2YSIA

Solution structure of the first ww domain from the mouse transcription elongation regulator 1, transcription factor ca150
Total Genus 1
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
1
sequence length
40
structure length
40
Chain Sequence
GSSGSSGTEEIWVENKTPDGKVYYYNARTRESAWTKPDGV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Transcription elongation regulator 1
publication title Solution structure of the first WW domain from the mouse transcription elongation regulator 1, transcription factor CA150
rcsb
source organism Mus musculus
molecule tags Protein binding
total genus 1
structure length 40
sequence length 40
ec nomenclature
pdb deposition date 2007-04-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00397 WW WW domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.20.70.10 Mainly Beta Single Sheet Ubiquitin Ligase Nedd4; Chain: W; Ubiquitin Ligase Nedd4; Chain: W; 2ysiA01
1K9RA 2JX8A 2ZR5A 3KAGA 2ITKA 2ZQUA 2XP6A 1F8AB 2XP9A 3KAFA 3KADA 4QIBA 1YW5A 2EZ5W 2M8IA 1I5HW 3TCZA 1EG4A 2F21A 2YSIA 3CNGA 4REXA 2LAJA 3TC5A 3TDBA 2XPAA 2ZQSA 1WMVA 2ZQVA 4U85A 3M85A 2DK7A 2YSGA 3ODKA 2L4JA 2XP8A 1JMQA 2ZAJA 2MDIA 5CQ2A 2DWVA 2XP3A 3NTPA 2YSBA 1K9QA 2E45A 2JMFA 2XPBA 3WH0A 3L4HA 2ZR6A 4U86A 2DK1A 5AHTA 2YSFA 1PINA 2DJYA 2Q5AA 3M7NA 1TK7A 2JXWA 4U84A 2XP4A 3KABA 2M8JA 3OOBA 4E5RA 3KAIA 2BA1A 1ZCNA 1NMVA 3KCEA 1O6WA 2JV4A 2ZR4A 1EG3A 2XP7A 3KAHA 2M3OW 2ZQTA 2RE3A 3LE4A 1WR7A 2KXQA 2XP5A 2DMVA 2YSHA
chains in the Genus database with same CATH superfamily
1K9RA 2JX8A 2ZR5A 3KAGA 2ITKA 2ZQUA 5E64A 2XP6A 1F8AB 2YAJB 2XP9A 3KAFA 3KADA 4QIBA 1YW5A 2EZ5W 2M8IA 1I5HW 3TCZA 1TR8A 3FSCA 5E66A 3PQHA 1EG4A 2WAEA 2F21A 5E65A 3MQHA 2YSIA 3CNGA 4REXA 2LAJA 3TC5A 3TDBA 2XPAA 4A0TA 2ZQSA 1WMVA 2ZQVA 3LKXA 4U85A 3M85A 3MCBA 2DK7A 2YSGA 3ODKA 3LKXB 2L4JA 2XP8A 3MQGA 1JMQA 2ZAJA 2MDIA 5CQ2A 2DWVA 2XP3A 3NTPA 2YSBA 1K9QA 5U47A 4GLXA 2E45A 2JMFA 2XPBA 3WH0A 3L4HA 2ZR6A 4U86A 2DK1A 5AHTA 2YSFA 5E5WA 1PINA 1RP5A 3FSBA 3MCBB 2DJYA 2Q5AA 3M7NA 1TK7A 2JXWA 4U84A 2XP4A 2Y8NB 2QRVA 2WADA 3KABA 5E62A 2M8JA 3OOBA 1FLCA 4E5RA 3KAIA 2BA1A 1ZCNA 1NMVA 3KCEA 1O6WA 2JV4A 2ZR4A 1EG3A 2XP7A 4A0UA 3KAHA 2M3OW 3FS8A 2ZQTA 2RE3A 3LE4A 2OWOA 1WR7A 2KXQA 2XP5A 2DMVA 2YSHA
chains in the Genus database with same CATH topology
1K9RA 2JX8A 2ZR5A 3KAGA 2ITKA 2ZQUA 5E64A 2XP6A 1F8AB 2YAJB 2XP9A 3KAFA 3KADA 4QIBA 1YW5A 2EZ5W 2M8IA 1I5HW 3TCZA 1TR8A 3FSCA 5E66A 3PQHA 1EG4A 2WAEA 2F21A 5E65A 3MQHA 2YSIA 3CNGA 4REXA 2LAJA 3TC5A 3TDBA 2XPAA 4A0TA 2ZQSA 1WMVA 2ZQVA 3LKXA 4U85A 3M85A 3MCBA 2DK7A 2YSGA 3ODKA 3LKXB 2L4JA 2XP8A 3MQGA 1JMQA 2ZAJA 2MDIA 5CQ2A 2DWVA 2XP3A 3NTPA 2YSBA 1K9QA 5U47A 4GLXA 2E45A 2JMFA 2XPBA 3WH0A 3L4HA 2ZR6A 4U86A 2DK1A 5AHTA 2YSFA 5E5WA 1PINA 1RP5A 3FSBA 3MCBB 2DJYA 2Q5AA 3M7NA 1TK7A 2JXWA 4U84A 2XP4A 2Y8NB 2QRVA 2WADA 3KABA 5E62A 2M8JA 3OOBA 1FLCA 4E5RA 3KAIA 2BA1A 1ZCNA 1NMVA 3KCEA 1O6WA 2JV4A 2ZR4A 1EG3A 2XP7A 4A0UA 3KAHA 2M3OW 3FS8A 2ZQTA 2RE3A 3LE4A 2OWOA 1WR7A 2KXQA 2XP5A 2DMVA 2YSHA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1K9R A;  2JX8 A;  2ZR5 A;  3KAG A;  2ITK A;  2ZQU A;  2XP6 A;  1F8A B;  2XP9 A;  3KAF A;  3KAD A;  4QIB A;  1YW5 A;  2EZ5 W;  2M8I A;  1I5H W;  3TCZ A;  1EG4 A;  2F21 A;  2YSI A;  3CNG A;  4REX A;  2LAJ A;  3TC5 A;  3TDB A;  2XPA A;  2ZQS A;  1WMV A;  2ZQV A;  4U85 A;  3M85 A;  2DK7 A;  2YSG A;  3ODK A;  2L4J A;  2XP8 A;  1JMQ A;  2ZAJ A;  2MDI A;  5CQ2 A;  2DWV A;  2XP3 A;  3NTP A;  2YSB A;  1K9Q A;  2E45 A;  2JMF A;  2XPB A;  3WH0 A;  3L4H A;  2ZR6 A;  4U86 A;  2DK1 A;  5AHT A;  2YSF A;  1PIN A;  2DJY A;  2Q5A A;  3M7N A;  1TK7 A;  2JXW A;  4U84 A;  2XP4 A;  3KAB A;  2M8J A;  3OOB A;  4E5R A;  3KAI A;  2BA1 A;  1ZCN A;  1NMV A;  3KCE A;  1O6W A;  2JV4 A;  2ZR4 A;  1EG3 A;  2XP7 A;  3KAH A;  2M3O W;  2ZQT A;  2RE3 A;  3LE4 A;  1WR7 A;  2KXQ A;  2XP5 A;  2DMV A;  2YSH A; 
#chains in the Genus database with same CATH topology
 1K9R A;  2JX8 A;  2ZR5 A;  3KAG A;  2ITK A;  2ZQU A;  5E64 A;  2XP6 A;  1F8A B;  2YAJ B;  2XP9 A;  3KAF A;  3KAD A;  4QIB A;  1YW5 A;  2EZ5 W;  2M8I A;  1I5H W;  3TCZ A;  1TR8 A;  3FSC A;  5E66 A;  3PQH A;  1EG4 A;  2WAE A;  2F21 A;  5E65 A;  3MQH A;  2YSI A;  3CNG A;  4REX A;  2LAJ A;  3TC5 A;  3TDB A;  2XPA A;  4A0T A;  2ZQS A;  1WMV A;  2ZQV A;  3LKX A;  4U85 A;  3M85 A;  3MCB A;  2DK7 A;  2YSG A;  3ODK A;  3LKX B;  2L4J A;  2XP8 A;  3MQG A;  1JMQ A;  2ZAJ A;  2MDI A;  5CQ2 A;  2DWV A;  2XP3 A;  3NTP A;  2YSB A;  1K9Q A;  5U47 A;  4GLX A;  2E45 A;  2JMF A;  2XPB A;  3WH0 A;  3L4H A;  2ZR6 A;  4U86 A;  2DK1 A;  5AHT A;  2YSF A;  5E5W A;  1PIN A;  1RP5 A;  3FSB A;  3MCB B;  2DJY A;  2Q5A A;  3M7N A;  1TK7 A;  2JXW A;  4U84 A;  2XP4 A;  2Y8N B;  2QRV A;  2WAD A;  3KAB A;  5E62 A;  2M8J A;  3OOB A;  1FLC A;  4E5R A;  3KAI A;  2BA1 A;  1ZCN A;  1NMV A;  3KCE A;  1O6W A;  2JV4 A;  2ZR4 A;  1EG3 A;  2XP7 A;  4A0U A;  3KAH A;  2M3O W;  3FS8 A;  2ZQT A;  2RE3 A;  3LE4 A;  2OWO A;  1WR7 A;  2KXQ A;  2XP5 A;  2DMV A;  2YSH A; 
#chains in the Genus database with same CATH homology
 1K9R A;  2JX8 A;  2ZR5 A;  3KAG A;  2ITK A;  2ZQU A;  5E64 A;  2XP6 A;  1F8A B;  2YAJ B;  2XP9 A;  3KAF A;  3KAD A;  4QIB A;  1YW5 A;  2EZ5 W;  2M8I A;  1I5H W;  3TCZ A;  1TR8 A;  3FSC A;  5E66 A;  3PQH A;  1EG4 A;  2WAE A;  2F21 A;  5E65 A;  3MQH A;  2YSI A;  3CNG A;  4REX A;  2LAJ A;  3TC5 A;  3TDB A;  2XPA A;  4A0T A;  2ZQS A;  1WMV A;  2ZQV A;  3LKX A;  4U85 A;  3M85 A;  3MCB A;  2DK7 A;  2YSG A;  3ODK A;  3LKX B;  2L4J A;  2XP8 A;  3MQG A;  1JMQ A;  2ZAJ A;  2MDI A;  5CQ2 A;  2DWV A;  2XP3 A;  3NTP A;  2YSB A;  1K9Q A;  5U47 A;  4GLX A;  2E45 A;  2JMF A;  2XPB A;  3WH0 A;  3L4H A;  2ZR6 A;  4U86 A;  2DK1 A;  5AHT A;  2YSF A;  5E5W A;  1PIN A;  1RP5 A;  3FSB A;  3MCB B;  2DJY A;  2Q5A A;  3M7N A;  1TK7 A;  2JXW A;  4U84 A;  2XP4 A;  2Y8N B;  2QRV A;  2WAD A;  3KAB A;  5E62 A;  2M8J A;  3OOB A;  1FLC A;  4E5R A;  3KAI A;  2BA1 A;  1ZCN A;  1NMV A;  3KCE A;  1O6W A;  2JV4 A;  2ZR4 A;  1EG3 A;  2XP7 A;  4A0U A;  3KAH A;  2M3O W;  3FS8 A;  2ZQT A;  2RE3 A;  3LE4 A;  2OWO A;  1WR7 A;  2KXQ A;  2XP5 A;  2DMV A;  2YSH A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...