2XP4A

Discovery of cell-active phenyl-imidazole pin1 inhibitors by structure-guided fragment evolution
Total Genus 46
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
46
sequence length
157
structure length
144
Chain Sequence
LPPGWEKAMSRSSGRVYYFNHITNASQWERPEPARVRCSHLLVKHSQSRRPSSWRQEKITRTKEEALELINGYIQKIKSGEEDFESLASQFSDCSSAKARGDLGAFSRGQMQKPFEDASFALRTGEMSGPVFTDSGIHIILRTE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PEPTIDYL-PROLYL CIS-TRANS ISOMERASE NIMA-INTERACTING 1
publication title Discovery of Cell-Active Phenyl-Imidazole Pin1 Inhibitors by Structure-Guided Fragment Evolution.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Isomerase
total genus 46
structure length 144
sequence length 157
ec nomenclature ec 5.2.1.8: Peptidylprolyl isomerase.
pdb deposition date 2010-08-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00397 WW WW domain
A PF00639 Rotamase PPIC-type PPIASE domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.20.70.10 Mainly Beta Single Sheet Ubiquitin Ligase Nedd4; Chain: W; Ubiquitin Ligase Nedd4; Chain: W; 2xp4A01
3.10.50.40 Alpha Beta Roll Chitinase A; domain 3 Chitinase A; domain 3 2xp4A02
1D7JA 2MLZA 3IKGA 3ODKA 1QPLA 2ZQTA 1FKSA 2RUCA 2F4EA 3FAPA 1EG4A 3GPKA 1FKFA 2AWGA 1J4IA 1K9RA 4JFLA 2DJYA 2XP5A 1PBKA 1YW5A 2F2DA 3PRDA 3KACA 4FAPA 3TC5A 3O5LA 4JYSA 4FN2A 1Q6IA 2VCDA 2RSEA 2D9FA 4DZ3A 5HW7A 3NRKA 2KI3A 3IHZA 4G2PA 2KO7A 5GPGA 2ZQUA 1FAPA 4GGQA 1ZCNA 4DRNA 3O5EA 1BKFA 4TNSA 1QPFA 4ODKA 1JVWA 5D75A 3KZ7A 5B8IC 1A7XA 2LPVA 4QT3A 4LAYA 1FKBA 2DK1A 1TCOC 2ITKA 2L4JA 4ODRA 3KCEA 2M8JA 1FKLA 3IK8A 3KAFA 1WR7A 1FKHA 3UI4A 3KAHA 1KT1A 3CGNA 3OOBA 3NTPA 3EY6A 4U85A 2E45A 4N19A 2JXWA 3LE4A 4E5RA 3JYMA 1TK7A 2DK7A 2F21A 4W9PA 4TW8A 4TW6A 2ZR4A 1NSGA 1J4HA 2XP7A 5HWBA 2JMFA 4TX0A 3L4HA 1D6OA 3IKDA 2ZR6A 1J4RA 3RFWA 2YSIA 4ITZA 5HW6A 1WMVA 3O5MA 2LKNA 1HXVA 4DT4A 3M85A 3O5RA 2YSHA 3I6CA 3O5QA 3UI5A 3PRBA 3UQAA 5AHTA 2M3OW 3CGMA 4ODQA 2JV4A 4DRJA 3TCZA 1JMQA 4C02B 5HWCA 4QT2A 2LAJA 2MDIA 2ZQVA 1F8AB 4DROA 2K8IA 2N87A 3TDBA 4ODLA 3KABA 4DRMA 1YATA 2LGOA 2DWVA 2PBCA 4ODMA 4DIPA 3M7NA 2MLYA 4W9OA 3KADA 2PV1A 4LAXA 5HW8A 2DG4A 4DRHA 3H9RB 1FKGA 4DH0A 1NMWA 2UZ5A 4NNRA 1BL4A 5DIUA 4MGVA 4G50A 3LUOA 2EZ5W 4JFJA 3JXVA 2FAPA 2RQSA 3JYJA 4U86A 4DRKA 2RE3A 2ZAJA 2KFWA 5CQ2A 2XPBA 3UQIA 1KT0A 4QIBA 2XP6A 3NI6A 4JFIA 2L2SA 2KE0A 1QZ2A 4ODOA 1FKIA 2FKEA 3MDYB 5HUAA 3O5OA 1FD9A 1D7IA 2ZR5A 1PINA 4W9QA 1FJDA 3UI6A 4DRIA 4DRQA 1NMVA 2DMVA 1K9QA 2RURA 2PV2A 4JFKA 4J4OA 1D7HA 5BXJA 2MLXA 4TYOA 2OFNA 5HKGA 2M08A 4IQCA 3O5FA 1R9HA 4JFMA 5DITA 5HT1A 1FKJA 2YSGA 2PPNA 2KXQA 5DIVA 1I5HW 1T11A 2RUQA 4ODNA 5HTGA 3UQBA 3O5PA 3CNGA 4BF8A 4TW7A 3WH0A 2DG3A 1FKTA 2KGJA 2MPHA 3O5IA 2JX8A 4LAWA 2PPPA 2Q5AA 2XP8A 1L1PA 4U84A 4GIVA 2YSFA 4MSPA 4DZ2A 2PPOA 3B7XA 1EG3A 1W26A 1P5QA 1Q6HA 2M1IA 4O2TA 3KAGA 3O5GA 1FKKA 3VAWA 2PV3A 3KAIA 4J4NA 1EQ3A 4IQ2A 3O5KA 1ROUA 1FKRA 3PA7A 2IF4A 2JZVA 3UF8A 2Y78A 3O5JA 2LJ4A 1O6WA 3O5DA 2YSBA 1FKDA 1EYMA 2RUDA 2VN1A 1Q1CA 2MNTA 1N1AA 4DRPA 4R0XA 1U79A 1JNTA 1C9HA 2DG9A 2XPAA 1F40A 1ZK6A 2XP4A 2M8IA 2MF9A 1ROTA 5J6EA 2M2AA 2XP9A 1B6CA 5I98A 1JNSA 2BA1A 2KR7A 4REXA 3RGCA 2XP3A 4LAVA 2ZQSA 1Q6UA 1M5YA 1Y0OA 1J6YA 4ODPA 4IPXA
chains in the Genus database with same CATH superfamily
1TFVA 1D7JA 2WLZA 2MLZA 3IKGA 3ODKA 2ETNA 1QPLA 2ZQTA 1FKSA 2RUCA 2F4EA 1FFRA 3FAPA 1EG4A 3GPKA 3MQHA 4URIA 1FKFA 3PR9A 1IX5A 2AWGA 1J4IA 4ZPWR 1K9RA 4JFLA 2DJYA 1ZBWA 3AS1A 3CHCA 3WD3A 2XP5A 1PBKA 2PI6A 1YW5A 2F2DA 3PRDA 1ZB5A 1GPFA 3KACA 4FAPA 3TC5A 3O5LA 4JYSA 2OLHA 4FN2A 1Q6IA 2VCDA 2RSEA 2D9FA 4P8VA 4DZ3A 2B31A 5HW7A 1W9PA 3NRKA 1J6YA 1NWTA 2KI3A 3IHZA 4G2PA 3W4RA 2KO7A 1K9TA 5GPGA 3RM4A 1W1PA 2ZQUA 1FAPA 4GGQA 1ZCNA 4DRNA 3O5EA 5E65A 1BKFA 1W1VA 5HBFA 4TNSA 5GPRA 4MAVA 3QOKA 2DSVA 1QPFA 3B9DA 2WM0A 1JVWA 1W9UA 4ODKA 5D75A 1WB0A 3KZ7A 5B8IC 5DF0A 4R5EA 3G6MA 2WLYA 1A7XA 3CHEA 2LPVA 4IT4A 4QT3A 1UR9A 3FXYA 4LAYA 1VF8A 4P8XA 3B8SA 2QF8A 1FKBA 2DK1A 1TCOC 2ITKA 1UR8A 2L4JA 2DT3A 4ODRA 2DT1A 3KCEA 2M8JA 1FKLA 4A0UA 3IK8A 3KAFA 1WR7A 1FKHA 3UI4A 5E62A 3WIJA 3KAHA 1KT1A 3CGNA 3OOBA 3NTPA 3EY6A 4U85A 1LL4A 2WK2A 2E45A 4P8WA 4N19A 2JXWA 3LE4A 4E5RA 3JYMA 1TK7A 4ODPA 2DK7A 3CZ8A 4Z2LA 2PN0A 2F21A 1GUVA 4W9PA 3EIPA 4TW8A 4TW6A 3RM9A 3FY1A 2ZR4A 1NWRA 4PTMA 1H0GA 1NSGA 1J4HA 1ZU8A 1WNOA 3MQGA 2XP7A 5HWBA 1FLCA 2JMFA 3FSCA 4HARA 4TX0A 3L4HA 1D6OA 2A3EA 3IKDA 2ZR6A 1J4RA 4A0TA 1HKJA 4MNMA 3ALGA 3RFWA 3LKXB 1O6IA 1E6RA 3AS3A 4W5UA 2YSIA 4ITZA 5HW6A 1WMVA 2WAEA 4ZPTR 3O5MA 2LKNA 2A3BA 4QZVB 1HXVA 3WL0A 4DT4A 3M85A 3O5RA 2EULA 1X6NA 3FSBA 2IUZA 1LJYA 2YSHA 4DWSA 3I6CA 1ZBKA 3O5QA 1LG1A 3UI5A 1FFQA 3PRBA 3UQAA 5AHTA 4L3NA 2M3OW 3CGMA 4ODQA 1HJVA 2JV4A 1E44A 3TCZA 1JMQA 4C02B 4DRJA 5HWCA 5DEZA 1EDQA 4QT2A 2LAJA 3PQHA 2MDIA 1LG2A 4MNLA 1E6PA 2ZQVA 1TR8A 1F8AB 4DROA 3ARZA 2K8IA 2N87A 2QRVA 3TDBA 4ODLA 3KABA 3ARVA 4DRMA 3LKXA 1YATA 1CTNA 1H0IA 2LGOA 4WKHA 5DO2A 2DWVA 2PBCA 5E5WA 4ODMA 4DIPA 3M7NA 3WD2A 3CHDA 2MLYA 4W9OA 3AQUA 4XAKA 3KADA 1D2KA 2PV1A 4LAXA 5HW8A 3CHFA 2DG4A 4DRHA 1ITXA 3RM8A 4Q22A 1X6LA 3H9RB 5E66A 4L72B 1FKGA 1E15A 4DH0A 1NMWA 2UZ5A 4NNRA 1SYTA 1BL4A 1OGBA 5DIUA 4MGVA 4G50A 3PRAA 3LUOA 2EZ5W 4JFJA 3JXVA 4S3KA 2FAPA 2RQSA 3JYJA 4U86A 4DRKA 2RE3A 1JNDA 2ZAJA 2B5UB 2KFWA 4S3JA 1LQ0A 5CQ2A 2XPBA 3UQIA 4MNJA 3ARUA 3WQVA 4Z2IA 1W1TA 3ARPA 4KQZA 1KT0A 4DWSB 4IPXA 4QIBA 2XP6A 1EIBA 4UDMA 1JNEA 3NI6A 2YBUA 4JFIA 2L2SA 2KE0A 1QZ2A 4ODOA 2DSWA 1FKIA 2FKEA 4HBOA 3WD4A 3MDYB 5HUAA 4WKAA 3ARSA 3ARWA 3O5OA 1FD9A 1D7IA 2ZR5A 1PINA 4W9QA 4LGXA 1FJDA 5GQBA 3UI6A 4DRIA 4ZPVR 2FDMA 1E9LA 3ALFA 4DRQA 1GRJA 1NMVA 2DMVA 1K9QA 2RURA 2PV2A 1JCHB 4JFKA 4J4OA 1D7HA 1WAWA 1XHGA 4NZCA 1W9VA 5BXJA 2MLXA 4TYOA 2OFNA 1E6ZA 2DSZA 2M08A 4Z2GA 5HKGA 4IQCA 4ZS6A 1KFWA 1HJXA 3O5FA 1R9HA 4JFMA 5DITA 5HT1A 1HKMA 1FKJA 2YSGA 2PPNA 3AS2A 2KXQA 5DIVA 2Y8NB 1I5HW 1OGGA 1T11A 2RUQA 1EHNA 4ODNA 5HTGA 3GTYX 2P4VA 3UQBA 3O5PA 3CNGA 4BF8A 4TW7A 3WH0A 2DG3A 1FKTA 2KGJA 1HJWA 2MPHA 1LL7A 3O5IA 2JX8A 3G6LA 1ZBVA 4LAWA 2PPPA 3B9EA 2Q5AA 2YAJB 2XP8A 3WD1A 3RMEA 1L1PA 1NH6A 3CH9A 2O92A 4MNKA 4U84A 4NSBA 4WIWA 4GIVA 1NWUA 3WQWA 3WD0A 4DWSC 3WL1A 2YSFA 1GOIA 2YBTA 3ARYA 4MSPA 3MCBB 1SR0A 4DZ2A 2PPOA 3GU0A 3B7XA 1EG3A 4HBEA 1W26A 1P5QA 3ARTA 1Q6HA 3OA5A 5U47A 2M1IA 4O2TA 3KAGA 3O5GA 1FKKA 3VAWA 2PV3A 4WKFA 3KAIA 4KR0B 4J4NA 1E6NA 1EQ3A 4Z2HA 4IQ2A 1XRVA 3O5KA 1ROUA 3ARQA 1OWQA 3ARXA 1FKRA 3PA7A 2IF4A 1RD6A 2ESCA 3BMBA 4IT6A 4P8UA 2WADA 2JZVA 3UF8A 2Y78A 3B9AA 2A3CA 2G8ZA 2A3AA 2G41A 2DT0A 4WK9A 3O5JA 2LJ4A 4MPKA 1O6WA 4DWSD 3O5DA 5JH8A 2YSBA 1FKDA 1EYMA 3MCBA 2RUDA 2VN1A 1NWSA 1Q1CA 2MNTA 1N1AA 4DRPA 3BXWA 4R0XA 4WJXA 1U79A 1JNTA 3AS0A 4Z2JA 1C9HA 2DPEA 4Q7NA 1RP5A 3FS8A 2DG9A 2XPAA 4Z2KA 1ZBCA 1F40A 4ML4A 1ZK6A 1LL6A 2XP4A 2M8IA 2MF9A 1ROTA 4MTVA 5J6EA 2M2AA 2XP9A 1HKKA 1B6CA 5I98A 1JNSA 2BA1A 2KR7A 4REXA 3RGCA 3AROA 3ARRA 2XP3A 2DT2A 4LAVA 2ZQSA 2OWOA 1Q6UA 1M5YA 5E64A 2AOSA 1ZL1A 2F23A 1Y0OA 1HKIA 4GLXA 2DSUA 4AY1A 1W1YA 2O9OA 3WKZA
chains in the Genus database with same CATH topology
1TFVA 1D7JA 2WLZA 2MLZA 3IKGA 3ODKA 1QPLA 2ZQTA 1FKSA 2RUCA 2F4EA 1FFRA 3FAPA 1EG4A 3GPKA 3MQHA 4URIA 1FKFA 3PR9A 1IX5A 2AWGA 1J4IA 4ZPWR 1K9RA 4JFLA 2DJYA 1ZBWA 3AS1A 3CHCA 3WD3A 2XP5A 1PBKA 2PI6A 1YW5A 2F2DA 3PRDA 1ZB5A 1GPFA 3KACA 4FAPA 3TC5A 3O5LA 4JYSA 2OLHA 4FN2A 1Q6IA 2VCDA 2RSEA 2D9FA 4P8VA 4DZ3A 2B31A 5HW7A 1W9PA 3NRKA 1J6YA 1NWTA 2KI3A 3IHZA 4G2PA 3W4RA 2KO7A 1K9TA 5GPGA 3RM4A 1W1PA 2ZQUA 1FAPA 4GGQA 1ZCNA 4DRNA 3O5EA 5E65A 1BKFA 1W1VA 5HBFA 4TNSA 5GPRA 4MAVA 3QOKA 2DSVA 1QPFA 3B9DA 2WM0A 1JVWA 1W9UA 4ODKA 5D75A 1WB0A 3KZ7A 5B8IC 5DF0A 4R5EA 3G6MA 2WLYA 1A7XA 3CHEA 2LPVA 4IT4A 4QT3A 1UR9A 3FXYA 4LAYA 1VF8A 4P8XA 3B8SA 2QF8A 1FKBA 2DK1A 1TCOC 2ITKA 1UR8A 2L4JA 2DT3A 4ODRA 2DT1A 3KCEA 2M8JA 1FKLA 4A0UA 3IK8A 3KAFA 1WR7A 1FKHA 3UI4A 5E62A 3WIJA 3KAHA 1KT1A 3CGNA 3OOBA 3NTPA 3EY6A 4U85A 1LL4A 2WK2A 2E45A 4P8WA 4N19A 2JXWA 3LE4A 4E5RA 3JYMA 1TK7A 4ODPA 2DK7A 3CZ8A 4Z2LA 2F21A 1GUVA 4W9PA 4TW8A 4TW6A 3RM9A 3FY1A 2ZR4A 1NWRA 4PTMA 1H0GA 1NSGA 1J4HA 1ZU8A 1WNOA 3MQGA 2XP7A 5HWBA 1FLCA 2JMFA 3FSCA 4HARA 4TX0A 3L4HA 1D6OA 2A3EA 3IKDA 2ZR6A 1J4RA 4A0TA 1HKJA 4MNMA 3ALGA 3RFWA 3LKXB 1O6IA 1E6RA 3AS3A 4W5UA 2YSIA 4ITZA 5HW6A 1WMVA 2WAEA 4ZPTR 3O5MA 2LKNA 2A3BA 4QZVB 1HXVA 3WL0A 4DT4A 3M85A 3O5RA 1X6NA 3FSBA 2IUZA 1LJYA 2YSHA 4DWSA 3I6CA 1ZBKA 3O5QA 1LG1A 3UI5A 1FFQA 3PRBA 3UQAA 5AHTA 4L3NA 2M3OW 3CGMA 4ODQA 1HJVA 2JV4A 3TCZA 1JMQA 4C02B 4DRJA 5HWCA 5DEZA 1EDQA 4QT2A 2LAJA 3PQHA 2MDIA 1LG2A 4MNLA 1E6PA 2ZQVA 1TR8A 1F8AB 4DROA 3ARZA 2K8IA 2N87A 2QRVA 3TDBA 4ODLA 3KABA 3ARVA 4DRMA 3LKXA 1YATA 1CTNA 1H0IA 2LGOA 4WKHA 5DO2A 2DWVA 2PBCA 5E5WA 4ODMA 4DIPA 3M7NA 3WD2A 3CHDA 2MLYA 4W9OA 3AQUA 4XAKA 3KADA 1D2KA 2PV1A 4LAXA 5HW8A 3CHFA 2DG4A 4DRHA 1ITXA 3RM8A 4Q22A 1X6LA 3H9RB 5E66A 4L72B 1FKGA 1E15A 4DH0A 1NMWA 2UZ5A 4NNRA 1SYTA 1BL4A 1OGBA 5DIUA 4MGVA 4G50A 3PRAA 3LUOA 2EZ5W 4JFJA 3JXVA 4S3KA 2FAPA 2RQSA 3JYJA 4U86A 4DRKA 2RE3A 1JNDA 2ZAJA 2KFWA 4S3JA 1LQ0A 5CQ2A 2XPBA 3UQIA 4MNJA 3ARUA 3WQVA 4Z2IA 1W1TA 3ARPA 4KQZA 1KT0A 4DWSB 4IPXA 4QIBA 2XP6A 1EIBA 1JNEA 3NI6A 2YBUA 4JFIA 2L2SA 2KE0A 1QZ2A 4ODOA 2DSWA 1FKIA 2FKEA 4HBOA 3WD4A 3MDYB 5HUAA 4WKAA 3ARSA 3ARWA 3O5OA 1FD9A 1D7IA 2ZR5A 1PINA 4W9QA 4LGXA 1FJDA 5GQBA 3UI6A 4DRIA 4ZPVR 2FDMA 1E9LA 3ALFA 4DRQA 1NMVA 2DMVA 1K9QA 2RURA 2PV2A 4JFKA 4J4OA 1D7HA 1WAWA 1XHGA 4NZCA 1W9VA 5BXJA 2MLXA 4TYOA 2OFNA 1E6ZA 2DSZA 2M08A 4Z2GA 5HKGA 4IQCA 4ZS6A 1KFWA 1HJXA 3O5FA 1R9HA 4JFMA 5DITA 5HT1A 1HKMA 1FKJA 2YSGA 2PPNA 3AS2A 2KXQA 5DIVA 2Y8NB 1I5HW 1OGGA 1T11A 2RUQA 1EHNA 4ODNA 5HTGA 3UQBA 3O5PA 3CNGA 4BF8A 4TW7A 3WH0A 2DG3A 1FKTA 2KGJA 1HJWA 2MPHA 1LL7A 3O5IA 2JX8A 3G6LA 1ZBVA 4LAWA 2PPPA 3B9EA 2Q5AA 2YAJB 2XP8A 3WD1A 3RMEA 1L1PA 1NH6A 3CH9A 2O92A 4MNKA 4U84A 4NSBA 4WIWA 4GIVA 1NWUA 3WQWA 3WD0A 4DWSC 3WL1A 2YSFA 1GOIA 2YBTA 3ARYA 4MSPA 3MCBB 1SR0A 4DZ2A 2PPOA 3B7XA 1EG3A 4HBEA 1W26A 1P5QA 3ARTA 1Q6HA 3OA5A 5U47A 2M1IA 4O2TA 3KAGA 3O5GA 1FKKA 3VAWA 2PV3A 4WKFA 3KAIA 4KR0B 4J4NA 1E6NA 1EQ3A 4Z2HA 4IQ2A 1XRVA 3O5KA 1ROUA 3ARQA 1OWQA 3ARXA 1FKRA 3PA7A 2IF4A 1RD6A 2ESCA 4IT6A 4P8UA 2WADA 2JZVA 3UF8A 2Y78A 3B9AA 2A3CA 2G8ZA 2A3AA 2G41A 2DT0A 4WK9A 3O5JA 2LJ4A 4MPKA 1O6WA 4DWSD 3O5DA 5JH8A 2YSBA 1FKDA 1EYMA 3MCBA 2RUDA 2VN1A 1NWSA 1Q1CA 2MNTA 1N1AA 4DRPA 3BXWA 4R0XA 4WJXA 1U79A 1JNTA 3AS0A 4Z2JA 1C9HA 2DPEA 4Q7NA 1RP5A 3FS8A 2DG9A 2XPAA 4Z2KA 1ZBCA 1F40A 4ML4A 1ZK6A 1LL6A 2XP4A 2M8IA 2MF9A 1ROTA 4MTVA 5J6EA 2M2AA 2XP9A 1HKKA 1B6CA 5I98A 1JNSA 2BA1A 2KR7A 4REXA 3RGCA 3AROA 3ARRA 2XP3A 2DT2A 4LAVA 2ZQSA 2OWOA 1Q6UA 1M5YA 5E64A 2AOSA 1ZL1A 1Y0OA 1HKIA 4GLXA 2DSUA 4AY1A 1W1YA 2O9OA 3WKZA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1D7J A;  2MLZ A;  3IKG A;  3ODK A;  1QPL A;  2ZQT A;  1FKS A;  2RUC A;  2F4E A;  3FAP A;  1EG4 A;  3GPK A;  1FKF A;  2AWG A;  1J4I A;  1K9R A;  4JFL A;  2DJY A;  2XP5 A;  1PBK A;  1YW5 A;  2F2D A;  3PRD A;  3KAC A;  4FAP A;  3TC5 A;  3O5L A;  4JYS A;  4FN2 A;  1Q6I A;  2VCD A;  2RSE A;  2D9F A;  4DZ3 A;  5HW7 A;  3NRK A;  2KI3 A;  3IHZ A;  4G2P A;  2KO7 A;  5GPG A;  2ZQU A;  1FAP A;  4GGQ A;  1ZCN A;  4DRN A;  3O5E A;  1BKF A;  4TNS A;  1QPF A;  4ODK A;  1JVW A;  5D75 A;  3KZ7 A;  5B8I C;  1A7X A;  2LPV A;  4QT3 A;  4LAY A;  1FKB A;  2DK1 A;  1TCO C;  2ITK A;  2L4J A;  4ODR A;  3KCE A;  2M8J A;  1FKL A;  3IK8 A;  3KAF A;  1WR7 A;  1FKH A;  3UI4 A;  3KAH A;  1KT1 A;  3CGN A;  3OOB A;  3NTP A;  3EY6 A;  4U85 A;  2E45 A;  4N19 A;  2JXW A;  3LE4 A;  4E5R A;  3JYM A;  1TK7 A;  2DK7 A;  2F21 A;  4W9P A;  4TW8 A;  4TW6 A;  2ZR4 A;  1NSG A;  1J4H A;  2XP7 A;  5HWB A;  2JMF A;  4TX0 A;  3L4H A;  1D6O A;  3IKD A;  2ZR6 A;  1J4R A;  3RFW A;  2YSI A;  4ITZ A;  5HW6 A;  1WMV A;  3O5M A;  2LKN A;  1HXV A;  4DT4 A;  3M85 A;  3O5R A;  2YSH A;  3I6C A;  3O5Q A;  3UI5 A;  3PRB A;  3UQA A;  5AHT A;  2M3O W;  3CGM A;  4ODQ A;  2JV4 A;  4DRJ A;  3TCZ A;  1JMQ A;  4C02 B;  5HWC A;  4QT2 A;  2LAJ A;  2MDI A;  2ZQV A;  1F8A B;  4DRO A;  2K8I A;  2N87 A;  3TDB A;  4ODL A;  3KAB A;  4DRM A;  1YAT A;  2LGO A;  2DWV A;  2PBC A;  4ODM A;  4DIP A;  3M7N A;  2MLY A;  4W9O A;  3KAD A;  2PV1 A;  4LAX A;  5HW8 A;  2DG4 A;  4DRH A;  3H9R B;  1FKG A;  4DH0 A;  1NMW A;  2UZ5 A;  4NNR A;  1BL4 A;  5DIU A;  4MGV A;  4G50 A;  3LUO A;  2EZ5 W;  4JFJ A;  3JXV A;  2FAP A;  2RQS A;  3JYJ A;  4U86 A;  4DRK A;  2RE3 A;  2ZAJ A;  2KFW A;  5CQ2 A;  2XPB A;  3UQI A;  1KT0 A;  4QIB A;  2XP6 A;  3NI6 A;  4JFI A;  2L2S A;  2KE0 A;  1QZ2 A;  4ODO A;  1FKI A;  2FKE A;  3MDY B;  5HUA A;  3O5O A;  1FD9 A;  1D7I A;  2ZR5 A;  1PIN A;  4W9Q A;  1FJD A;  3UI6 A;  4DRI A;  4DRQ A;  1NMV A;  2DMV A;  1K9Q A;  2RUR A;  2PV2 A;  4JFK A;  4J4O A;  1D7H A;  5BXJ A;  2MLX A;  4TYO A;  2OFN A;  5HKG A;  2M08 A;  4IQC A;  3O5F A;  1R9H A;  4JFM A;  5DIT A;  5HT1 A;  1FKJ A;  2YSG A;  2PPN A;  2KXQ A;  5DIV A;  1I5H W;  1T11 A;  2RUQ A;  4ODN A;  5HTG A;  3UQB A;  3O5P A;  3CNG A;  4BF8 A;  4TW7 A;  3WH0 A;  2DG3 A;  1FKT A;  2KGJ A;  2MPH A;  3O5I A;  2JX8 A;  4LAW A;  2PPP A;  2Q5A A;  2XP8 A;  1L1P A;  4U84 A;  4GIV A;  2YSF A;  4MSP A;  4DZ2 A;  2PPO A;  3B7X A;  1EG3 A;  1W26 A;  1P5Q A;  1Q6H A;  2M1I A;  4O2T A;  3KAG A;  3O5G A;  1FKK A;  3VAW A;  2PV3 A;  3KAI A;  4J4N A;  1EQ3 A;  4IQ2 A;  3O5K A;  1ROU A;  1FKR A;  3PA7 A;  2IF4 A;  2JZV A;  3UF8 A;  2Y78 A;  3O5J A;  2LJ4 A;  1O6W A;  3O5D A;  2YSB A;  1FKD A;  1EYM A;  2RUD A;  2VN1 A;  1Q1C A;  2MNT A;  1N1A A;  4DRP A;  4R0X A;  1U79 A;  1JNT A;  1C9H A;  2DG9 A;  2XPA A;  1F40 A;  1ZK6 A;  2XP4 A;  2M8I A;  2MF9 A;  1ROT A;  5J6E A;  2M2A A;  2XP9 A;  1B6C A;  5I98 A;  1JNS A;  2BA1 A;  2KR7 A;  4REX A;  3RGC A;  2XP3 A;  4LAV A;  2ZQS A;  1Q6U A;  1M5Y A;  1Y0O A;  1J6Y A;  4ODP A;  4IPX A; 
#chains in the Genus database with same CATH topology
 1TFV A;  1D7J A;  2WLZ A;  2MLZ A;  3IKG A;  3ODK A;  2ETN A;  1QPL A;  2ZQT A;  1FKS A;  2RUC A;  2F4E A;  1FFR A;  3FAP A;  1EG4 A;  3GPK A;  3MQH A;  4URI A;  1FKF A;  3PR9 A;  1IX5 A;  2AWG A;  1J4I A;  4ZPW R;  1K9R A;  4JFL A;  2DJY A;  1ZBW A;  3AS1 A;  3CHC A;  3WD3 A;  2XP5 A;  1PBK A;  2PI6 A;  1YW5 A;  2F2D A;  3PRD A;  1ZB5 A;  1GPF A;  3KAC A;  4FAP A;  3TC5 A;  3O5L A;  4JYS A;  2OLH A;  4FN2 A;  1Q6I A;  2VCD A;  2RSE A;  2D9F A;  4P8V A;  4DZ3 A;  2B31 A;  5HW7 A;  1W9P A;  3NRK A;  1J6Y A;  1NWT A;  2KI3 A;  3IHZ A;  4G2P A;  3W4R A;  2KO7 A;  1K9T A;  5GPG A;  3RM4 A;  1W1P A;  2ZQU A;  1FAP A;  4GGQ A;  1ZCN A;  4DRN A;  3O5E A;  5E65 A;  1BKF A;  1W1V A;  5HBF A;  4TNS A;  5GPR A;  4MAV A;  3QOK A;  2DSV A;  1QPF A;  3B9D A;  2WM0 A;  1JVW A;  1W9U A;  4ODK A;  5D75 A;  1WB0 A;  3KZ7 A;  5B8I C;  5DF0 A;  4R5E A;  3G6M A;  2WLY A;  1A7X A;  3CHE A;  2LPV A;  4IT4 A;  4QT3 A;  1UR9 A;  3FXY A;  4LAY A;  1VF8 A;  4P8X A;  3B8S A;  2QF8 A;  1FKB A;  2DK1 A;  1TCO C;  2ITK A;  1UR8 A;  2L4J A;  2DT3 A;  4ODR A;  2DT1 A;  3KCE A;  2M8J A;  1FKL A;  4A0U A;  3IK8 A;  3KAF A;  1WR7 A;  1FKH A;  3UI4 A;  5E62 A;  3WIJ A;  3KAH A;  1KT1 A;  3CGN A;  3OOB A;  3NTP A;  3EY6 A;  4U85 A;  1LL4 A;  2WK2 A;  2E45 A;  4P8W A;  4N19 A;  2JXW A;  3LE4 A;  4E5R A;  3JYM A;  1TK7 A;  4ODP A;  2DK7 A;  3CZ8 A;  4Z2L A;  2PN0 A;  2F21 A;  1GUV A;  4W9P A;  3EIP A;  4TW8 A;  4TW6 A;  3RM9 A;  3FY1 A;  2ZR4 A;  1NWR A;  4PTM A;  1H0G A;  1NSG A;  1J4H A;  1ZU8 A;  1WNO A;  3MQG A;  2XP7 A;  5HWB A;  1FLC A;  2JMF A;  3FSC A;  4HAR A;  4TX0 A;  3L4H A;  1D6O A;  2A3E A;  3IKD A;  2ZR6 A;  1J4R A;  4A0T A;  1HKJ A;  4MNM A;  3ALG A;  3RFW A;  3LKX B;  1O6I A;  1E6R A;  3AS3 A;  4W5U A;  2YSI A;  4ITZ A;  5HW6 A;  1WMV A;  2WAE A;  4ZPT R;  3O5M A;  2LKN A;  2A3B A;  4QZV B;  1HXV A;  3WL0 A;  4DT4 A;  3M85 A;  3O5R A;  2EUL A;  1X6N A;  3FSB A;  2IUZ A;  1LJY A;  2YSH A;  4DWS A;  3I6C A;  1ZBK A;  3O5Q A;  1LG1 A;  3UI5 A;  1FFQ A;  3PRB A;  3UQA A;  5AHT A;  4L3N A;  2M3O W;  3CGM A;  4ODQ A;  1HJV A;  2JV4 A;  1E44 A;  3TCZ A;  1JMQ A;  4C02 B;  4DRJ A;  5HWC A;  5DEZ A;  1EDQ A;  4QT2 A;  2LAJ A;  3PQH A;  2MDI A;  1LG2 A;  4MNL A;  1E6P A;  2ZQV A;  1TR8 A;  1F8A B;  4DRO A;  3ARZ A;  2K8I A;  2N87 A;  2QRV A;  3TDB A;  4ODL A;  3KAB A;  3ARV A;  4DRM A;  3LKX A;  1YAT A;  1CTN A;  1H0I A;  2LGO A;  4WKH A;  5DO2 A;  2DWV A;  2PBC A;  5E5W A;  4ODM A;  4DIP A;  3M7N A;  3WD2 A;  3CHD A;  2MLY A;  4W9O A;  3AQU A;  4XAK A;  3KAD A;  1D2K A;  2PV1 A;  4LAX A;  5HW8 A;  3CHF A;  2DG4 A;  4DRH A;  1ITX A;  3RM8 A;  4Q22 A;  1X6L A;  3H9R B;  5E66 A;  4L72 B;  1FKG A;  1E15 A;  4DH0 A;  1NMW A;  2UZ5 A;  4NNR A;  1SYT A;  1BL4 A;  1OGB A;  5DIU A;  4MGV A;  4G50 A;  3PRA A;  3LUO A;  2EZ5 W;  4JFJ A;  3JXV A;  4S3K A;  2FAP A;  2RQS A;  3JYJ A;  4U86 A;  4DRK A;  2RE3 A;  1JND A;  2ZAJ A;  2B5U B;  2KFW A;  4S3J A;  1LQ0 A;  5CQ2 A;  2XPB A;  3UQI A;  4MNJ A;  3ARU A;  3WQV A;  4Z2I A;  1W1T A;  3ARP A;  4KQZ A;  1KT0 A;  4DWS B;  4IPX A;  4QIB A;  2XP6 A;  1EIB A;  4UDM A;  1JNE A;  3NI6 A;  2YBU A;  4JFI A;  2L2S A;  2KE0 A;  1QZ2 A;  4ODO A;  2DSW A;  1FKI A;  2FKE A;  4HBO A;  3WD4 A;  3MDY B;  5HUA A;  4WKA A;  3ARS A;  3ARW A;  3O5O A;  1FD9 A;  1D7I A;  2ZR5 A;  1PIN A;  4W9Q A;  4LGX A;  1FJD A;  5GQB A;  3UI6 A;  4DRI A;  4ZPV R;  2FDM A;  1E9L A;  3ALF A;  4DRQ A;  1GRJ A;  1NMV A;  2DMV A;  1K9Q A;  2RUR A;  2PV2 A;  1JCH B;  4JFK A;  4J4O A;  1D7H A;  1WAW A;  1XHG A;  4NZC A;  1W9V A;  5BXJ A;  2MLX A;  4TYO A;  2OFN A;  1E6Z A;  2DSZ A;  2M08 A;  4Z2G A;  5HKG A;  4IQC A;  4ZS6 A;  1KFW A;  1HJX A;  3O5F A;  1R9H A;  4JFM A;  5DIT A;  5HT1 A;  1HKM A;  1FKJ A;  2YSG A;  2PPN A;  3AS2 A;  2KXQ A;  5DIV A;  2Y8N B;  1I5H W;  1OGG A;  1T11 A;  2RUQ A;  1EHN A;  4ODN A;  5HTG A;  3GTY X;  2P4V A;  3UQB A;  3O5P A;  3CNG A;  4BF8 A;  4TW7 A;  3WH0 A;  2DG3 A;  1FKT A;  2KGJ A;  1HJW A;  2MPH A;  1LL7 A;  3O5I A;  2JX8 A;  3G6L A;  1ZBV A;  4LAW A;  2PPP A;  3B9E A;  2Q5A A;  2YAJ B;  2XP8 A;  3WD1 A;  3RME A;  1L1P A;  1NH6 A;  3CH9 A;  2O92 A;  4MNK A;  4U84 A;  4NSB A;  4WIW A;  4GIV A;  1NWU A;  3WQW A;  3WD0 A;  4DWS C;  3WL1 A;  2YSF A;  1GOI A;  2YBT A;  3ARY A;  4MSP A;  3MCB B;  1SR0 A;  4DZ2 A;  2PPO A;  3GU0 A;  3B7X A;  1EG3 A;  4HBE A;  1W26 A;  1P5Q A;  3ART A;  1Q6H A;  3OA5 A;  5U47 A;  2M1I A;  4O2T A;  3KAG A;  3O5G A;  1FKK A;  3VAW A;  2PV3 A;  4WKF A;  3KAI A;  4KR0 B;  4J4N A;  1E6N A;  1EQ3 A;  4Z2H A;  4IQ2 A;  1XRV A;  3O5K A;  1ROU A;  3ARQ A;  1OWQ A;  3ARX A;  1FKR A;  3PA7 A;  2IF4 A;  1RD6 A;  2ESC A;  3BMB A;  4IT6 A;  4P8U A;  2WAD A;  2JZV A;  3UF8 A;  2Y78 A;  3B9A A;  2A3C A;  2G8Z A;  2A3A A;  2G41 A;  2DT0 A;  4WK9 A;  3O5J A;  2LJ4 A;  4MPK A;  1O6W A;  4DWS D;  3O5D A;  5JH8 A;  2YSB A;  1FKD A;  1EYM A;  3MCB A;  2RUD A;  2VN1 A;  1NWS A;  1Q1C A;  2MNT A;  1N1A A;  4DRP A;  3BXW A;  4R0X A;  4WJX A;  1U79 A;  1JNT A;  3AS0 A;  4Z2J A;  1C9H A;  2DPE A;  4Q7N A;  1RP5 A;  3FS8 A;  2DG9 A;  2XPA A;  4Z2K A;  1ZBC A;  1F40 A;  4ML4 A;  1ZK6 A;  1LL6 A;  2XP4 A;  2M8I A;  2MF9 A;  1ROT A;  4MTV A;  5J6E A;  2M2A A;  2XP9 A;  1HKK A;  1B6C A;  5I98 A;  1JNS A;  2BA1 A;  2KR7 A;  4REX A;  3RGC A;  3ARO A;  3ARR A;  2XP3 A;  2DT2 A;  4LAV A;  2ZQS A;  2OWO A;  1Q6U A;  1M5Y A;  5E64 A;  2AOS A;  1ZL1 A;  2F23 A;  1Y0O A;  1HKI A;  4GLX A;  2DSU A;  4AY1 A;  1W1Y A;  2O9O A;  3WKZ A; 
#chains in the Genus database with same CATH homology
 1TFV A;  1D7J A;  2WLZ A;  2MLZ A;  3IKG A;  3ODK A;  1QPL A;  2ZQT A;  1FKS A;  2RUC A;  2F4E A;  1FFR A;  3FAP A;  1EG4 A;  3GPK A;  3MQH A;  4URI A;  1FKF A;  3PR9 A;  1IX5 A;  2AWG A;  1J4I A;  4ZPW R;  1K9R A;  4JFL A;  2DJY A;  1ZBW A;  3AS1 A;  3CHC A;  3WD3 A;  2XP5 A;  1PBK A;  2PI6 A;  1YW5 A;  2F2D A;  3PRD A;  1ZB5 A;  1GPF A;  3KAC A;  4FAP A;  3TC5 A;  3O5L A;  4JYS A;  2OLH A;  4FN2 A;  1Q6I A;  2VCD A;  2RSE A;  2D9F A;  4P8V A;  4DZ3 A;  2B31 A;  5HW7 A;  1W9P A;  3NRK A;  1J6Y A;  1NWT A;  2KI3 A;  3IHZ A;  4G2P A;  3W4R A;  2KO7 A;  1K9T A;  5GPG A;  3RM4 A;  1W1P A;  2ZQU A;  1FAP A;  4GGQ A;  1ZCN A;  4DRN A;  3O5E A;  5E65 A;  1BKF A;  1W1V A;  5HBF A;  4TNS A;  5GPR A;  4MAV A;  3QOK A;  2DSV A;  1QPF A;  3B9D A;  2WM0 A;  1JVW A;  1W9U A;  4ODK A;  5D75 A;  1WB0 A;  3KZ7 A;  5B8I C;  5DF0 A;  4R5E A;  3G6M A;  2WLY A;  1A7X A;  3CHE A;  2LPV A;  4IT4 A;  4QT3 A;  1UR9 A;  3FXY A;  4LAY A;  1VF8 A;  4P8X A;  3B8S A;  2QF8 A;  1FKB A;  2DK1 A;  1TCO C;  2ITK A;  1UR8 A;  2L4J A;  2DT3 A;  4ODR A;  2DT1 A;  3KCE A;  2M8J A;  1FKL A;  4A0U A;  3IK8 A;  3KAF A;  1WR7 A;  1FKH A;  3UI4 A;  5E62 A;  3WIJ A;  3KAH A;  1KT1 A;  3CGN A;  3OOB A;  3NTP A;  3EY6 A;  4U85 A;  1LL4 A;  2WK2 A;  2E45 A;  4P8W A;  4N19 A;  2JXW A;  3LE4 A;  4E5R A;  3JYM A;  1TK7 A;  4ODP A;  2DK7 A;  3CZ8 A;  4Z2L A;  2F21 A;  1GUV A;  4W9P A;  4TW8 A;  4TW6 A;  3RM9 A;  3FY1 A;  2ZR4 A;  1NWR A;  4PTM A;  1H0G A;  1NSG A;  1J4H A;  1ZU8 A;  1WNO A;  3MQG A;  2XP7 A;  5HWB A;  1FLC A;  2JMF A;  3FSC A;  4HAR A;  4TX0 A;  3L4H A;  1D6O A;  2A3E A;  3IKD A;  2ZR6 A;  1J4R A;  4A0T A;  1HKJ A;  4MNM A;  3ALG A;  3RFW A;  3LKX B;  1O6I A;  1E6R A;  3AS3 A;  4W5U A;  2YSI A;  4ITZ A;  5HW6 A;  1WMV A;  2WAE A;  4ZPT R;  3O5M A;  2LKN A;  2A3B A;  4QZV B;  1HXV A;  3WL0 A;  4DT4 A;  3M85 A;  3O5R A;  1X6N A;  3FSB A;  2IUZ A;  1LJY A;  2YSH A;  4DWS A;  3I6C A;  1ZBK A;  3O5Q A;  1LG1 A;  3UI5 A;  1FFQ A;  3PRB A;  3UQA A;  5AHT A;  4L3N A;  2M3O W;  3CGM A;  4ODQ A;  1HJV A;  2JV4 A;  3TCZ A;  1JMQ A;  4C02 B;  4DRJ A;  5HWC A;  5DEZ A;  1EDQ A;  4QT2 A;  2LAJ A;  3PQH A;  2MDI A;  1LG2 A;  4MNL A;  1E6P A;  2ZQV A;  1TR8 A;  1F8A B;  4DRO A;  3ARZ A;  2K8I A;  2N87 A;  2QRV A;  3TDB A;  4ODL A;  3KAB A;  3ARV A;  4DRM A;  3LKX A;  1YAT A;  1CTN A;  1H0I A;  2LGO A;  4WKH A;  5DO2 A;  2DWV A;  2PBC A;  5E5W A;  4ODM A;  4DIP A;  3M7N A;  3WD2 A;  3CHD A;  2MLY A;  4W9O A;  3AQU A;  4XAK A;  3KAD A;  1D2K A;  2PV1 A;  4LAX A;  5HW8 A;  3CHF A;  2DG4 A;  4DRH A;  1ITX A;  3RM8 A;  4Q22 A;  1X6L A;  3H9R B;  5E66 A;  4L72 B;  1FKG A;  1E15 A;  4DH0 A;  1NMW A;  2UZ5 A;  4NNR A;  1SYT A;  1BL4 A;  1OGB A;  5DIU A;  4MGV A;  4G50 A;  3PRA A;  3LUO A;  2EZ5 W;  4JFJ A;  3JXV A;  4S3K A;  2FAP A;  2RQS A;  3JYJ A;  4U86 A;  4DRK A;  2RE3 A;  1JND A;  2ZAJ A;  2KFW A;  4S3J A;  1LQ0 A;  5CQ2 A;  2XPB A;  3UQI A;  4MNJ A;  3ARU A;  3WQV A;  4Z2I A;  1W1T A;  3ARP A;  4KQZ A;  1KT0 A;  4DWS B;  4IPX A;  4QIB A;  2XP6 A;  1EIB A;  1JNE A;  3NI6 A;  2YBU A;  4JFI A;  2L2S A;  2KE0 A;  1QZ2 A;  4ODO A;  2DSW A;  1FKI A;  2FKE A;  4HBO A;  3WD4 A;  3MDY B;  5HUA A;  4WKA A;  3ARS A;  3ARW A;  3O5O A;  1FD9 A;  1D7I A;  2ZR5 A;  1PIN A;  4W9Q A;  4LGX A;  1FJD A;  5GQB A;  3UI6 A;  4DRI A;  4ZPV R;  2FDM A;  1E9L A;  3ALF A;  4DRQ A;  1NMV A;  2DMV A;  1K9Q A;  2RUR A;  2PV2 A;  4JFK A;  4J4O A;  1D7H A;  1WAW A;  1XHG A;  4NZC A;  1W9V A;  5BXJ A;  2MLX A;  4TYO A;  2OFN A;  1E6Z A;  2DSZ A;  2M08 A;  4Z2G A;  5HKG A;  4IQC A;  4ZS6 A;  1KFW A;  1HJX A;  3O5F A;  1R9H A;  4JFM A;  5DIT A;  5HT1 A;  1HKM A;  1FKJ A;  2YSG A;  2PPN A;  3AS2 A;  2KXQ A;  5DIV A;  2Y8N B;  1I5H W;  1OGG A;  1T11 A;  2RUQ A;  1EHN A;  4ODN A;  5HTG A;  3UQB A;  3O5P A;  3CNG A;  4BF8 A;  4TW7 A;  3WH0 A;  2DG3 A;  1FKT A;  2KGJ A;  1HJW A;  2MPH A;  1LL7 A;  3O5I A;  2JX8 A;  3G6L A;  1ZBV A;  4LAW A;  2PPP A;  3B9E A;  2Q5A A;  2YAJ B;  2XP8 A;  3WD1 A;  3RME A;  1L1P A;  1NH6 A;  3CH9 A;  2O92 A;  4MNK A;  4U84 A;  4NSB A;  4WIW A;  4GIV A;  1NWU A;  3WQW A;  3WD0 A;  4DWS C;  3WL1 A;  2YSF A;  1GOI A;  2YBT A;  3ARY A;  4MSP A;  3MCB B;  1SR0 A;  4DZ2 A;  2PPO A;  3B7X A;  1EG3 A;  4HBE A;  1W26 A;  1P5Q A;  3ART A;  1Q6H A;  3OA5 A;  5U47 A;  2M1I A;  4O2T A;  3KAG A;  3O5G A;  1FKK A;  3VAW A;  2PV3 A;  4WKF A;  3KAI A;  4KR0 B;  4J4N A;  1E6N A;  1EQ3 A;  4Z2H A;  4IQ2 A;  1XRV A;  3O5K A;  1ROU A;  3ARQ A;  1OWQ A;  3ARX A;  1FKR A;  3PA7 A;  2IF4 A;  1RD6 A;  2ESC A;  4IT6 A;  4P8U A;  2WAD A;  2JZV A;  3UF8 A;  2Y78 A;  3B9A A;  2A3C A;  2G8Z A;  2A3A A;  2G41 A;  2DT0 A;  4WK9 A;  3O5J A;  2LJ4 A;  4MPK A;  1O6W A;  4DWS D;  3O5D A;  5JH8 A;  2YSB A;  1FKD A;  1EYM A;  3MCB A;  2RUD A;  2VN1 A;  1NWS A;  1Q1C A;  2MNT A;  1N1A A;  4DRP A;  3BXW A;  4R0X A;  4WJX A;  1U79 A;  1JNT A;  3AS0 A;  4Z2J A;  1C9H A;  2DPE A;  4Q7N A;  1RP5 A;  3FS8 A;  2DG9 A;  2XPA A;  4Z2K A;  1ZBC A;  1F40 A;  4ML4 A;  1ZK6 A;  1LL6 A;  2XP4 A;  2M8I A;  2MF9 A;  1ROT A;  4MTV A;  5J6E A;  2M2A A;  2XP9 A;  1HKK A;  1B6C A;  5I98 A;  1JNS A;  2BA1 A;  2KR7 A;  4REX A;  3RGC A;  3ARO A;  3ARR A;  2XP3 A;  2DT2 A;  4LAV A;  2ZQS A;  2OWO A;  1Q6U A;  1M5Y A;  5E64 A;  2AOS A;  1ZL1 A;  1Y0O A;  1HKI A;  4GLX A;  2DSU A;  4AY1 A;  1W1Y A;  2O9O A;  3WKZ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...