl-imidazole pin1 inhibitors by structure-guided fragment evolution
Total Genus 46
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
46
sequence length
157
structure length
144
Chain Sequence
LPPGWEKAMSRSSGRVYYFNHITNASQWERPEPARVRCSHLLVKHSQSRRPSSWRQEKITRTKEEALELINGYIQKIKSGEEDFESLASQFSDCSSAKARGDLGAFSRGQMQKPFEDASFALRTGEMSGPVFTDSGIHIILRTE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PEPTIDYL-PROLYL CIS-TRANS ISOMERASE NIMA-INTERACTING 1
publication title Discovery of Cell-Active Phenyl-Imidazole Pin1 Inhibitors by Structure-Guided Fragment Evolution.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Isomerase
total genus 46
structure length 144
sequence length 157
ec nomenclature ec 5.2.1.8: Peptidylprolyl isomerase.
pdb deposition date 2010-08-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00397 WW WW domain
A PF00639 Rotamase PPIC-type PPIASE domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.20.70.10 Mainly Beta Single Sheet Ubiquitin Ligase Nedd4; Chain: W; Ubiquitin Ligase Nedd4; Chain: W; 2xp4A01
3.10.50.40 Alpha Beta Roll Chitinase A; domain 3 Chitinase A; domain 3 2xp4A02
1Y0OA 4QT3A 2LKNA 1EG4A 2M1IA 2XP3A 2XPBA 5HW6A 2XP9A 5AHTA 5HTGA 1QZ2A 1WR7A 2ZQVA 2YSFA 4U85A 1NMWA 3LE4A 1FJDA 4TW6A 3O5KA 4LAVA 2ZR6A 4ODRA 3FAPA 3CGNA 3O5MA 2LJ4A 1W26A 2M8IA 2PPPA 3O5LA 4LAWA 1B6CA 1BL4A 4JFJA 3O5JA 1JMQA 1D7IA 2ZQTA 2Y78A 1T11A 1FKHA 5HW7A 3TC5A 5HUAA 4JFKA 4DH0A 1R9HA 3TCZA 3M85A 4DRJA 2MPHA 4TYOA 5DIVA 1PINA 4ODNA 4DRNA 3IKGA 3KAHA 3UF8A 4U86A 2XP5A 1Q6IA 3KABA 1J4RA 4DIPA 3RGCA 2MLYA 1Q6HA 4ODLA 4DT4A 4ITZA 3PRBA 2VCDA 3O5DA 2DK1A 4N19A 4JFLA 4QT2A 4W9QA 1HXVA 1FKJA 5I98A 2N87A 4DRKA 3UQBA 1K9QA 4JFMA 4W9OA 5GPGA 4DRMA 2KGJA 1EYMA 2KR7A 1L1PA 3NI6A 4G2PA 3JYMA 4FN2A 3O5QA 3I6CA 3M7NA 4JYSA 1YW5A 1PBKA 3O5GA 2JV4A 4BF8A 1JNSA 1F40A 4DRPA 3O5PA 4QIBA 3B7XA 1FKDA 3EY6A 3H9RB 2RUDA 4IPXA 3KZ7A 4R0XA 2KXQA 1J4IA 2KE0A 2DK7A 1FKFA 1TK7A 1Q1CA 2MF9A 2RURA 2VN1A 1JVWA 2MLXA 2JMFA 1YATA 5HW8A 5DITA 3O5FA 2FKEA 2RE3A 2ZQUA 1JNTA 2BA1A 4JFIA 1BKFA 2F4EA 1NSGA 4TX0A 4DRQA 1D7HA 1ZK6A 4DRHA 3LUOA 2XPAA 1J4HA 1C9HA 2AWGA 4O2TA 4IQCA 1J6YA 4DROA 3KAGA 4ODMA 2IF4A 2RUQA 2M08A 5HT1A 3PA7A 3O5EA 1FD9A 2EZ5W 2DG9A 2M3OW 3UQIA 5HWBA 5J6EA 2ITKA 2L4JA 3L4HA 2JZVA 3RFWA 2YSHA 2DJYA 3CNGA 3KAFA 2KI3A 1EG3A 1FKGA 5BXJA 3O5IA 2LPVA 2LGOA 4MGVA 2UZ5A 2DWVA 5CQ2A 1M5YA 5HWCA 3KCEA 3UI6A 1QPLA 2JXWA 3CGMA 2YSBA 2XP7A 4LAYA 5DIUA 4ODQA 3WH0A 4TNSA 3UI4A 2F21A 2PV2A 1N1AA 2D9FA 2ZQSA 1D7JA 1EQ3A 4W9PA 2KFWA 1P5QA 3GPKA 4MSPA 1U79A 2FAPA 1K9RA 2K8IA 4ODOA 3NRKA 1KT0A 1FKLA 1TCOC 4G50A 1WMVA 3IKDA 1FKIA 1F8AB 4ODPA 3ODKA 2DG4A 2ZR4A 4DRIA 2ZR5A 4C02B 1QPFA 1I5HW 2XP4A 1NMVA 1Q6UA 3JYJA 1O6WA 3NTPA 2L2SA 2OFNA 4GIVA 5HKGA 1ROTA 4J4OA 2MNTA 4NNRA 5B8IC 2M2AA 4REXA 2PPOA 4TW7A 1D6OA 2JX8A 3KAIA 2XP8A 2MLZA 2LAJA 3IK8A 4J4NA 1FKSA 4FAPA 2DMVA 2PPNA 1FKTA 3UI5A 3O5OA 1FAPA 4E5RA 1FKKA 3JXVA 1ZCNA 4U84A 3OOBA 2PV3A 4LAXA 2YSGA 1KT1A 2RUCA 4DZ2A 4TW8A 3O5RA 2M8JA 2YSIA 2PBCA 3TDBA 4ODKA 4DZ3A 2E45A 3IHZA 3MDYB 2ZAJA 2F2DA 2MDIA 2RSEA 1FKBA 3KACA 1A7XA 5D75A 2DG3A 1ROUA 4IQ2A 3PRDA 3VAWA 4GGQA 1FKRA 2RQSA 2XP6A 2Q5AA 2PV1A 3UQAA 2KO7A 3KADA
chains in the Genus database with same CATH superfamily
1Y0OA 4QT3A 2LKNA 1EG4A 4Q22A 4Z2GA 1FLCA 2EULA 3WL1A 2M1IA 2XP3A 2XPBA 1OWQA 5HW6A 1NH6A 2XP9A 5AHTA 4DWSB 5HTGA 1QZ2A 3WD3A 1WR7A 5DO2A 3PR9A 1HJWA 2ZQVA 1E6NA 2YSFA 3WKZA 4U85A 1NMWA 3LE4A 1FJDA 1GOIA 3O5KA 4TW6A 4LAVA 2ZR6A 4ZPVR 4ODRA 4MAVA 3FAPA 4HBOA 3CGNA 3O5MA 1HKMA 2LJ4A 1JNDA 2WAEA 1W26A 2M8IA 2PPPA 1ZBKA 3O5LA 3ARXA 1E6PA 4LAWA 2DSUA 1LG2A 1B6CA 1BL4A 4JFJA 4Q7NA 3O5JA 1JMQA 1D7IA 2ZQTA 2Y78A 1T11A 1FKHA 1W9VA 3TC5A 5HW7A 5HUAA 4JFKA 4DH0A 3ARSA 3CHDA 2O9OA 1R9HA 1LQ0A 3TCZA 3M85A 4DRJA 1HKKA 2MPHA 4TYOA 5DIVA 1PINA 4ODNA 3G6MA 4DRNA 3IKGA 3KAHA 3UF8A 4XAKA 4U86A 2XP5A 4ZPTR 2IUZA 1Q6IA 3KABA 1J4RA 2FDMA 3CHCA 5E5WA 4DIPA 3RGCA 3PRAA 2MLYA 1RD6A 1ZBVA 4WJXA 4DWSC 2B31A 3B8SA 1Q6HA 4ODLA 4DT4A 3ALGA 4ITZA 2DSVA 3PRBA 1HJXA 2VCDA 1LL4A 3AS2A 3O5DA 2WADA 1X6LA 2DK1A 4N19A 4JFLA 4QT2A 4W9QA 1HXVA 1FKJA 4P8WA 5I98A 3AQUA 2N87A 3WIJA 4DRKA 3UQBA 1UR9A 1K9QA 4P8XA 4JFMA 4W9OA 5GPGA 4DRMA 2WM0A 3WD1A 2KGJA 1EYMA 2WLZA 4S3KA 2KR7A 1L1PA 3NI6A 4G2PA 5HBFA 4IT4A 1D2KA 3JYMA 4FN2A 3O5QA 3I6CA 3M7NA 2YBUA 4JYSA 1YW5A 1PBKA 3AS1A 4MNJA 4PTMA 5DEZA 3O5GA 2ESCA 3RMEA 2JV4A 1ZBWA 1NWSA 4BF8A 1VF8A 2QF8A 2O92A 1JNSA 1NWTA 5U47A 1F40A 4DRPA 3LKXB 2DT3A 2QRVA 2WLYA 3O5PA 4QIBA 2YBTA 4S3JA 4ZPWR 1CTNA 3B7XA 2G8ZA 4MNKA 3WD0A 1FKDA 3EY6A 1E44A 3H9RB 1JCHB 2RUDA 4IPXA 3KZ7A 4R0XA 2KXQA 1J4IA 2AOSA 2KE0A 2DPEA 5DF0A 3RM4A 4WKHA 2DK7A 1FKFA 1TK7A 1Q1CA 4HARA 2MF9A 2RURA 2VN1A 1JVWA 2MLXA 2JMFA 1YATA 5HW8A 5DITA 3O5FA 2FKEA 3B9EA 2RE3A 2ZQUA 1ZB5A 3WQVA 1JNTA 2G41A 2BA1A 4JFIA 1BKFA 2F4EA 5E62A 1ZL1A 1NSGA 2P4VA 3FXYA 4TX0A 3B9AA 4DRQA 1D7HA 1ZK6A 5GPRA 4DRHA 3LUOA 2XPAA 1FFQA 1J4HA 1LG1A 4LGXA 2A3AA 1C9HA 2AWGA 4O2TA 4IQCA 1J6YA 4DROA 3KAGA 4ODMA 2IF4A 2RUQA 2M08A 4WK9A 3PA7A 3O5EA 5HT1A 3EIPA 1FD9A 3BMBA 2EZ5W 2DG9A 2M3OW 3UQIA 5HWBA 4ML4A 5J6EA 1LJYA 2ITKA 2L4JA 3L4HA 2JZVA 1ZU8A 1W9UA 3RFWA 2YSHA 2DJYA 3CNGA 1GUVA 1OGGA 2DT2A 3KAFA 2KI3A 3ARYA 3FY1A 1EG3A 1WB0A 4DWSA 3GU0A 1FKGA 1NWUA 3O5IA 3WD4A 5BXJA 2LPVA 2LGOA 1W1PA 2UZ5A 4MGVA 4WKFA 4DWSD 2A3EA 1EIBA 1W1YA 2DT0A 3MCBA 4P8VA 4KQZA 1RP5A 2Y8NB 2DWVA 5CQ2A 1M5YA 5HWCA 3AROA 3KCEA 3W4RA 3UI6A 1QPLA 3CHFA 1XRVA 4HBEA 1TR8A 2JXWA 3CGMA 2YSBA 2XP7A 4LAYA 3PQHA 3ARZA 3ARQA 3BXWA 1SYTA 1SR0A 5DIUA 4ODQA 5E64A 1K9TA 3B9DA 3WH0A 4TNSA 3UI4A 2F21A 2PV2A 1N1AA 2A3CA 2D9FA 4L72B 3FSCA 2ZQSA 1D7JA 4ZS6A 3ALFA 4GLXA 1EQ3A 4W9PA 2KFWA 1P5QA 3GPKA 4MSPA 1U79A 2FAPA 4KR0B 1K9RA 2K8IA 4Z2LA 1E6ZA 4A0TA 4ODOA 3ARUA 4Z2JA 3NRKA 2F23A 1KT0A 1FKLA 3WD2A 1LL7A 5E65A 1TCOC 1HJVA 4G50A 1WMVA 1KFWA 1W1TA 5JH8A 3IKDA 3GTYX 1FKIA 1F8AB 4ODPA 3ODKA 2DG4A 2ZR4A 4DRIA 2DSZA 4MNMA 1O6IA 2ZR5A 1ITXA 4C02B 1WNOA 1QPFA 2A3BA 4R5EA 1I5HW 3CZ8A 2XP4A 1NMVA 1Q6UA 3JYJA 3WQWA 1O6WA 3NTPA 2L2SA 2OFNA 4GIVA 5HKGA 2DT1A 2DSWA 1ROTA 3MCBB 4J4OA 2MNTA 1E9LA 3ARWA 4NNRA 3WL0A 5B8IC 1LL6A 3RM8A 2M2AA 3QOKA 4REXA 2PPOA 3G6LA 2PN0A 1TFVA 3RM9A 3CHEA 1JNEA 3OA5A 4TW7A 4MNLA 1X6NA 1D6OA 2JX8A 3KAIA 4AY1A 2XP8A 3MQHA 2MLZA 1IX5A 2LAJA 3IK8A 4WKAA 4Z2HA 1H0GA 4NSBA 1W9PA 1XHGA 3FS8A 2ETNA 4J4NA 4NZCA 2OWOA 3CH9A 1FKSA 3LKXA 4FAPA 2DMVA 1EDQA 2PPNA 1HKJA 1FKTA 1UR8A 3UI5A 4W5UA 3O5OA 1E15A 1FAPA 4E5RA 1FKKA 3JXVA 1NWRA 1ZBCA 1ZCNA 2OLHA 4Z2KA 1EHNA 4U84A 3OOBA 2PV3A 4LAXA 2YSGA 1KT1A 2RUCA 4P8UA 4MTVA 1FFRA 4DZ2A 4TW8A 4QZVB 3O5RA 2M8JA 4WIWA 3MQGA 5GQBA 4A0UA 1H0IA 1E6RA 4MPKA 4L3NA 2YSIA 2PBCA 1GRJA 2PI6A 2WK2A 3TDBA 3ARVA 4ODKA 1HKIA 4DZ3A 3ARTA 2B5UB 2E45A 3IHZA 4UDMA 3AS0A 3MDYB 2ZAJA 2F2DA 2MDIA 3AS3A 2RSEA 1FKBA 3ARRA 1OGBA 3KACA 1A7XA 1WAWA 2YAJB 5D75A 4Z2IA 2DG3A 1ROUA 4IQ2A 3PRDA 3VAWA 5E66A 4URIA 3ARPA 4IT6A 4GGQA 1FKRA 2RQSA 2XP6A 3FSBA 2Q5AA 1GPFA 2PV1A 3UQAA 1W1VA 2KO7A 3KADA
chains in the Genus database with same CATH topology
1Y0OA 4QT3A 2LKNA 1EG4A 4Q22A 4Z2GA 1FLCA 3WL1A 2M1IA 2XP3A 2XPBA 1OWQA 5HW6A 1NH6A 2XP9A 5AHTA 4DWSB 5HTGA 1QZ2A 3WD3A 1WR7A 5DO2A 3PR9A 1HJWA 2ZQVA 1E6NA 2YSFA 3WKZA 4U85A 1NMWA 3LE4A 1FJDA 1GOIA 3O5KA 4TW6A 4LAVA 2ZR6A 4ZPVR 4ODRA 4MAVA 3FAPA 4HBOA 3CGNA 3O5MA 1HKMA 2LJ4A 1JNDA 2WAEA 1W26A 2M8IA 2PPPA 1ZBKA 3O5LA 3ARXA 1E6PA 4LAWA 2DSUA 1LG2A 1B6CA 1BL4A 4JFJA 4Q7NA 3O5JA 1JMQA 1D7IA 2ZQTA 2Y78A 1T11A 1FKHA 1W9VA 3TC5A 5HW7A 5HUAA 4JFKA 4DH0A 3ARSA 3CHDA 2O9OA 1R9HA 1LQ0A 3TCZA 3M85A 4DRJA 1HKKA 2MPHA 4TYOA 5DIVA 1PINA 4ODNA 3G6MA 4DRNA 3IKGA 3KAHA 3UF8A 4XAKA 4U86A 2XP5A 4ZPTR 2IUZA 1Q6IA 3KABA 1J4RA 2FDMA 3CHCA 5E5WA 4DIPA 3RGCA 3PRAA 2MLYA 1RD6A 1ZBVA 4WJXA 4DWSC 2B31A 3B8SA 1Q6HA 4ODLA 4DT4A 3ALGA 4ITZA 2DSVA 3PRBA 1HJXA 2VCDA 1LL4A 3AS2A 3O5DA 2WADA 1X6LA 2DK1A 4N19A 4JFLA 4QT2A 4W9QA 1HXVA 1FKJA 4P8WA 5I98A 3AQUA 2N87A 3WIJA 4DRKA 3UQBA 1UR9A 1K9QA 4P8XA 4JFMA 4W9OA 5GPGA 4DRMA 2WM0A 3WD1A 2KGJA 1EYMA 2WLZA 4S3KA 2KR7A 1L1PA 3NI6A 4G2PA 5HBFA 4IT4A 1D2KA 3JYMA 4FN2A 3O5QA 3I6CA 3M7NA 2YBUA 4JYSA 1YW5A 1PBKA 3AS1A 4MNJA 4PTMA 5DEZA 3O5GA 2ESCA 3RMEA 2JV4A 1ZBWA 1NWSA 4BF8A 1VF8A 2QF8A 2O92A 1JNSA 1NWTA 5U47A 1F40A 4DRPA 3LKXB 2DT3A 2QRVA 2WLYA 3O5PA 4QIBA 2YBTA 4S3JA 4ZPWR 1CTNA 3B7XA 2G8ZA 4MNKA 3WD0A 1FKDA 3EY6A 3H9RB 2RUDA 4IPXA 3KZ7A 4R0XA 2KXQA 1J4IA 2AOSA 2KE0A 2DPEA 5DF0A 3RM4A 4WKHA 2DK7A 1FKFA 1TK7A 1Q1CA 4HARA 2MF9A 2RURA 2VN1A 1JVWA 2MLXA 2JMFA 1YATA 5HW8A 5DITA 3O5FA 2FKEA 3B9EA 2RE3A 2ZQUA 1ZB5A 3WQVA 1JNTA 2G41A 2BA1A 4JFIA 1BKFA 2F4EA 5E62A 1ZL1A 1NSGA 3FXYA 4TX0A 3B9AA 4DRQA 1D7HA 1ZK6A 5GPRA 4DRHA 3LUOA 2XPAA 1FFQA 1J4HA 1LG1A 4LGXA 2A3AA 1C9HA 2AWGA 4O2TA 4IQCA 1J6YA 4DROA 3KAGA 4ODMA 2IF4A 2RUQA 2M08A 4WK9A 3PA7A 3O5EA 5HT1A 1FD9A 2EZ5W 2DG9A 2M3OW 3UQIA 5HWBA 4ML4A 5J6EA 1LJYA 2ITKA 2L4JA 3L4HA 2JZVA 1ZU8A 1W9UA 3RFWA 2YSHA 2DJYA 3CNGA 1GUVA 1OGGA 2DT2A 3KAFA 2KI3A 3ARYA 3FY1A 1EG3A 1WB0A 4DWSA 3WD4A 1FKGA 1NWUA 3O5IA 5BXJA 2LPVA 2LGOA 1W1PA 2UZ5A 4MGVA 4WKFA 4DWSD 2A3EA 1EIBA 1W1YA 2DT0A 3MCBA 4P8VA 4KQZA 1RP5A 2Y8NB 2DWVA 5CQ2A 1M5YA 5HWCA 3AROA 3KCEA 3W4RA 3UI6A 1QPLA 3CHFA 1XRVA 4HBEA 1TR8A 2JXWA 3CGMA 2YSBA 2XP7A 4LAYA 3PQHA 3ARZA 3ARQA 3BXWA 1SYTA 1SR0A 5DIUA 4ODQA 5E64A 1K9TA 3B9DA 3WH0A 4TNSA 3UI4A 2F21A 2PV2A 1N1AA 2A3CA 2D9FA 4L72B 3FSCA 2ZQSA 1D7JA 4ZS6A 3ALFA 4GLXA 1EQ3A 4W9PA 2KFWA 1P5QA 3GPKA 4MSPA 1U79A 2FAPA 4KR0B 1K9RA 2K8IA 4Z2LA 1E6ZA 4A0TA 4ODOA 3ARUA 4Z2JA 3NRKA 1KT0A 1FKLA 3WD2A 1LL7A 5E65A 1TCOC 1HJVA 4G50A 1WMVA 1KFWA 1W1TA 5JH8A 3IKDA 1FKIA 1F8AB 4ODPA 3ODKA 2DG4A 2ZR4A 4DRIA 2DSZA 4MNMA 1O6IA 2ZR5A 1ITXA 4C02B 1WNOA 1QPFA 2A3BA 4R5EA 1I5HW 3CZ8A 2XP4A 1NMVA 1Q6UA 3JYJA 3WQWA 1O6WA 3NTPA 2L2SA 2OFNA 4GIVA 5HKGA 2DT1A 2DSWA 1ROTA 3MCBB 4J4OA 2MNTA 1E9LA 3ARWA 4NNRA 3WL0A 5B8IC 1LL6A 3RM8A 2M2AA 3QOKA 4REXA 2PPOA 3G6LA 1TFVA 3RM9A 3CHEA 1JNEA 3OA5A 4TW7A 4MNLA 1X6NA 1D6OA 2JX8A 3KAIA 4AY1A 2XP8A 3MQHA 2MLZA 1IX5A 2LAJA 3IK8A 4WKAA 4Z2HA 1H0GA 4NSBA 1W9PA 1XHGA 3FS8A 4J4NA 4NZCA 2OWOA 3CH9A 1FKSA 3LKXA 4FAPA 2DMVA 1EDQA 2PPNA 1HKJA 1FKTA 1UR8A 3UI5A 4W5UA 3O5OA 1E15A 1FAPA 4E5RA 1FKKA 3JXVA 1NWRA 1ZBCA 1ZCNA 2OLHA 4Z2KA 1EHNA 4U84A 3OOBA 2PV3A 4LAXA 2YSGA 1KT1A 2RUCA 4P8UA 4MTVA 1FFRA 4DZ2A 4TW8A 4QZVB 3O5RA 2M8JA 4WIWA 3MQGA 5GQBA 4A0UA 1H0IA 1E6RA 4MPKA 4L3NA 2YSIA 2PBCA 2PI6A 2WK2A 3TDBA 3ARVA 4ODKA 1HKIA 4DZ3A 3ARTA 2E45A 3IHZA 3AS0A 3MDYB 2ZAJA 2F2DA 2MDIA 3AS3A 2RSEA 1FKBA 3ARRA 1OGBA 3KACA 1A7XA 1WAWA 2YAJB 5D75A 4Z2IA 2DG3A 1ROUA 4IQ2A 3PRDA 3VAWA 5E66A 4URIA 3ARPA 4IT6A 4GGQA 1FKRA 2RQSA 2XP6A 3FSBA 2Q5AA 1GPFA 2PV1A 3UQAA 1W1VA 2KO7A 3KADA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1Y0O A;  4QT3 A;  2LKN A;  1EG4 A;  2M1I A;  2XP3 A;  2XPB A;  5HW6 A;  2XP9 A;  5AHT A;  5HTG A;  1QZ2 A;  1WR7 A;  2ZQV A;  2YSF A;  4U85 A;  1NMW A;  3LE4 A;  1FJD A;  4TW6 A;  3O5K A;  4LAV A;  2ZR6 A;  4ODR A;  3FAP A;  3CGN A;  3O5M A;  2LJ4 A;  1W26 A;  2M8I A;  2PPP A;  3O5L A;  4LAW A;  1B6C A;  1BL4 A;  4JFJ A;  3O5J A;  1JMQ A;  1D7I A;  2ZQT A;  2Y78 A;  1T11 A;  1FKH A;  5HW7 A;  3TC5 A;  5HUA A;  4JFK A;  4DH0 A;  1R9H A;  3TCZ A;  3M85 A;  4DRJ A;  2MPH A;  4TYO A;  5DIV A;  1PIN A;  4ODN A;  4DRN A;  3IKG A;  3KAH A;  3UF8 A;  4U86 A;  2XP5 A;  1Q6I A;  3KAB A;  1J4R A;  4DIP A;  3RGC A;  2MLY A;  1Q6H A;  4ODL A;  4DT4 A;  4ITZ A;  3PRB A;  2VCD A;  3O5D A;  2DK1 A;  4N19 A;  4JFL A;  4QT2 A;  4W9Q A;  1HXV A;  1FKJ A;  5I98 A;  2N87 A;  4DRK A;  3UQB A;  1K9Q A;  4JFM A;  4W9O A;  5GPG A;  4DRM A;  2KGJ A;  1EYM A;  2KR7 A;  1L1P A;  3NI6 A;  4G2P A;  3JYM A;  4FN2 A;  3O5Q A;  3I6C A;  3M7N A;  4JYS A;  1YW5 A;  1PBK A;  3O5G A;  2JV4 A;  4BF8 A;  1JNS A;  1F40 A;  4DRP A;  3O5P A;  4QIB A;  3B7X A;  1FKD A;  3EY6 A;  3H9R B;  2RUD A;  4IPX A;  3KZ7 A;  4R0X A;  2KXQ A;  1J4I A;  2KE0 A;  2DK7 A;  1FKF A;  1TK7 A;  1Q1C A;  2MF9 A;  2RUR A;  2VN1 A;  1JVW A;  2MLX A;  2JMF A;  1YAT A;  5HW8 A;  5DIT A;  3O5F A;  2FKE A;  2RE3 A;  2ZQU A;  1JNT A;  2BA1 A;  4JFI A;  1BKF A;  2F4E A;  1NSG A;  4TX0 A;  4DRQ A;  1D7H A;  1ZK6 A;  4DRH A;  3LUO A;  2XPA A;  1J4H A;  1C9H A;  2AWG A;  4O2T A;  4IQC A;  1J6Y A;  4DRO A;  3KAG A;  4ODM A;  2IF4 A;  2RUQ A;  2M08 A;  5HT1 A;  3PA7 A;  3O5E A;  1FD9 A;  2EZ5 W;  2DG9 A;  2M3O W;  3UQI A;  5HWB A;  5J6E A;  2ITK A;  2L4J A;  3L4H A;  2JZV A;  3RFW A;  2YSH A;  2DJY A;  3CNG A;  3KAF A;  2KI3 A;  1EG3 A;  1FKG A;  5BXJ A;  3O5I A;  2LPV A;  2LGO A;  4MGV A;  2UZ5 A;  2DWV A;  5CQ2 A;  1M5Y A;  5HWC A;  3KCE A;  3UI6 A;  1QPL A;  2JXW A;  3CGM A;  2YSB A;  2XP7 A;  4LAY A;  5DIU A;  4ODQ A;  3WH0 A;  4TNS A;  3UI4 A;  2F21 A;  2PV2 A;  1N1A A;  2D9F A;  2ZQS A;  1D7J A;  1EQ3 A;  4W9P A;  2KFW A;  1P5Q A;  3GPK A;  4MSP A;  1U79 A;  2FAP A;  1K9R A;  2K8I A;  4ODO A;  3NRK A;  1KT0 A;  1FKL A;  1TCO C;  4G50 A;  1WMV A;  3IKD A;  1FKI A;  1F8A B;  4ODP A;  3ODK A;  2DG4 A;  2ZR4 A;  4DRI A;  2ZR5 A;  4C02 B;  1QPF A;  1I5H W;  2XP4 A;  1NMV A;  1Q6U A;  3JYJ A;  1O6W A;  3NTP A;  2L2S A;  2OFN A;  4GIV A;  5HKG A;  1ROT A;  4J4O A;  2MNT A;  4NNR A;  5B8I C;  2M2A A;  4REX A;  2PPO A;  4TW7 A;  1D6O A;  2JX8 A;  3KAI A;  2XP8 A;  2MLZ A;  2LAJ A;  3IK8 A;  4J4N A;  1FKS A;  4FAP A;  2DMV A;  2PPN A;  1FKT A;  3UI5 A;  3O5O A;  1FAP A;  4E5R A;  1FKK A;  3JXV A;  1ZCN A;  4U84 A;  3OOB A;  2PV3 A;  4LAX A;  2YSG A;  1KT1 A;  2RUC A;  4DZ2 A;  4TW8 A;  3O5R A;  2M8J A;  2YSI A;  2PBC A;  3TDB A;  4ODK A;  4DZ3 A;  2E45 A;  3IHZ A;  3MDY B;  2ZAJ A;  2F2D A;  2MDI A;  2RSE A;  1FKB A;  3KAC A;  1A7X A;  5D75 A;  2DG3 A;  1ROU A;  4IQ2 A;  3PRD A;  3VAW A;  4GGQ A;  1FKR A;  2RQS A;  2XP6 A;  2Q5A A;  2PV1 A;  3UQA A;  2KO7 A;  3KAD A; 
#chains in the Genus database with same CATH topology
 1Y0O A;  4QT3 A;  2LKN A;  1EG4 A;  4Q22 A;  4Z2G A;  1FLC A;  2EUL A;  3WL1 A;  2M1I A;  2XP3 A;  2XPB A;  1OWQ A;  5HW6 A;  1NH6 A;  2XP9 A;  5AHT A;  4DWS B;  5HTG A;  1QZ2 A;  3WD3 A;  1WR7 A;  5DO2 A;  3PR9 A;  1HJW A;  2ZQV A;  1E6N A;  2YSF A;  3WKZ A;  4U85 A;  1NMW A;  3LE4 A;  1FJD A;  1GOI A;  3O5K A;  4TW6 A;  4LAV A;  2ZR6 A;  4ZPV R;  4ODR A;  4MAV A;  3FAP A;  4HBO A;  3CGN A;  3O5M A;  1HKM A;  2LJ4 A;  1JND A;  2WAE A;  1W26 A;  2M8I A;  2PPP A;  1ZBK A;  3O5L A;  3ARX A;  1E6P A;  4LAW A;  2DSU A;  1LG2 A;  1B6C A;  1BL4 A;  4JFJ A;  4Q7N A;  3O5J A;  1JMQ A;  1D7I A;  2ZQT A;  2Y78 A;  1T11 A;  1FKH A;  1W9V A;  3TC5 A;  5HW7 A;  5HUA A;  4JFK A;  4DH0 A;  3ARS A;  3CHD A;  2O9O A;  1R9H A;  1LQ0 A;  3TCZ A;  3M85 A;  4DRJ A;  1HKK A;  2MPH A;  4TYO A;  5DIV A;  1PIN A;  4ODN A;  3G6M A;  4DRN A;  3IKG A;  3KAH A;  3UF8 A;  4XAK A;  4U86 A;  2XP5 A;  4ZPT R;  2IUZ A;  1Q6I A;  3KAB A;  1J4R A;  2FDM A;  3CHC A;  5E5W A;  4DIP A;  3RGC A;  3PRA A;  2MLY A;  1RD6 A;  1ZBV A;  4WJX A;  4DWS C;  2B31 A;  3B8S A;  1Q6H A;  4ODL A;  4DT4 A;  3ALG A;  4ITZ A;  2DSV A;  3PRB A;  1HJX A;  2VCD A;  1LL4 A;  3AS2 A;  3O5D A;  2WAD A;  1X6L A;  2DK1 A;  4N19 A;  4JFL A;  4QT2 A;  4W9Q A;  1HXV A;  1FKJ A;  4P8W A;  5I98 A;  3AQU A;  2N87 A;  3WIJ A;  4DRK A;  3UQB A;  1UR9 A;  1K9Q A;  4P8X A;  4JFM A;  4W9O A;  5GPG A;  4DRM A;  2WM0 A;  3WD1 A;  2KGJ A;  1EYM A;  2WLZ A;  4S3K A;  2KR7 A;  1L1P A;  3NI6 A;  4G2P A;  5HBF A;  4IT4 A;  1D2K A;  3JYM A;  4FN2 A;  3O5Q A;  3I6C A;  3M7N A;  2YBU A;  4JYS A;  1YW5 A;  1PBK A;  3AS1 A;  4MNJ A;  4PTM A;  5DEZ A;  3O5G A;  2ESC A;  3RME A;  2JV4 A;  1ZBW A;  1NWS A;  4BF8 A;  1VF8 A;  2QF8 A;  2O92 A;  1JNS A;  1NWT A;  5U47 A;  1F40 A;  4DRP A;  3LKX B;  2DT3 A;  2QRV A;  2WLY A;  3O5P A;  4QIB A;  2YBT A;  4S3J A;  4ZPW R;  1CTN A;  3B7X A;  2G8Z A;  4MNK A;  3WD0 A;  1FKD A;  3EY6 A;  1E44 A;  3H9R B;  1JCH B;  2RUD A;  4IPX A;  3KZ7 A;  4R0X A;  2KXQ A;  1J4I A;  2AOS A;  2KE0 A;  2DPE A;  5DF0 A;  3RM4 A;  4WKH A;  2DK7 A;  1FKF A;  1TK7 A;  1Q1C A;  4HAR A;  2MF9 A;  2RUR A;  2VN1 A;  1JVW A;  2MLX A;  2JMF A;  1YAT A;  5HW8 A;  5DIT A;  3O5F A;  2FKE A;  3B9E A;  2RE3 A;  2ZQU A;  1ZB5 A;  3WQV A;  1JNT A;  2G41 A;  2BA1 A;  4JFI A;  1BKF A;  2F4E A;  5E62 A;  1ZL1 A;  1NSG A;  2P4V A;  3FXY A;  4TX0 A;  3B9A A;  4DRQ A;  1D7H A;  1ZK6 A;  5GPR A;  4DRH A;  3LUO A;  2XPA A;  1FFQ A;  1J4H A;  1LG1 A;  4LGX A;  2A3A A;  1C9H A;  2AWG A;  4O2T A;  4IQC A;  1J6Y A;  4DRO A;  3KAG A;  4ODM A;  2IF4 A;  2RUQ A;  2M08 A;  4WK9 A;  3PA7 A;  3O5E A;  5HT1 A;  3EIP A;  1FD9 A;  3BMB A;  2EZ5 W;  2DG9 A;  2M3O W;  3UQI A;  5HWB A;  4ML4 A;  5J6E A;  1LJY A;  2ITK A;  2L4J A;  3L4H A;  2JZV A;  1ZU8 A;  1W9U A;  3RFW A;  2YSH A;  2DJY A;  3CNG A;  1GUV A;  1OGG A;  2DT2 A;  3KAF A;  2KI3 A;  3ARY A;  3FY1 A;  1EG3 A;  1WB0 A;  4DWS A;  3GU0 A;  1FKG A;  1NWU A;  3O5I A;  3WD4 A;  5BXJ A;  2LPV A;  2LGO A;  1W1P A;  2UZ5 A;  4MGV A;  4WKF A;  4DWS D;  2A3E A;  1EIB A;  1W1Y A;  2DT0 A;  3MCB A;  4P8V A;  4KQZ A;  1RP5 A;  2Y8N B;  2DWV A;  5CQ2 A;  1M5Y A;  5HWC A;  3ARO A;  3KCE A;  3W4R A;  3UI6 A;  1QPL A;  3CHF A;  1XRV A;  4HBE A;  1TR8 A;  2JXW A;  3CGM A;  2YSB A;  2XP7 A;  4LAY A;  3PQH A;  3ARZ A;  3ARQ A;  3BXW A;  1SYT A;  1SR0 A;  5DIU A;  4ODQ A;  5E64 A;  1K9T A;  3B9D A;  3WH0 A;  4TNS A;  3UI4 A;  2F21 A;  2PV2 A;  1N1A A;  2A3C A;  2D9F A;  4L72 B;  3FSC A;  2ZQS A;  1D7J A;  4ZS6 A;  3ALF A;  4GLX A;  1EQ3 A;  4W9P A;  2KFW A;  1P5Q A;  3GPK A;  4MSP A;  1U79 A;  2FAP A;  4KR0 B;  1K9R A;  2K8I A;  4Z2L A;  1E6Z A;  4A0T A;  4ODO A;  3ARU A;  4Z2J A;  3NRK A;  2F23 A;  1KT0 A;  1FKL A;  3WD2 A;  1LL7 A;  5E65 A;  1TCO C;  1HJV A;  4G50 A;  1WMV A;  1KFW A;  1W1T A;  5JH8 A;  3IKD A;  3GTY X;  1FKI A;  1F8A B;  4ODP A;  3ODK A;  2DG4 A;  2ZR4 A;  4DRI A;  2DSZ A;  4MNM A;  1O6I A;  2ZR5 A;  1ITX A;  4C02 B;  1WNO A;  1QPF A;  2A3B A;  4R5E A;  1I5H W;  3CZ8 A;  2XP4 A;  1NMV A;  1Q6U A;  3JYJ A;  3WQW A;  1O6W A;  3NTP A;  2L2S A;  2OFN A;  4GIV A;  5HKG A;  2DT1 A;  2DSW A;  1ROT A;  3MCB B;  4J4O A;  2MNT A;  1E9L A;  3ARW A;  4NNR A;  3WL0 A;  5B8I C;  1LL6 A;  3RM8 A;  2M2A A;  3QOK A;  4REX A;  2PPO A;  3G6L A;  2PN0 A;  1TFV A;  3RM9 A;  3CHE A;  1JNE A;  3OA5 A;  4TW7 A;  4MNL A;  1X6N A;  1D6O A;  2JX8 A;  3KAI A;  4AY1 A;  2XP8 A;  3MQH A;  2MLZ A;  1IX5 A;  2LAJ A;  3IK8 A;  4WKA A;  4Z2H A;  1H0G A;  4NSB A;  1W9P A;  1XHG A;  3FS8 A;  2ETN A;  4J4N A;  4NZC A;  2OWO A;  3CH9 A;  1FKS A;  3LKX A;  4FAP A;  2DMV A;  1EDQ A;  2PPN A;  1HKJ A;  1FKT A;  1UR8 A;  3UI5 A;  4W5U A;  3O5O A;  1E15 A;  1FAP A;  4E5R A;  1FKK A;  3JXV A;  1NWR A;  1ZBC A;  1ZCN A;  2OLH A;  4Z2K A;  1EHN A;  4U84 A;  3OOB A;  2PV3 A;  4LAX A;  2YSG A;  1KT1 A;  2RUC A;  4P8U A;  4MTV A;  1FFR A;  4DZ2 A;  4TW8 A;  4QZV B;  3O5R A;  2M8J A;  4WIW A;  3MQG A;  5GQB A;  4A0U A;  1H0I A;  1E6R A;  4MPK A;  4L3N A;  2YSI A;  2PBC A;  1GRJ A;  2PI6 A;  2WK2 A;  3TDB A;  3ARV A;  4ODK A;  1HKI A;  4DZ3 A;  3ART A;  2B5U B;  2E45 A;  3IHZ A;  4UDM A;  3AS0 A;  3MDY B;  2ZAJ A;  2F2D A;  2MDI A;  3AS3 A;  2RSE A;  1FKB A;  3ARR A;  1OGB A;  3KAC A;  1A7X A;  1WAW A;  2YAJ B;  5D75 A;  4Z2I A;  2DG3 A;  1ROU A;  4IQ2 A;  3PRD A;  3VAW A;  5E66 A;  4URI A;  3ARP A;  4IT6 A;  4GGQ A;  1FKR A;  2RQS A;  2XP6 A;  3FSB A;  2Q5A A;  1GPF A;  2PV1 A;  3UQA A;  1W1V A;  2KO7 A;  3KAD A; 
#chains in the Genus database with same CATH homology
 1Y0O A;  4QT3 A;  2LKN A;  1EG4 A;  4Q22 A;  4Z2G A;  1FLC A;  3WL1 A;  2M1I A;  2XP3 A;  2XPB A;  1OWQ A;  5HW6 A;  1NH6 A;  2XP9 A;  5AHT A;  4DWS B;  5HTG A;  1QZ2 A;  3WD3 A;  1WR7 A;  5DO2 A;  3PR9 A;  1HJW A;  2ZQV A;  1E6N A;  2YSF A;  3WKZ A;  4U85 A;  1NMW A;  3LE4 A;  1FJD A;  1GOI A;  3O5K A;  4TW6 A;  4LAV A;  2ZR6 A;  4ZPV R;  4ODR A;  4MAV A;  3FAP A;  4HBO A;  3CGN A;  3O5M A;  1HKM A;  2LJ4 A;  1JND A;  2WAE A;  1W26 A;  2M8I A;  2PPP A;  1ZBK A;  3O5L A;  3ARX A;  1E6P A;  4LAW A;  2DSU A;  1LG2 A;  1B6C A;  1BL4 A;  4JFJ A;  4Q7N A;  3O5J A;  1JMQ A;  1D7I A;  2ZQT A;  2Y78 A;  1T11 A;  1FKH A;  1W9V A;  3TC5 A;  5HW7 A;  5HUA A;  4JFK A;  4DH0 A;  3ARS A;  3CHD A;  2O9O A;  1R9H A;  1LQ0 A;  3TCZ A;  3M85 A;  4DRJ A;  1HKK A;  2MPH A;  4TYO A;  5DIV A;  1PIN A;  4ODN A;  3G6M A;  4DRN A;  3IKG A;  3KAH A;  3UF8 A;  4XAK A;  4U86 A;  2XP5 A;  4ZPT R;  2IUZ A;  1Q6I A;  3KAB A;  1J4R A;  2FDM A;  3CHC A;  5E5W A;  4DIP A;  3RGC A;  3PRA A;  2MLY A;  1RD6 A;  1ZBV A;  4WJX A;  4DWS C;  2B31 A;  3B8S A;  1Q6H A;  4ODL A;  4DT4 A;  3ALG A;  4ITZ A;  2DSV A;  3PRB A;  1HJX A;  2VCD A;  1LL4 A;  3AS2 A;  3O5D A;  2WAD A;  1X6L A;  2DK1 A;  4N19 A;  4JFL A;  4QT2 A;  4W9Q A;  1HXV A;  1FKJ A;  4P8W A;  5I98 A;  3AQU A;  2N87 A;  3WIJ A;  4DRK A;  3UQB A;  1UR9 A;  1K9Q A;  4P8X A;  4JFM A;  4W9O A;  5GPG A;  4DRM A;  2WM0 A;  3WD1 A;  2KGJ A;  1EYM A;  2WLZ A;  4S3K A;  2KR7 A;  1L1P A;  3NI6 A;  4G2P A;  5HBF A;  4IT4 A;  1D2K A;  3JYM A;  4FN2 A;  3O5Q A;  3I6C A;  3M7N A;  2YBU A;  4JYS A;  1YW5 A;  1PBK A;  3AS1 A;  4MNJ A;  4PTM A;  5DEZ A;  3O5G A;  2ESC A;  3RME A;  2JV4 A;  1ZBW A;  1NWS A;  4BF8 A;  1VF8 A;  2QF8 A;  2O92 A;  1JNS A;  1NWT A;  5U47 A;  1F40 A;  4DRP A;  3LKX B;  2DT3 A;  2QRV A;  2WLY A;  3O5P A;  4QIB A;  2YBT A;  4S3J A;  4ZPW R;  1CTN A;  3B7X A;  2G8Z A;  4MNK A;  3WD0 A;  1FKD A;  3EY6 A;  3H9R B;  2RUD A;  4IPX A;  3KZ7 A;  4R0X A;  2KXQ A;  1J4I A;  2AOS A;  2KE0 A;  2DPE A;  5DF0 A;  3RM4 A;  4WKH A;  2DK7 A;  1FKF A;  1TK7 A;  1Q1C A;  4HAR A;  2MF9 A;  2RUR A;  2VN1 A;  1JVW A;  2MLX A;  2JMF A;  1YAT A;  5HW8 A;  5DIT A;  3O5F A;  2FKE A;  3B9E A;  2RE3 A;  2ZQU A;  1ZB5 A;  3WQV A;  1JNT A;  2G41 A;  2BA1 A;  4JFI A;  1BKF A;  2F4E A;  5E62 A;  1ZL1 A;  1NSG A;  3FXY A;  4TX0 A;  3B9A A;  4DRQ A;  1D7H A;  1ZK6 A;  5GPR A;  4DRH A;  3LUO A;  2XPA A;  1FFQ A;  1J4H A;  1LG1 A;  4LGX A;  2A3A A;  1C9H A;  2AWG A;  4O2T A;  4IQC A;  1J6Y A;  4DRO A;  3KAG A;  4ODM A;  2IF4 A;  2RUQ A;  2M08 A;  4WK9 A;  3PA7 A;  3O5E A;  5HT1 A;  1FD9 A;  2EZ5 W;  2DG9 A;  2M3O W;  3UQI A;  5HWB A;  4ML4 A;  5J6E A;  1LJY A;  2ITK A;  2L4J A;  3L4H A;  2JZV A;  1ZU8 A;  1W9U A;  3RFW A;  2YSH A;  2DJY A;  3CNG A;  1GUV A;  1OGG A;  2DT2 A;  3KAF A;  2KI3 A;  3ARY A;  3FY1 A;  1EG3 A;  1WB0 A;  4DWS A;  3WD4 A;  1FKG A;  1NWU A;  3O5I A;  5BXJ A;  2LPV A;  2LGO A;  1W1P A;  2UZ5 A;  4MGV A;  4WKF A;  4DWS D;  2A3E A;  1EIB A;  1W1Y A;  2DT0 A;  3MCB A;  4P8V A;  4KQZ A;  1RP5 A;  2Y8N B;  2DWV A;  5CQ2 A;  1M5Y A;  5HWC A;  3ARO A;  3KCE A;  3W4R A;  3UI6 A;  1QPL A;  3CHF A;  1XRV A;  4HBE A;  1TR8 A;  2JXW A;  3CGM A;  2YSB A;  2XP7 A;  4LAY A;  3PQH A;  3ARZ A;  3ARQ A;  3BXW A;  1SYT A;  1SR0 A;  5DIU A;  4ODQ A;  5E64 A;  1K9T A;  3B9D A;  3WH0 A;  4TNS A;  3UI4 A;  2F21 A;  2PV2 A;  1N1A A;  2A3C A;  2D9F A;  4L72 B;  3FSC A;  2ZQS A;  1D7J A;  4ZS6 A;  3ALF A;  4GLX A;  1EQ3 A;  4W9P A;  2KFW A;  1P5Q A;  3GPK A;  4MSP A;  1U79 A;  2FAP A;  4KR0 B;  1K9R A;  2K8I A;  4Z2L A;  1E6Z A;  4A0T A;  4ODO A;  3ARU A;  4Z2J A;  3NRK A;  1KT0 A;  1FKL A;  3WD2 A;  1LL7 A;  5E65 A;  1TCO C;  1HJV A;  4G50 A;  1WMV A;  1KFW A;  1W1T A;  5JH8 A;  3IKD A;  1FKI A;  1F8A B;  4ODP A;  3ODK A;  2DG4 A;  2ZR4 A;  4DRI A;  2DSZ A;  4MNM A;  1O6I A;  2ZR5 A;  1ITX A;  4C02 B;  1WNO A;  1QPF A;  2A3B A;  4R5E A;  1I5H W;  3CZ8 A;  2XP4 A;  1NMV A;  1Q6U A;  3JYJ A;  3WQW A;  1O6W A;  3NTP A;  2L2S A;  2OFN A;  4GIV A;  5HKG A;  2DT1 A;  2DSW A;  1ROT A;  3MCB B;  4J4O A;  2MNT A;  1E9L A;  3ARW A;  4NNR A;  3WL0 A;  5B8I C;  1LL6 A;  3RM8 A;  2M2A A;  3QOK A;  4REX A;  2PPO A;  3G6L A;  1TFV A;  3RM9 A;  3CHE A;  1JNE A;  3OA5 A;  4TW7 A;  4MNL A;  1X6N A;  1D6O A;  2JX8 A;  3KAI A;  4AY1 A;  2XP8 A;  3MQH A;  2MLZ A;  1IX5 A;  2LAJ A;  3IK8 A;  4WKA A;  4Z2H A;  1H0G A;  4NSB A;  1W9P A;  1XHG A;  3FS8 A;  4J4N A;  4NZC A;  2OWO A;  3CH9 A;  1FKS A;  3LKX A;  4FAP A;  2DMV A;  1EDQ A;  2PPN A;  1HKJ A;  1FKT A;  1UR8 A;  3UI5 A;  4W5U A;  3O5O A;  1E15 A;  1FAP A;  4E5R A;  1FKK A;  3JXV A;  1NWR A;  1ZBC A;  1ZCN A;  2OLH A;  4Z2K A;  1EHN A;  4U84 A;  3OOB A;  2PV3 A;  4LAX A;  2YSG A;  1KT1 A;  2RUC A;  4P8U A;  4MTV A;  1FFR A;  4DZ2 A;  4TW8 A;  4QZV B;  3O5R A;  2M8J A;  4WIW A;  3MQG A;  5GQB A;  4A0U A;  1H0I A;  1E6R A;  4MPK A;  4L3N A;  2YSI A;  2PBC A;  2PI6 A;  2WK2 A;  3TDB A;  3ARV A;  4ODK A;  1HKI A;  4DZ3 A;  3ART A;  2E45 A;  3IHZ A;  3AS0 A;  3MDY B;  2ZAJ A;  2F2D A;  2MDI A;  3AS3 A;  2RSE A;  1FKB A;  3ARR A;  1OGB A;  3KAC A;  1A7X A;  1WAW A;  2YAJ B;  5D75 A;  4Z2I A;  2DG3 A;  1ROU A;  4IQ2 A;  3PRD A;  3VAW A;  5E66 A;  4URI A;  3ARP A;  4IT6 A;  4GGQ A;  1FKR A;  2RQS A;  2XP6 A;  3FSB A;  2Q5A A;  1GPF A;  2PV1 A;  3UQA A;  1W1V A;  2KO7 A;  3KAD A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...