2XP4A

Discovery of cell-active phenyl-imidazole pin1 inhibitors by structure-guided fragment evolution
Total Genus 46
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
46
sequence length
157
structure length
144
Chain Sequence
LPPGWEKAMSRSSGRVYYFNHITNASQWERPEPARVRCSHLLVKHSQSRRPSSWRQEKITRTKEEALELINGYIQKIKSGEEDFESLASQFSDCSSAKARGDLGAFSRGQMQKPFEDASFALRTGEMSGPVFTDSGIHIILRTE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Isomerase
molecule keywords PEPTIDYL-PROLYL CIS-TRANS ISOMERASE NIMA-INTERACTING 1
publication title Discovery of Cell-Active Phenyl-Imidazole Pin1 Inhibitors by Structure-Guided Fragment Evolution.
pubmed doi rcsb
source organism Homo sapiens
total genus 46
structure length 144
sequence length 157
ec nomenclature ec 5.2.1.8: Peptidylprolyl isomerase.
pdb deposition date 2010-08-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00397 WW WW domain
A PF00639 Rotamase PPIC-type PPIASE domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.20.70.10 Mainly Beta Single Sheet Ubiquitin Ligase Nedd4; Chain: W; Ubiquitin Ligase Nedd4; Chain: W; 2xp4A01
3.10.50.40 Alpha Beta Roll Chitinase A; domain 3 Chitinase A; domain 3 2xp4A02
3O5JA 4MSPA 1FKTA 1N1AA 3H9RB 3OOBA 1FAPA 2Y78A 1JVWA 1NMVA 3NI6A 1B6CA 2M8IA 2LJ4A 4ODMA 2KE0A 2DMVA 1D7IA 1D7HA 4DRQA 2MDIA 2F4EA 4G2PA 4DRMA 1FKIA 1C9HA 5AHTA 2YSFA 2L4JA 2D9FA 5BXJA 3VAWA 2XPAA 2PPOA 1NMWA 1Q6UA 2ZQTA 1K9QA 2RURA 2ZR4A 2KI3A 3JXVA 2MLXA 3O5RA 3IKDA 2EZ5W 1J4IA 1J4HA 2RQSA 1EQ3A 3UI4A 5HUAA 4JFJA 4REXA 1O6WA 1FKGA 1PBKA 2K8IA 3UF8A 2JMFA 1L1PA 1FKFA 1W26A 1YW5A 1FKKA 1M5YA 3O5KA 1P5QA 3O5FA 4BF8A 2ZR5A 2PV1A 4LAXA 2M1IA 1D6OA 2PV3A 2XP8A 4J4NA 5HKGA 2M2AA 4DRHA 2DK7A 4TX0A 3PRDA 2LAJA 1FJDA 1QPLA 4E5RA 1PINA 2LKNA 1FKRA 4LAVA 3KCEA 2ZR6A 3TCZA 3O5IA 2MF9A 5HTGA 2MLYA 2DG4A 5DITA 3PRBA 2BA1A 3NRKA 4TNSA 4TW6A 2M3OW 2KFWA 3IK8A 3KAFA 1YATA 4FAPA 3M85A 4ODQA 4ODLA 3GPKA 2XP3A 1ROUA 2KO7A 1ZCNA 1FKJA 2RUQA 2KGJA 1R9HA 1J6YA 4R0XA 2L2SA 2YSHA 2FAPA 2MNTA 2M08A 4U85A 3I6CA 4C02B 2RUCA 1FKDA 2OFNA 4NNRA 4TW7A 1Q1CA 1J4RA 3M7NA 2AWGA 5DIVA 1KT0A 5GPGA 4DRJA 3UQBA 2DWVA 4TW8A 2VN1A 2ZAJA 2JXWA 4U86A 1FKLA 2YSGA 2N87A 1JNSA 3TC5A 5D75A 1QZ2A 2PBCA 3RFWA 4ODOA 3UQIA 1A7XA 4MGVA 2LPVA 3O5EA 4DRNA 3PA7A 3JYJA 4G50A 4ODKA 4W9OA 1HXVA 2PPNA 4W9PA 1WMVA 1NSGA 3L4HA 3MDYB 4DT4A 4QT2A 1FKBA 2ITKA 2KXQA 4DRPA 1Y0OA 2ZQVA 2RSEA 1BKFA 5HW6A 4W9QA 4IQ2A 2Q5AA 3WH0A 1Q6IA 3CGNA 2E45A 3NTPA 2JZVA 4ODNA 3UI6A 3KAHA 5HW8A 5J6EA 4O2TA 3O5OA 1ZK6A 4DZ2A 1WR7A 2XP9A 4JFIA 2FKEA 2KR7A 4IPXA 1FD9A 1F40A 2YSIA 4IQCA 2UZ5A 3ODKA 5CQ2A 3IKGA 3CGMA 3O5QA 3KZ7A 2DG9A 2ZQUA 4LAWA 5HWBA 1T11A 1I5HW 1QPFA 3O5GA 4DH0A 3KADA 2F21A 4DRIA 4JFLA 2XP4A 2F2DA 2DJYA 3O5LA 2MLZA 2YSBA 2XP6A 2VCDA 4TYOA 1F8AB 1EG3A 4GIVA 4DZ3A 2PPPA 4QIBA 4JFMA 2DG3A 4DROA 3KACA 4N19A 4J4OA 2JX8A 3JYMA 1EYMA 5I98A 1JNTA 3UI5A 1JMQA 4QT3A 4FN2A 2ZQSA 3LUOA 5DIUA 2XPBA 3O5PA 2M8JA 5HWCA 3O5DA 3FAPA 5HT1A 2IF4A 4GGQA 1Q6HA 1ROTA 4LAYA 3O5MA 5HW7A 1TK7A 3B7XA 3KAGA 2XP5A 4JYSA 3CNGA 5B8IC 3KABA 2LGOA 1TCOC 2RE3A 4ODRA 2MPHA 2PV2A 2JV4A 3UQAA 4ODPA 2XP7A 2DK1A 3RGCA 4DIPA 2RUDA 1K9RA 3EY6A 4JFKA 4DRKA 1D7JA 4U84A 1FKSA 4ITZA 1BL4A 1U79A 1KT1A 3LE4A 3KAIA 1EG4A 1FKHA 3TDBA 3IHZA
chains in the Genus database with same CATH superfamily
1HKJA 3O5JA 4MSPA 4ML4A 1KFWA 4WKFA 2DSZA 1FKTA 1N1AA 3H9RB 3AS2A 4Z2GA 1CTNA 3OOBA 1FAPA 2Y78A 1JVWA 1NMVA 3NI6A 1B6CA 2M8IA 5GQBA 2LJ4A 4ODMA 2KE0A 2DMVA 1D7IA 1D7HA 4DRQA 2MDIA 4NSBA 3LKXB 1GRJA 2F4EA 4G2PA 4DRMA 1LG1A 3FSBA 1FKIA 3AS3A 3WD1A 1IX5A 1C9HA 5AHTA 2YSFA 2L4JA 1ZBCA 4IT6A 2D9FA 3W4RA 1OWQA 3G6LA 4WKAA 4MNMA 2WAEA 5BXJA 3VAWA 2XPAA 2PPOA 1NMWA 1Q6UA 2ZQTA 1K9QA 2RURA 2ZR4A 2B31A 2KI3A 3JXVA 2MLXA 3O5RA 1LL7A 3IKDA 2EZ5W 1J4IA 2O9OA 5E5WA 1J4HA 1TR8A 2RQSA 3B9AA 1EQ3A 3UI4A 1W1TA 5HUAA 4JFJA 3BXWA 3B9DA 4REXA 2DSVA 2O92A 1O6WA 5E66A 1FKGA 1PBKA 2K8IA 1ZU8A 1W9UA 5DO2A 2FDMA 5GPRA 3UF8A 2JMFA 1L1PA 1OGGA 1FKFA 1W26A 1YW5A 3B9EA 3OA5A 1FKKA 1M5YA 3O5KA 1P5QA 3O5FA 4BF8A 2ZR5A 1ZBWA 4L72B 3CHCA 1E44A 2PV1A 4LAXA 2M1IA 3ALGA 1D6OA 2PV3A 3RM9A 3WQWA 4DWSB 2XP8A 4ZS6A 1NWRA 4KQZA 1RP5A 1LL4A 1JNDA 4ZPWR 1UR9A 2YBUA 4J4NA 4NZCA 5HKGA 2M2AA 4DRHA 2DK7A 5E64A 4TX0A 1LQ0A 4A0TA 3PRDA 2LAJA 1FJDA 4DWSA 4Z2LA 1QPLA 4E5RA 1FFQA 2DT3A 1PINA 3CHEA 1HKKA 3G6MA 2LKNA 4MPKA 1FKRA 3PQHA 3KCEA 4LAVA 2ZR6A 3TCZA 3O5IA 2MF9A 2IUZA 1H0IA 5HTGA 1HJXA 3PRAA 3WIJA 1WNOA 2B5UB 2MLYA 2DG4A 5DITA 3FY1A 3AROA 1HKMA 2BA1A 1EDQA 3NRKA 3PRBA 4TNSA 4TW6A 3MQHA 3WL1A 2M3OW 2KFWA 4WJXA 3IK8A 3KAFA 3GU0A 4P8UA 1YATA 4FAPA 1ITXA 1ZBVA 2DT0A 3M85A 3AQUA 4ODQA 2QF8A 4P8XA 5HBFA 4ODLA 3GPKA 2XP3A 2WLZA 4MNKA 2ESCA 1ROUA 2KO7A 1ZCNA 1E9LA 1FKJA 2RUQA 2KGJA 1R9HA 3CHFA 1J6YA 4R0XA 4MNLA 4WIWA 2L2SA 2YSHA 2FAPA 2MNTA 2M08A 4WKHA 4U85A 2PN0A 2YAJB 3I6CA 1SYTA 2DT1A 4HBOA 1VF8A 4XAKA 1SR0A 4C02B 2RUCA 1FKDA 2OFNA 4NNRA 4TW7A 1Q1CA 1J4RA 3M7NA 1E6RA 2AWGA 3QOKA 1KT0A 5DIVA 5GPGA 4DWSC 3BMBA 4DRJA 3UQBA 2DWVA 1UR8A 2OLHA 4TW8A 2VN1A 2WADA 2ZAJA 2JXWA 4U86A 1FKLA 1X6NA 1WB0A 4GLXA 2YSGA 2N87A 3ARXA 2WM0A 1JNSA 3TC5A 5D75A 2DSWA 4Z2HA 1QZ2A 2PBCA 1HJWA 1GOIA 3RFWA 4ODOA 3UQIA 3FS8A 1A7XA 4MGVA 2LPVA 3O5EA 4DRNA 3PA7A 3ARUA 3CZ8A 3JYJA 4G50A 2A3EA 4ODKA 4W9OA 1HXVA 2PPNA 4W5UA 4W9PA 1WMVA 1NSGA 3CHDA 3L4HA 1W1VA 1D2KA 3ALFA 2F23A 3MDYB 4MNJA 4DT4A 2A3AA 4QT2A 1FKBA 2ITKA 2KXQA 4LGXA 3WQVA 4DRPA 4Q7NA 1Y0OA 2ZQVA 3EIPA 1E6ZA 3AS0A 2RSEA 3ARWA 1BKFA 5HW6A 4W9QA 2DSUA 4IQ2A 1NH6A 1XRVA 2Q5AA 3WH0A 1Q6IA 3CGNA 2E45A 1RD6A 3NTPA 3RM8A 2JZVA 1GUVA 2WK2A 4ODNA 4ZPVR 1W9VA 3UI6A 3KAHA 5HW8A 5J6EA 4O2TA 1JNEA 3O5OA 1ZK6A 4DZ2A 5E62A 3WD4A 1WAWA 4Z2KA 4HARA 1WR7A 2WLYA 2XP9A 1ZB5A 4JFIA 2FKEA 2KR7A 1X6LA 2P4VA 3MCBA 5DF0A 4IPXA 1FD9A 1F40A 3PR9A 2YSIA 4IQCA 2UZ5A 3ODKA 1E15A 5CQ2A 4URIA 3IKGA 1H0GA 4A0UA 3CGMA 1JCHB 3FXYA 2AOSA 3O5QA 3ARZA 4Z2JA 4KR0B 4R5EA 3KZ7A 2DG9A 2ZQUA 4LAWA 3FSCA 5HWBA 1T11A 1LJYA 1NWTA 2QRVA 1I5HW 1QPFA 4HBEA 3O5GA 4DH0A 3KADA 1LL6A 2F21A 4P8VA 1XHGA 4DRIA 1HKIA 4JFLA 2XP4A 2F2DA 2DJYA 3ARPA 3ARRA 1LG2A 2MLZA 3O5LA 3RM4A 3GTYX 2YSBA 3WD0A 2XP6A 2VCDA 1E6PA 1F8AB 4TYOA 1EG3A 3CH9A 4GIVA 4DZ3A 2PPPA 2ETNA 2G8ZA 3WKZA 4QIBA 4MAVA 2OWOA 4JFMA 2DG3A 3ARYA 4S3KA 4DROA 3LKXA 2PI6A 5U47A 1HJVA 3WD3A 3KACA 4Q22A 1NWSA 4N19A 4J4OA 1O6IA 2JX8A 3JYMA 1EYMA 5I98A 1JNTA 4P8WA 3UI5A 1JMQA 4QT3A 3B8SA 3RMEA 4FN2A 1ZBKA 4ZPTR 2ZQSA 3LUOA 5DIUA 2XPBA 3ARQA 3O5PA 2M8JA 5HWCA 3O5DA 1K9TA 3FAPA 1ZL1A 2Y8NB 5HT1A 4IT4A 2IF4A 4GGQA 1W1PA 2DPEA 4AY1A 1Q6HA 5DEZA 1ROTA 4LAYA 3O5MA 3ARTA 5HW7A 1TK7A 3B7XA 3KAGA 2XP5A 4PTMA 3WL0A 4JYSA 1EHNA 3CNGA 5B8IC 3KABA 2LGOA 2G41A 5JH8A 1TCOC 2RE3A 4ODRA 4DWSD 2MPHA 3AS1A 3WD2A 2PV2A 2JV4A 1EIBA 1NWUA 3UQAA 1W9PA 4ODPA 1E6NA 2XP7A 2DK1A 3RGCA 3MQGA 4DIPA 3MCBB 2RUDA 4S3JA 1FLCA 1OGBA 1K9RA 2DT2A 4WK9A 3EY6A 5E65A 4MTVA 2YBTA 4Z2IA 1TFVA 1W1YA 4QZVB 4JFKA 1D7JA 4DRKA 4U84A 1FKSA 4ITZA 1BL4A 1U79A 3ARSA 1KT1A 4UDMA 2EULA 1FFRA 3ARVA 2A3BA 2A3CA 3LE4A 3KAIA 1EG4A 4L3NA 1FKHA 1GPFA 3TDBA 3IHZA
chains in the Genus database with same CATH topology
1HKJA 3O5JA 4MSPA 4ML4A 1KFWA 4WKFA 2DSZA 1FKTA 1N1AA 3H9RB 3AS2A 4Z2GA 1CTNA 3OOBA 1FAPA 2Y78A 1JVWA 1NMVA 3NI6A 1B6CA 2M8IA 5GQBA 2LJ4A 4ODMA 2KE0A 2DMVA 1D7IA 1D7HA 4DRQA 2MDIA 4NSBA 3LKXB 2F4EA 4G2PA 4DRMA 1LG1A 3FSBA 1FKIA 3AS3A 3WD1A 1IX5A 1C9HA 5AHTA 2YSFA 2L4JA 1ZBCA 4IT6A 2D9FA 3W4RA 1OWQA 3G6LA 4WKAA 4MNMA 2WAEA 5BXJA 3VAWA 2XPAA 2PPOA 1NMWA 1Q6UA 2ZQTA 1K9QA 2RURA 2ZR4A 2B31A 2KI3A 3JXVA 2MLXA 3O5RA 1LL7A 3IKDA 2EZ5W 1J4IA 2O9OA 5E5WA 1J4HA 1TR8A 2RQSA 3B9AA 1EQ3A 3UI4A 1W1TA 5HUAA 4JFJA 3BXWA 3B9DA 4REXA 2DSVA 2O92A 1O6WA 5E66A 1FKGA 1PBKA 2K8IA 1ZU8A 1W9UA 5DO2A 2FDMA 5GPRA 3UF8A 2JMFA 1L1PA 1OGGA 1FKFA 1W26A 1YW5A 3B9EA 3OA5A 1FKKA 1M5YA 3O5KA 1P5QA 3O5FA 4BF8A 2ZR5A 1ZBWA 4L72B 3CHCA 2PV1A 4LAXA 2M1IA 3ALGA 1D6OA 2PV3A 3RM9A 3WQWA 4DWSB 2XP8A 4ZS6A 1NWRA 4KQZA 1RP5A 1LL4A 1JNDA 4ZPWR 1UR9A 2YBUA 4J4NA 4NZCA 5HKGA 2M2AA 4DRHA 2DK7A 5E64A 4TX0A 1LQ0A 4A0TA 3PRDA 2LAJA 1FJDA 4DWSA 4Z2LA 1QPLA 4E5RA 1FFQA 2DT3A 1PINA 3CHEA 1HKKA 3G6MA 2LKNA 4MPKA 1FKRA 3PQHA 3KCEA 4LAVA 2ZR6A 3TCZA 3O5IA 2MF9A 2IUZA 1H0IA 5HTGA 1HJXA 3PRAA 3WIJA 1WNOA 2MLYA 2DG4A 5DITA 3FY1A 3AROA 1HKMA 2BA1A 1EDQA 3NRKA 3PRBA 4TNSA 4TW6A 3MQHA 3WL1A 2M3OW 2KFWA 4WJXA 3IK8A 3KAFA 4P8UA 1YATA 4FAPA 1ITXA 1ZBVA 2DT0A 3M85A 3AQUA 4ODQA 2QF8A 4P8XA 5HBFA 4ODLA 3GPKA 2XP3A 2WLZA 4MNKA 2ESCA 1ROUA 2KO7A 1ZCNA 1E9LA 1FKJA 2RUQA 2KGJA 1R9HA 3CHFA 1J6YA 4R0XA 4MNLA 4WIWA 2L2SA 2YSHA 2FAPA 2MNTA 2M08A 4WKHA 4U85A 2YAJB 3I6CA 1SYTA 2DT1A 4HBOA 1VF8A 4XAKA 1SR0A 4C02B 2RUCA 1FKDA 2OFNA 4NNRA 4TW7A 1Q1CA 1J4RA 3M7NA 1E6RA 2AWGA 3QOKA 1KT0A 5DIVA 5GPGA 4DWSC 4DRJA 3UQBA 2DWVA 1UR8A 2OLHA 4TW8A 2VN1A 2WADA 2ZAJA 2JXWA 4U86A 1FKLA 1X6NA 1WB0A 4GLXA 2YSGA 2N87A 3ARXA 2WM0A 1JNSA 3TC5A 5D75A 2DSWA 4Z2HA 1QZ2A 2PBCA 1HJWA 1GOIA 3RFWA 4ODOA 3UQIA 3FS8A 1A7XA 4MGVA 2LPVA 3O5EA 4DRNA 3PA7A 3ARUA 3CZ8A 3JYJA 4G50A 2A3EA 4ODKA 4W9OA 1HXVA 2PPNA 4W5UA 4W9PA 1WMVA 1NSGA 3CHDA 3L4HA 1W1VA 1D2KA 3ALFA 3MDYB 4MNJA 4DT4A 2A3AA 4QT2A 1FKBA 2ITKA 2KXQA 4LGXA 3WQVA 4DRPA 4Q7NA 1Y0OA 2ZQVA 1E6ZA 3AS0A 2RSEA 3ARWA 1BKFA 5HW6A 4W9QA 2DSUA 4IQ2A 1NH6A 1XRVA 2Q5AA 3WH0A 1Q6IA 3CGNA 2E45A 1RD6A 3NTPA 3RM8A 2JZVA 1GUVA 2WK2A 4ODNA 4ZPVR 1W9VA 3UI6A 3KAHA 5HW8A 5J6EA 4O2TA 1JNEA 3O5OA 1ZK6A 4DZ2A 5E62A 3WD4A 1WAWA 4Z2KA 4HARA 1WR7A 2WLYA 2XP9A 1ZB5A 4JFIA 2FKEA 2KR7A 1X6LA 3MCBA 5DF0A 4IPXA 1FD9A 1F40A 3PR9A 2YSIA 4IQCA 2UZ5A 3ODKA 1E15A 5CQ2A 4URIA 3IKGA 1H0GA 4A0UA 3CGMA 3FXYA 2AOSA 3O5QA 3ARZA 4Z2JA 4KR0B 4R5EA 3KZ7A 2DG9A 2ZQUA 4LAWA 3FSCA 5HWBA 1T11A 1LJYA 1NWTA 2QRVA 1I5HW 1QPFA 4HBEA 3O5GA 4DH0A 3KADA 1LL6A 2F21A 4P8VA 1XHGA 4DRIA 1HKIA 4JFLA 2XP4A 2F2DA 2DJYA 3ARPA 3ARRA 1LG2A 2MLZA 3O5LA 3RM4A 2YSBA 3WD0A 2XP6A 2VCDA 1E6PA 1F8AB 4TYOA 1EG3A 3CH9A 4GIVA 4DZ3A 2PPPA 2G8ZA 3WKZA 4QIBA 4MAVA 2OWOA 4JFMA 2DG3A 3ARYA 4S3KA 4DROA 3LKXA 2PI6A 5U47A 1HJVA 3WD3A 3KACA 4Q22A 1NWSA 4N19A 4J4OA 1O6IA 2JX8A 3JYMA 1EYMA 5I98A 1JNTA 4P8WA 3UI5A 1JMQA 4QT3A 3B8SA 3RMEA 4FN2A 1ZBKA 4ZPTR 2ZQSA 3LUOA 5DIUA 2XPBA 3ARQA 3O5PA 2M8JA 5HWCA 3O5DA 1K9TA 3FAPA 1ZL1A 2Y8NB 5HT1A 4IT4A 2IF4A 4GGQA 1W1PA 2DPEA 4AY1A 1Q6HA 5DEZA 1ROTA 4LAYA 3O5MA 3ARTA 5HW7A 1TK7A 3B7XA 3KAGA 2XP5A 4PTMA 3WL0A 4JYSA 1EHNA 3CNGA 5B8IC 3KABA 2LGOA 2G41A 5JH8A 1TCOC 2RE3A 4ODRA 4DWSD 2MPHA 3AS1A 3WD2A 2PV2A 2JV4A 1EIBA 1NWUA 3UQAA 1W9PA 4ODPA 1E6NA 2XP7A 2DK1A 3RGCA 3MQGA 4DIPA 3MCBB 2RUDA 4S3JA 1FLCA 1OGBA 1K9RA 2DT2A 4WK9A 3EY6A 5E65A 4MTVA 2YBTA 4Z2IA 1TFVA 1W1YA 4QZVB 4JFKA 1D7JA 4DRKA 4U84A 1FKSA 4ITZA 1BL4A 1U79A 3ARSA 1KT1A 1FFRA 3ARVA 2A3BA 2A3CA 3LE4A 3KAIA 1EG4A 4L3NA 1FKHA 1GPFA 3TDBA 3IHZA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3O5J A;  4MSP A;  1FKT A;  1N1A A;  3H9R B;  3OOB A;  1FAP A;  2Y78 A;  1JVW A;  1NMV A;  3NI6 A;  1B6C A;  2M8I A;  2LJ4 A;  4ODM A;  2KE0 A;  2DMV A;  1D7I A;  1D7H A;  4DRQ A;  2MDI A;  2F4E A;  4G2P A;  4DRM A;  1FKI A;  1C9H A;  5AHT A;  2YSF A;  2L4J A;  2D9F A;  5BXJ A;  3VAW A;  2XPA A;  2PPO A;  1NMW A;  1Q6U A;  2ZQT A;  1K9Q A;  2RUR A;  2ZR4 A;  2KI3 A;  3JXV A;  2MLX A;  3O5R A;  3IKD A;  2EZ5 W;  1J4I A;  1J4H A;  2RQS A;  1EQ3 A;  3UI4 A;  5HUA A;  4JFJ A;  4REX A;  1O6W A;  1FKG A;  1PBK A;  2K8I A;  3UF8 A;  2JMF A;  1L1P A;  1FKF A;  1W26 A;  1YW5 A;  1FKK A;  1M5Y A;  3O5K A;  1P5Q A;  3O5F A;  4BF8 A;  2ZR5 A;  2PV1 A;  4LAX A;  2M1I A;  1D6O A;  2PV3 A;  2XP8 A;  4J4N A;  5HKG A;  2M2A A;  4DRH A;  2DK7 A;  4TX0 A;  3PRD A;  2LAJ A;  1FJD A;  1QPL A;  4E5R A;  1PIN A;  2LKN A;  1FKR A;  4LAV A;  3KCE A;  2ZR6 A;  3TCZ A;  3O5I A;  2MF9 A;  5HTG A;  2MLY A;  2DG4 A;  5DIT A;  3PRB A;  2BA1 A;  3NRK A;  4TNS A;  4TW6 A;  2M3O W;  2KFW A;  3IK8 A;  3KAF A;  1YAT A;  4FAP A;  3M85 A;  4ODQ A;  4ODL A;  3GPK A;  2XP3 A;  1ROU A;  2KO7 A;  1ZCN A;  1FKJ A;  2RUQ A;  2KGJ A;  1R9H A;  1J6Y A;  4R0X A;  2L2S A;  2YSH A;  2FAP A;  2MNT A;  2M08 A;  4U85 A;  3I6C A;  4C02 B;  2RUC A;  1FKD A;  2OFN A;  4NNR A;  4TW7 A;  1Q1C A;  1J4R A;  3M7N A;  2AWG A;  5DIV A;  1KT0 A;  5GPG A;  4DRJ A;  3UQB A;  2DWV A;  4TW8 A;  2VN1 A;  2ZAJ A;  2JXW A;  4U86 A;  1FKL A;  2YSG A;  2N87 A;  1JNS A;  3TC5 A;  5D75 A;  1QZ2 A;  2PBC A;  3RFW A;  4ODO A;  3UQI A;  1A7X A;  4MGV A;  2LPV A;  3O5E A;  4DRN A;  3PA7 A;  3JYJ A;  4G50 A;  4ODK A;  4W9O A;  1HXV A;  2PPN A;  4W9P A;  1WMV A;  1NSG A;  3L4H A;  3MDY B;  4DT4 A;  4QT2 A;  1FKB A;  2ITK A;  2KXQ A;  4DRP A;  1Y0O A;  2ZQV A;  2RSE A;  1BKF A;  5HW6 A;  4W9Q A;  4IQ2 A;  2Q5A A;  3WH0 A;  1Q6I A;  3CGN A;  2E45 A;  3NTP A;  2JZV A;  4ODN A;  3UI6 A;  3KAH A;  5HW8 A;  5J6E A;  4O2T A;  3O5O A;  1ZK6 A;  4DZ2 A;  1WR7 A;  2XP9 A;  4JFI A;  2FKE A;  2KR7 A;  4IPX A;  1FD9 A;  1F40 A;  2YSI A;  4IQC A;  2UZ5 A;  3ODK A;  5CQ2 A;  3IKG A;  3CGM A;  3O5Q A;  3KZ7 A;  2DG9 A;  2ZQU A;  4LAW A;  5HWB A;  1T11 A;  1I5H W;  1QPF A;  3O5G A;  4DH0 A;  3KAD A;  2F21 A;  4DRI A;  4JFL A;  2XP4 A;  2F2D A;  2DJY A;  3O5L A;  2MLZ A;  2YSB A;  2XP6 A;  2VCD A;  4TYO A;  1F8A B;  1EG3 A;  4GIV A;  4DZ3 A;  2PPP A;  4QIB A;  4JFM A;  2DG3 A;  4DRO A;  3KAC A;  4N19 A;  4J4O A;  2JX8 A;  3JYM A;  1EYM A;  5I98 A;  1JNT A;  3UI5 A;  1JMQ A;  4QT3 A;  4FN2 A;  2ZQS A;  3LUO A;  5DIU A;  2XPB A;  3O5P A;  2M8J A;  5HWC A;  3O5D A;  3FAP A;  5HT1 A;  2IF4 A;  4GGQ A;  1Q6H A;  1ROT A;  4LAY A;  3O5M A;  5HW7 A;  1TK7 A;  3B7X A;  3KAG A;  2XP5 A;  4JYS A;  3CNG A;  5B8I C;  3KAB A;  2LGO A;  1TCO C;  2RE3 A;  4ODR A;  2MPH A;  2PV2 A;  2JV4 A;  3UQA A;  4ODP A;  2XP7 A;  2DK1 A;  3RGC A;  4DIP A;  2RUD A;  1K9R A;  3EY6 A;  4JFK A;  4DRK A;  1D7J A;  4U84 A;  1FKS A;  4ITZ A;  1BL4 A;  1U79 A;  1KT1 A;  3LE4 A;  3KAI A;  1EG4 A;  1FKH A;  3TDB A;  3IHZ A; 
#chains in the Genus database with same CATH topology
 1HKJ A;  3O5J A;  4MSP A;  4ML4 A;  1KFW A;  4WKF A;  2DSZ A;  1FKT A;  1N1A A;  3H9R B;  3AS2 A;  4Z2G A;  1CTN A;  3OOB A;  1FAP A;  2Y78 A;  1JVW A;  1NMV A;  3NI6 A;  1B6C A;  2M8I A;  5GQB A;  2LJ4 A;  4ODM A;  2KE0 A;  2DMV A;  1D7I A;  1D7H A;  4DRQ A;  2MDI A;  4NSB A;  3LKX B;  1GRJ A;  2F4E A;  4G2P A;  4DRM A;  1LG1 A;  3FSB A;  1FKI A;  3AS3 A;  3WD1 A;  1IX5 A;  1C9H A;  5AHT A;  2YSF A;  2L4J A;  1ZBC A;  4IT6 A;  2D9F A;  3W4R A;  1OWQ A;  3G6L A;  4WKA A;  4MNM A;  2WAE A;  5BXJ A;  3VAW A;  2XPA A;  2PPO A;  1NMW A;  1Q6U A;  2ZQT A;  1K9Q A;  2RUR A;  2ZR4 A;  2B31 A;  2KI3 A;  3JXV A;  2MLX A;  3O5R A;  1LL7 A;  3IKD A;  2EZ5 W;  1J4I A;  2O9O A;  5E5W A;  1J4H A;  1TR8 A;  2RQS A;  3B9A A;  1EQ3 A;  3UI4 A;  1W1T A;  5HUA A;  4JFJ A;  3BXW A;  3B9D A;  4REX A;  2DSV A;  2O92 A;  1O6W A;  5E66 A;  1FKG A;  1PBK A;  2K8I A;  1ZU8 A;  1W9U A;  5DO2 A;  2FDM A;  5GPR A;  3UF8 A;  2JMF A;  1L1P A;  1OGG A;  1FKF A;  1W26 A;  1YW5 A;  3B9E A;  3OA5 A;  1FKK A;  1M5Y A;  3O5K A;  1P5Q A;  3O5F A;  4BF8 A;  2ZR5 A;  1ZBW A;  4L72 B;  3CHC A;  1E44 A;  2PV1 A;  4LAX A;  2M1I A;  3ALG A;  1D6O A;  2PV3 A;  3RM9 A;  3WQW A;  4DWS B;  2XP8 A;  4ZS6 A;  1NWR A;  4KQZ A;  1RP5 A;  1LL4 A;  1JND A;  4ZPW R;  1UR9 A;  2YBU A;  4J4N A;  4NZC A;  5HKG A;  2M2A A;  4DRH A;  2DK7 A;  5E64 A;  4TX0 A;  1LQ0 A;  4A0T A;  3PRD A;  2LAJ A;  1FJD A;  4DWS A;  4Z2L A;  1QPL A;  4E5R A;  1FFQ A;  2DT3 A;  1PIN A;  3CHE A;  1HKK A;  3G6M A;  2LKN A;  4MPK A;  1FKR A;  3PQH A;  3KCE A;  4LAV A;  2ZR6 A;  3TCZ A;  3O5I A;  2MF9 A;  2IUZ A;  1H0I A;  5HTG A;  1HJX A;  3PRA A;  3WIJ A;  1WNO A;  2B5U B;  2MLY A;  2DG4 A;  5DIT A;  3FY1 A;  3ARO A;  1HKM A;  2BA1 A;  1EDQ A;  3NRK A;  3PRB A;  4TNS A;  4TW6 A;  3MQH A;  3WL1 A;  2M3O W;  2KFW A;  4WJX A;  3IK8 A;  3KAF A;  3GU0 A;  4P8U A;  1YAT A;  4FAP A;  1ITX A;  1ZBV A;  2DT0 A;  3M85 A;  3AQU A;  4ODQ A;  2QF8 A;  4P8X A;  5HBF A;  4ODL A;  3GPK A;  2XP3 A;  2WLZ A;  4MNK A;  2ESC A;  1ROU A;  2KO7 A;  1ZCN A;  1E9L A;  1FKJ A;  2RUQ A;  2KGJ A;  1R9H A;  3CHF A;  1J6Y A;  4R0X A;  4MNL A;  4WIW A;  2L2S A;  2YSH A;  2FAP A;  2MNT A;  2M08 A;  4WKH A;  4U85 A;  2PN0 A;  2YAJ B;  3I6C A;  1SYT A;  2DT1 A;  4HBO A;  1VF8 A;  4XAK A;  1SR0 A;  4C02 B;  2RUC A;  1FKD A;  2OFN A;  4NNR A;  4TW7 A;  1Q1C A;  1J4R A;  3M7N A;  1E6R A;  2AWG A;  3QOK A;  1KT0 A;  5DIV A;  5GPG A;  4DWS C;  3BMB A;  4DRJ A;  3UQB A;  2DWV A;  1UR8 A;  2OLH A;  4TW8 A;  2VN1 A;  2WAD A;  2ZAJ A;  2JXW A;  4U86 A;  1FKL A;  1X6N A;  1WB0 A;  4GLX A;  2YSG A;  2N87 A;  3ARX A;  2WM0 A;  1JNS A;  3TC5 A;  5D75 A;  2DSW A;  4Z2H A;  1QZ2 A;  2PBC A;  1HJW A;  1GOI A;  3RFW A;  4ODO A;  3UQI A;  3FS8 A;  1A7X A;  4MGV A;  2LPV A;  3O5E A;  4DRN A;  3PA7 A;  3ARU A;  3CZ8 A;  3JYJ A;  4G50 A;  2A3E A;  4ODK A;  4W9O A;  1HXV A;  2PPN A;  4W5U A;  4W9P A;  1WMV A;  1NSG A;  3CHD A;  3L4H A;  1W1V A;  1D2K A;  3ALF A;  2F23 A;  3MDY B;  4MNJ A;  4DT4 A;  2A3A A;  4QT2 A;  1FKB A;  2ITK A;  2KXQ A;  4LGX A;  3WQV A;  4DRP A;  4Q7N A;  1Y0O A;  2ZQV A;  3EIP A;  1E6Z A;  3AS0 A;  2RSE A;  3ARW A;  1BKF A;  5HW6 A;  4W9Q A;  2DSU A;  4IQ2 A;  1NH6 A;  1XRV A;  2Q5A A;  3WH0 A;  1Q6I A;  3CGN A;  2E45 A;  1RD6 A;  3NTP A;  3RM8 A;  2JZV A;  1GUV A;  2WK2 A;  4ODN A;  4ZPV R;  1W9V A;  3UI6 A;  3KAH A;  5HW8 A;  5J6E A;  4O2T A;  1JNE A;  3O5O A;  1ZK6 A;  4DZ2 A;  5E62 A;  3WD4 A;  1WAW A;  4Z2K A;  4HAR A;  1WR7 A;  2WLY A;  2XP9 A;  1ZB5 A;  4JFI A;  2FKE A;  2KR7 A;  1X6L A;  2P4V A;  3MCB A;  5DF0 A;  4IPX A;  1FD9 A;  1F40 A;  3PR9 A;  2YSI A;  4IQC A;  2UZ5 A;  3ODK A;  1E15 A;  5CQ2 A;  4URI A;  3IKG A;  1H0G A;  4A0U A;  3CGM A;  1JCH B;  3FXY A;  2AOS A;  3O5Q A;  3ARZ A;  4Z2J A;  4KR0 B;  4R5E A;  3KZ7 A;  2DG9 A;  2ZQU A;  4LAW A;  3FSC A;  5HWB A;  1T11 A;  1LJY A;  1NWT A;  2QRV A;  1I5H W;  1QPF A;  4HBE A;  3O5G A;  4DH0 A;  3KAD A;  1LL6 A;  2F21 A;  4P8V A;  1XHG A;  4DRI A;  1HKI A;  4JFL A;  2XP4 A;  2F2D A;  2DJY A;  3ARP A;  3ARR A;  1LG2 A;  2MLZ A;  3O5L A;  3RM4 A;  3GTY X;  2YSB A;  3WD0 A;  2XP6 A;  2VCD A;  1E6P A;  1F8A B;  4TYO A;  1EG3 A;  3CH9 A;  4GIV A;  4DZ3 A;  2PPP A;  2ETN A;  2G8Z A;  3WKZ A;  4QIB A;  4MAV A;  2OWO A;  4JFM A;  2DG3 A;  3ARY A;  4S3K A;  4DRO A;  3LKX A;  2PI6 A;  5U47 A;  1HJV A;  3WD3 A;  3KAC A;  4Q22 A;  1NWS A;  4N19 A;  4J4O A;  1O6I A;  2JX8 A;  3JYM A;  1EYM A;  5I98 A;  1JNT A;  4P8W A;  3UI5 A;  1JMQ A;  4QT3 A;  3B8S A;  3RME A;  4FN2 A;  1ZBK A;  4ZPT R;  2ZQS A;  3LUO A;  5DIU A;  2XPB A;  3ARQ A;  3O5P A;  2M8J A;  5HWC A;  3O5D A;  1K9T A;  3FAP A;  1ZL1 A;  2Y8N B;  5HT1 A;  4IT4 A;  2IF4 A;  4GGQ A;  1W1P A;  2DPE A;  4AY1 A;  1Q6H A;  5DEZ A;  1ROT A;  4LAY A;  3O5M A;  3ART A;  5HW7 A;  1TK7 A;  3B7X A;  3KAG A;  2XP5 A;  4PTM A;  3WL0 A;  4JYS A;  1EHN A;  3CNG A;  5B8I C;  3KAB A;  2LGO A;  2G41 A;  5JH8 A;  1TCO C;  2RE3 A;  4ODR A;  4DWS D;  2MPH A;  3AS1 A;  3WD2 A;  2PV2 A;  2JV4 A;  1EIB A;  1NWU A;  3UQA A;  1W9P A;  4ODP A;  1E6N A;  2XP7 A;  2DK1 A;  3RGC A;  3MQG A;  4DIP A;  3MCB B;  2RUD A;  4S3J A;  1FLC A;  1OGB A;  1K9R A;  2DT2 A;  4WK9 A;  3EY6 A;  5E65 A;  4MTV A;  2YBT A;  4Z2I A;  1TFV A;  1W1Y A;  4QZV B;  4JFK A;  1D7J A;  4DRK A;  4U84 A;  1FKS A;  4ITZ A;  1BL4 A;  1U79 A;  3ARS A;  1KT1 A;  4UDM A;  2EUL A;  1FFR A;  3ARV A;  2A3B A;  2A3C A;  3LE4 A;  3KAI A;  1EG4 A;  4L3N A;  1FKH A;  1GPF A;  3TDB A;  3IHZ A; 
#chains in the Genus database with same CATH homology
 1HKJ A;  3O5J A;  4MSP A;  4ML4 A;  1KFW A;  4WKF A;  2DSZ A;  1FKT A;  1N1A A;  3H9R B;  3AS2 A;  4Z2G A;  1CTN A;  3OOB A;  1FAP A;  2Y78 A;  1JVW A;  1NMV A;  3NI6 A;  1B6C A;  2M8I A;  5GQB A;  2LJ4 A;  4ODM A;  2KE0 A;  2DMV A;  1D7I A;  1D7H A;  4DRQ A;  2MDI A;  4NSB A;  3LKX B;  2F4E A;  4G2P A;  4DRM A;  1LG1 A;  3FSB A;  1FKI A;  3AS3 A;  3WD1 A;  1IX5 A;  1C9H A;  5AHT A;  2YSF A;  2L4J A;  1ZBC A;  4IT6 A;  2D9F A;  3W4R A;  1OWQ A;  3G6L A;  4WKA A;  4MNM A;  2WAE A;  5BXJ A;  3VAW A;  2XPA A;  2PPO A;  1NMW A;  1Q6U A;  2ZQT A;  1K9Q A;  2RUR A;  2ZR4 A;  2B31 A;  2KI3 A;  3JXV A;  2MLX A;  3O5R A;  1LL7 A;  3IKD A;  2EZ5 W;  1J4I A;  2O9O A;  5E5W A;  1J4H A;  1TR8 A;  2RQS A;  3B9A A;  1EQ3 A;  3UI4 A;  1W1T A;  5HUA A;  4JFJ A;  3BXW A;  3B9D A;  4REX A;  2DSV A;  2O92 A;  1O6W A;  5E66 A;  1FKG A;  1PBK A;  2K8I A;  1ZU8 A;  1W9U A;  5DO2 A;  2FDM A;  5GPR A;  3UF8 A;  2JMF A;  1L1P A;  1OGG A;  1FKF A;  1W26 A;  1YW5 A;  3B9E A;  3OA5 A;  1FKK A;  1M5Y A;  3O5K A;  1P5Q A;  3O5F A;  4BF8 A;  2ZR5 A;  1ZBW A;  4L72 B;  3CHC A;  2PV1 A;  4LAX A;  2M1I A;  3ALG A;  1D6O A;  2PV3 A;  3RM9 A;  3WQW A;  4DWS B;  2XP8 A;  4ZS6 A;  1NWR A;  4KQZ A;  1RP5 A;  1LL4 A;  1JND A;  4ZPW R;  1UR9 A;  2YBU A;  4J4N A;  4NZC A;  5HKG A;  2M2A A;  4DRH A;  2DK7 A;  5E64 A;  4TX0 A;  1LQ0 A;  4A0T A;  3PRD A;  2LAJ A;  1FJD A;  4DWS A;  4Z2L A;  1QPL A;  4E5R A;  1FFQ A;  2DT3 A;  1PIN A;  3CHE A;  1HKK A;  3G6M A;  2LKN A;  4MPK A;  1FKR A;  3PQH A;  3KCE A;  4LAV A;  2ZR6 A;  3TCZ A;  3O5I A;  2MF9 A;  2IUZ A;  1H0I A;  5HTG A;  1HJX A;  3PRA A;  3WIJ A;  1WNO A;  2MLY A;  2DG4 A;  5DIT A;  3FY1 A;  3ARO A;  1HKM A;  2BA1 A;  1EDQ A;  3NRK A;  3PRB A;  4TNS A;  4TW6 A;  3MQH A;  3WL1 A;  2M3O W;  2KFW A;  4WJX A;  3IK8 A;  3KAF A;  4P8U A;  1YAT A;  4FAP A;  1ITX A;  1ZBV A;  2DT0 A;  3M85 A;  3AQU A;  4ODQ A;  2QF8 A;  4P8X A;  5HBF A;  4ODL A;  3GPK A;  2XP3 A;  2WLZ A;  4MNK A;  2ESC A;  1ROU A;  2KO7 A;  1ZCN A;  1E9L A;  1FKJ A;  2RUQ A;  2KGJ A;  1R9H A;  3CHF A;  1J6Y A;  4R0X A;  4MNL A;  4WIW A;  2L2S A;  2YSH A;  2FAP A;  2MNT A;  2M08 A;  4WKH A;  4U85 A;  2YAJ B;  3I6C A;  1SYT A;  2DT1 A;  4HBO A;  1VF8 A;  4XAK A;  1SR0 A;  4C02 B;  2RUC A;  1FKD A;  2OFN A;  4NNR A;  4TW7 A;  1Q1C A;  1J4R A;  3M7N A;  1E6R A;  2AWG A;  3QOK A;  1KT0 A;  5DIV A;  5GPG A;  4DWS C;  4DRJ A;  3UQB A;  2DWV A;  1UR8 A;  2OLH A;  4TW8 A;  2VN1 A;  2WAD A;  2ZAJ A;  2JXW A;  4U86 A;  1FKL A;  1X6N A;  1WB0 A;  4GLX A;  2YSG A;  2N87 A;  3ARX A;  2WM0 A;  1JNS A;  3TC5 A;  5D75 A;  2DSW A;  4Z2H A;  1QZ2 A;  2PBC A;  1HJW A;  1GOI A;  3RFW A;  4ODO A;  3UQI A;  3FS8 A;  1A7X A;  4MGV A;  2LPV A;  3O5E A;  4DRN A;  3PA7 A;  3ARU A;  3CZ8 A;  3JYJ A;  4G50 A;  2A3E A;  4ODK A;  4W9O A;  1HXV A;  2PPN A;  4W5U A;  4W9P A;  1WMV A;  1NSG A;  3CHD A;  3L4H A;  1W1V A;  1D2K A;  3ALF A;  3MDY B;  4MNJ A;  4DT4 A;  2A3A A;  4QT2 A;  1FKB A;  2ITK A;  2KXQ A;  4LGX A;  3WQV A;  4DRP A;  4Q7N A;  1Y0O A;  2ZQV A;  1E6Z A;  3AS0 A;  2RSE A;  3ARW A;  1BKF A;  5HW6 A;  4W9Q A;  2DSU A;  4IQ2 A;  1NH6 A;  1XRV A;  2Q5A A;  3WH0 A;  1Q6I A;  3CGN A;  2E45 A;  1RD6 A;  3NTP A;  3RM8 A;  2JZV A;  1GUV A;  2WK2 A;  4ODN A;  4ZPV R;  1W9V A;  3UI6 A;  3KAH A;  5HW8 A;  5J6E A;  4O2T A;  1JNE A;  3O5O A;  1ZK6 A;  4DZ2 A;  5E62 A;  3WD4 A;  1WAW A;  4Z2K A;  4HAR A;  1WR7 A;  2WLY A;  2XP9 A;  1ZB5 A;  4JFI A;  2FKE A;  2KR7 A;  1X6L A;  3MCB A;  5DF0 A;  4IPX A;  1FD9 A;  1F40 A;  3PR9 A;  2YSI A;  4IQC A;  2UZ5 A;  3ODK A;  1E15 A;  5CQ2 A;  4URI A;  3IKG A;  1H0G A;  4A0U A;  3CGM A;  3FXY A;  2AOS A;  3O5Q A;  3ARZ A;  4Z2J A;  4KR0 B;  4R5E A;  3KZ7 A;  2DG9 A;  2ZQU A;  4LAW A;  3FSC A;  5HWB A;  1T11 A;  1LJY A;  1NWT A;  2QRV A;  1I5H W;  1QPF A;  4HBE A;  3O5G A;  4DH0 A;  3KAD A;  1LL6 A;  2F21 A;  4P8V A;  1XHG A;  4DRI A;  1HKI A;  4JFL A;  2XP4 A;  2F2D A;  2DJY A;  3ARP A;  3ARR A;  1LG2 A;  2MLZ A;  3O5L A;  3RM4 A;  2YSB A;  3WD0 A;  2XP6 A;  2VCD A;  1E6P A;  1F8A B;  4TYO A;  1EG3 A;  3CH9 A;  4GIV A;  4DZ3 A;  2PPP A;  2G8Z A;  3WKZ A;  4QIB A;  4MAV A;  2OWO A;  4JFM A;  2DG3 A;  3ARY A;  4S3K A;  4DRO A;  3LKX A;  2PI6 A;  5U47 A;  1HJV A;  3WD3 A;  3KAC A;  4Q22 A;  1NWS A;  4N19 A;  4J4O A;  1O6I A;  2JX8 A;  3JYM A;  1EYM A;  5I98 A;  1JNT A;  4P8W A;  3UI5 A;  1JMQ A;  4QT3 A;  3B8S A;  3RME A;  4FN2 A;  1ZBK A;  4ZPT R;  2ZQS A;  3LUO A;  5DIU A;  2XPB A;  3ARQ A;  3O5P A;  2M8J A;  5HWC A;  3O5D A;  1K9T A;  3FAP A;  1ZL1 A;  2Y8N B;  5HT1 A;  4IT4 A;  2IF4 A;  4GGQ A;  1W1P A;  2DPE A;  4AY1 A;  1Q6H A;  5DEZ A;  1ROT A;  4LAY A;  3O5M A;  3ART A;  5HW7 A;  1TK7 A;  3B7X A;  3KAG A;  2XP5 A;  4PTM A;  3WL0 A;  4JYS A;  1EHN A;  3CNG A;  5B8I C;  3KAB A;  2LGO A;  2G41 A;  5JH8 A;  1TCO C;  2RE3 A;  4ODR A;  4DWS D;  2MPH A;  3AS1 A;  3WD2 A;  2PV2 A;  2JV4 A;  1EIB A;  1NWU A;  3UQA A;  1W9P A;  4ODP A;  1E6N A;  2XP7 A;  2DK1 A;  3RGC A;  3MQG A;  4DIP A;  3MCB B;  2RUD A;  4S3J A;  1FLC A;  1OGB A;  1K9R A;  2DT2 A;  4WK9 A;  3EY6 A;  5E65 A;  4MTV A;  2YBT A;  4Z2I A;  1TFV A;  1W1Y A;  4QZV B;  4JFK A;  1D7J A;  4DRK A;  4U84 A;  1FKS A;  4ITZ A;  1BL4 A;  1U79 A;  3ARS A;  1KT1 A;  1FFR A;  3ARV A;  2A3B A;  2A3C A;  3LE4 A;  3KAI A;  1EG4 A;  4L3N A;  1FKH A;  1GPF A;  3TDB A;  3IHZ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...