2YSIA

Solution structure of the first ww domain from the mouse transcription elongation regulator 1, transcription factor ca150
Total Genus 1
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
1
sequence length
40
structure length
40
Chain Sequence
GSSGSSGTEEIWVENKTPDGKVYYYNARTRESAWTKPDGV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Protein binding
molecule keywords Transcription elongation regulator 1
publication title Solution structure of the first WW domain from the mouse transcription elongation regulator 1, transcription factor CA150
rcsb
source organism Mus musculus
total genus 1
structure length 40
sequence length 40
ec nomenclature
pdb deposition date 2007-04-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00397 WW WW domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.20.70.10 Mainly Beta Single Sheet Ubiquitin Ligase Nedd4; Chain: W; Ubiquitin Ligase Nedd4; Chain: W; 2ysiA01
4REXA 2ZR6A 3WH0A 3M7NA 2ZQUA 2F21A 2JMFA 2BA1A 2JV4A 2XP8A 2ZR5A 2XP5A 2ZQTA 4QIBA 4U84A 1ZCNA 3TC5A 2ZR4A 2DK1A 2XP9A 2Q5AA 4U85A 1YW5A 1NMVA 2XP4A 2E45A 4E5RA 1WMVA 2KXQA 2DMVA 2EZ5W 3CNGA 3KABA 2YSIA 3ODKA 3NTPA 2DK7A 5CQ2A 2XPBA 3KAGA 1WR7A 3M85A 1EG4A 5AHTA 2XPAA 3TCZA 1F8AB 2YSFA 1EG3A 2M8JA 2RE3A 2YSBA 2ZQVA 2YSHA 3OOBA 1PINA 2JX8A 2ZQSA 3L4HA 2MDIA 2M8IA 3KADA 2XP7A 2LAJA 2JXWA 2L4JA 3KCEA 2YSGA 1O6WA 4U86A 1K9QA 2XP6A 1I5HW 3KAHA 2DJYA 1K9RA 2XP3A 1JMQA 2M3OW 3LE4A 3TDBA 2DWVA 1TK7A 3KAIA 2ZAJA 3KAFA 2ITKA
chains in the Genus database with same CATH superfamily
4REXA 2ZR6A 3FSCA 3WH0A 3M7NA 2ZQUA 2F21A 2JMFA 2BA1A 2JV4A 2XP8A 2ZR5A 2XP5A 2ZQTA 4QIBA 4U84A 1ZCNA 3TC5A 2ZR4A 2DK1A 2XP9A 3PQHA 2Q5AA 4U85A 1YW5A 1NMVA 2XP4A 3MQGA 2E45A 4E5RA 1WMVA 2KXQA 2DMVA 2EZ5W 3CNGA 3KABA 2WADA 2YSIA 3LKXA 3ODKA 3MQHA 3NTPA 2DK7A 5CQ2A 2XPBA 3KAGA 2WAEA 1WR7A 3M85A 3MCBB 1EG4A 1TR8A 5E5WA 5AHTA 2XPAA 3TCZA 1F8AB 2YSFA 5E62A 1EG3A 2M8JA 2RE3A 2Y8NB 2YSBA 2ZQVA 2YSHA 1FLCA 3OOBA 1PINA 2JX8A 2ZQSA 3L4HA 2MDIA 2M8IA 5U47A 3KADA 3FSBA 2XP7A 2LAJA 2JXWA 2L4JA 3FS8A 1RP5A 3KCEA 5E64A 2YSGA 1O6WA 4U86A 1K9QA 4A0UA 2YAJB 2XP6A 1I5HW 3MCBA 3KAHA 2DJYA 1K9RA 2OWOA 2XP3A 2QRVA 1JMQA 3LKXB 2M3OW 4A0TA 3LE4A 3TDBA 2DWVA 5E66A 5E65A 1TK7A 3KAIA 2ZAJA 3KAFA 2ITKA 4GLXA
chains in the Genus database with same CATH topology
4REXA 2ZR6A 3FSCA 3WH0A 3M7NA 2ZQUA 2F21A 2JMFA 2BA1A 2JV4A 2XP8A 2ZR5A 2XP5A 2ZQTA 4QIBA 4U84A 1ZCNA 3TC5A 2ZR4A 2DK1A 2XP9A 3PQHA 2Q5AA 4U85A 1YW5A 1NMVA 2XP4A 3MQGA 2E45A 4E5RA 1WMVA 2KXQA 2DMVA 2EZ5W 3CNGA 3KABA 2WADA 2YSIA 3LKXA 3ODKA 3MQHA 3NTPA 2DK7A 5CQ2A 2XPBA 3KAGA 2WAEA 1WR7A 3M85A 3MCBB 1EG4A 1TR8A 5E5WA 5AHTA 2XPAA 3TCZA 1F8AB 2YSFA 5E62A 1EG3A 2M8JA 2RE3A 2Y8NB 2YSBA 2ZQVA 2YSHA 1FLCA 3OOBA 1PINA 2JX8A 2ZQSA 3L4HA 2MDIA 2M8IA 5U47A 3KADA 3FSBA 2XP7A 2LAJA 2JXWA 2L4JA 3FS8A 1RP5A 3KCEA 5E64A 2YSGA 1O6WA 4U86A 1K9QA 4A0UA 2YAJB 2XP6A 1I5HW 3MCBA 3KAHA 2DJYA 1K9RA 2OWOA 2XP3A 2QRVA 1JMQA 3LKXB 2M3OW 4A0TA 3LE4A 3TDBA 2DWVA 5E66A 5E65A 1TK7A 3KAIA 2ZAJA 3KAFA 2ITKA 4GLXA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4REX A;  2ZR6 A;  3WH0 A;  3M7N A;  2ZQU A;  2F21 A;  2JMF A;  2BA1 A;  2JV4 A;  2XP8 A;  2ZR5 A;  2XP5 A;  2ZQT A;  4QIB A;  4U84 A;  1ZCN A;  3TC5 A;  2ZR4 A;  2DK1 A;  2XP9 A;  2Q5A A;  4U85 A;  1YW5 A;  1NMV A;  2XP4 A;  2E45 A;  4E5R A;  1WMV A;  2KXQ A;  2DMV A;  2EZ5 W;  3CNG A;  3KAB A;  2YSI A;  3ODK A;  3NTP A;  2DK7 A;  5CQ2 A;  2XPB A;  3KAG A;  1WR7 A;  3M85 A;  1EG4 A;  5AHT A;  2XPA A;  3TCZ A;  1F8A B;  2YSF A;  1EG3 A;  2M8J A;  2RE3 A;  2YSB A;  2ZQV A;  2YSH A;  3OOB A;  1PIN A;  2JX8 A;  2ZQS A;  3L4H A;  2MDI A;  2M8I A;  3KAD A;  2XP7 A;  2LAJ A;  2JXW A;  2L4J A;  3KCE A;  2YSG A;  1O6W A;  4U86 A;  1K9Q A;  2XP6 A;  1I5H W;  3KAH A;  2DJY A;  1K9R A;  2XP3 A;  1JMQ A;  2M3O W;  3LE4 A;  3TDB A;  2DWV A;  1TK7 A;  3KAI A;  2ZAJ A;  3KAF A;  2ITK A; 
#chains in the Genus database with same CATH topology
 4REX A;  2ZR6 A;  3FSC A;  3WH0 A;  3M7N A;  2ZQU A;  2F21 A;  2JMF A;  2BA1 A;  2JV4 A;  2XP8 A;  2ZR5 A;  2XP5 A;  2ZQT A;  4QIB A;  4U84 A;  1ZCN A;  3TC5 A;  2ZR4 A;  2DK1 A;  2XP9 A;  3PQH A;  2Q5A A;  4U85 A;  1YW5 A;  1NMV A;  2XP4 A;  3MQG A;  2E45 A;  4E5R A;  1WMV A;  2KXQ A;  2DMV A;  2EZ5 W;  3CNG A;  3KAB A;  2WAD A;  2YSI A;  3LKX A;  3ODK A;  3MQH A;  3NTP A;  2DK7 A;  5CQ2 A;  2XPB A;  3KAG A;  2WAE A;  1WR7 A;  3M85 A;  3MCB B;  1EG4 A;  1TR8 A;  5E5W A;  5AHT A;  2XPA A;  3TCZ A;  1F8A B;  2YSF A;  5E62 A;  1EG3 A;  2M8J A;  2RE3 A;  2Y8N B;  2YSB A;  2ZQV A;  2YSH A;  1FLC A;  3OOB A;  1PIN A;  2JX8 A;  2ZQS A;  3L4H A;  2MDI A;  2M8I A;  5U47 A;  3KAD A;  3FSB A;  2XP7 A;  2LAJ A;  2JXW A;  2L4J A;  3FS8 A;  1RP5 A;  3KCE A;  5E64 A;  2YSG A;  1O6W A;  4U86 A;  1K9Q A;  4A0U A;  2YAJ B;  2XP6 A;  1I5H W;  3MCB A;  3KAH A;  2DJY A;  1K9R A;  2OWO A;  2XP3 A;  2QRV A;  1JMQ A;  3LKX B;  2M3O W;  4A0T A;  3LE4 A;  3TDB A;  2DWV A;  5E66 A;  5E65 A;  1TK7 A;  3KAI A;  2ZAJ A;  3KAF A;  2ITK A;  4GLX A; 
#chains in the Genus database with same CATH homology
 4REX A;  2ZR6 A;  3FSC A;  3WH0 A;  3M7N A;  2ZQU A;  2F21 A;  2JMF A;  2BA1 A;  2JV4 A;  2XP8 A;  2ZR5 A;  2XP5 A;  2ZQT A;  4QIB A;  4U84 A;  1ZCN A;  3TC5 A;  2ZR4 A;  2DK1 A;  2XP9 A;  3PQH A;  2Q5A A;  4U85 A;  1YW5 A;  1NMV A;  2XP4 A;  3MQG A;  2E45 A;  4E5R A;  1WMV A;  2KXQ A;  2DMV A;  2EZ5 W;  3CNG A;  3KAB A;  2WAD A;  2YSI A;  3LKX A;  3ODK A;  3MQH A;  3NTP A;  2DK7 A;  5CQ2 A;  2XPB A;  3KAG A;  2WAE A;  1WR7 A;  3M85 A;  3MCB B;  1EG4 A;  1TR8 A;  5E5W A;  5AHT A;  2XPA A;  3TCZ A;  1F8A B;  2YSF A;  5E62 A;  1EG3 A;  2M8J A;  2RE3 A;  2Y8N B;  2YSB A;  2ZQV A;  2YSH A;  1FLC A;  3OOB A;  1PIN A;  2JX8 A;  2ZQS A;  3L4H A;  2MDI A;  2M8I A;  5U47 A;  3KAD A;  3FSB A;  2XP7 A;  2LAJ A;  2JXW A;  2L4J A;  3FS8 A;  1RP5 A;  3KCE A;  5E64 A;  2YSG A;  1O6W A;  4U86 A;  1K9Q A;  4A0U A;  2YAJ B;  2XP6 A;  1I5H W;  3MCB A;  3KAH A;  2DJY A;  1K9R A;  2OWO A;  2XP3 A;  2QRV A;  1JMQ A;  3LKX B;  2M3O W;  4A0T A;  3LE4 A;  3TDB A;  2DWV A;  5E66 A;  5E65 A;  1TK7 A;  3KAI A;  2ZAJ A;  3KAF A;  2ITK A;  4GLX A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...