2YSIA

Solution structure of the first ww domain from the mouse transcription elongation regulator 1, transcription factor ca150
Total Genus 1
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
1
sequence length
40
structure length
40
Chain Sequence
b'GSSGSSGTEEIWVENKTPDGKVYYYNARTRESAWTKPDGV'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Transcription elongation regulator 1
publication title Solution structure of the first WW domain from the mouse transcription elongation regulator 1, transcription factor CA150
rcsb
source organism Mus musculus
molecule tags Protein binding
total genus 1
structure length 40
sequence length 40
ec nomenclature
pdb deposition date 2007-04-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00397 WW WW domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.20.70.10 Mainly Beta Single Sheet Ubiquitin Ligase Nedd4; Chain: W; Ubiquitin Ligase Nedd4; Chain: W; 2ysiA01
3M85A 3KAGA 1O6WA 3KAHA 3KABA 2YSIA 2DK1A 2DMVA 2ZQTA 1PINA 1EG3A 2XPBA 3TDBA 1WR7A 2XP9A 2JMFA 2M8IA 4U86A 2XP3A 2ITKA 4QIBA 3M7NA 2XP8A 2ZR5A 4U85A 3KADA 2ZR4A 1ZCNA 1JMQA 2XP4A 2KXQA 2YSGA 3KAFA 2ZQVA 3CNGA 2DJYA 3L4HA 1EG4A 2M8JA 3NTPA 1I5HW 2L4JA 2M3OW 2YSFA 1K9RA 2JV4A 2MDIA 5CQ2A 2ZQSA 1TK7A 2DK7A 1YW5A 2ZQUA 3TCZA 2JXWA 5AHTA 2EZ5W 2F21A 2Q5AA 3TC5A 2ZAJA 3ODKA 3OOBA 2RE3A 2E45A 2YSBA 4REXA 2XPAA 2BA1A 2JX8A 3LE4A 4U84A 2XP5A 1F8AB 2ZR6A 3KAIA 2XP6A 4E5RA 1WMVA 1NMVA 2LAJA 2DWVA 3WH0A 2YSHA 1K9QA 3KCEA 2XP7A
chains in the Genus database with same CATH superfamily
3M85A 3KAGA 5E65A 3MCBA 1O6WA 3KAHA 3KABA 2YSIA 2DK1A 4GLXA 2DMVA 3LKXA 2ZQTA 1PINA 1EG3A 2XPBA 3TDBA 5E5WA 1WR7A 2YAJB 2XP9A 2JMFA 2M8IA 2ITKA 2XP3A 4U86A 4QIBA 3M7NA 2XP8A 2ZR5A 4U85A 3FSBA 3KADA 2ZR4A 1ZCNA 1JMQA 2XP4A 2KXQA 2YSGA 3KAFA 2ZQVA 3CNGA 2DJYA 3FSCA 4A0TA 2QRVA 3L4HA 1EG4A 2M8JA 3NTPA 1I5HW 2L4JA 2M3OW 2YSFA 1K9RA 2JV4A 2MDIA 5U47A 5CQ2A 1RP5A 5E66A 2ZQSA 1TK7A 2DK7A 1YW5A 2ZQUA 3TCZA 3MQHA 2JXWA 1FLCA 5AHTA 3MCBB 2EZ5W 2F21A 2Q5AA 3TC5A 2ZAJA 3ODKA 3MQGA 3OOBA 3LKXB 2RE3A 2E45A 2YSBA 4REXA 2XPAA 2BA1A 2WAEA 2JX8A 3PQHA 3LE4A 2WADA 4U84A 2XP5A 1F8AB 2OWOA 1TR8A 2ZR6A 3KAIA 4A0UA 2XP6A 4E5RA 5E64A 1WMVA 1NMVA 2LAJA 2DWVA 2Y8NB 3WH0A 2YSHA 3FS8A 5E62A 1K9QA 3KCEA 2XP7A
chains in the Genus database with same CATH topology
3M85A 3KAGA 5E65A 3MCBA 1O6WA 3KAHA 3KABA 2YSIA 2DK1A 4GLXA 2DMVA 3LKXA 2ZQTA 1PINA 1EG3A 2XPBA 3TDBA 5E5WA 1WR7A 2YAJB 2XP9A 2JMFA 2M8IA 2ITKA 2XP3A 4U86A 4QIBA 3M7NA 2XP8A 2ZR5A 4U85A 3FSBA 3KADA 2ZR4A 1ZCNA 1JMQA 2XP4A 2KXQA 2YSGA 3KAFA 2ZQVA 3CNGA 2DJYA 3FSCA 4A0TA 2QRVA 3L4HA 1EG4A 2M8JA 3NTPA 1I5HW 2L4JA 2M3OW 2YSFA 1K9RA 2JV4A 2MDIA 5U47A 5CQ2A 1RP5A 5E66A 2ZQSA 1TK7A 2DK7A 1YW5A 2ZQUA 3TCZA 3MQHA 2JXWA 1FLCA 5AHTA 3MCBB 2EZ5W 2F21A 2Q5AA 3TC5A 2ZAJA 3ODKA 3MQGA 3OOBA 3LKXB 2RE3A 2E45A 2YSBA 4REXA 2XPAA 2BA1A 2WAEA 2JX8A 3PQHA 3LE4A 2WADA 4U84A 2XP5A 1F8AB 2OWOA 1TR8A 2ZR6A 3KAIA 4A0UA 2XP6A 4E5RA 5E64A 1WMVA 1NMVA 2LAJA 2DWVA 2Y8NB 3WH0A 2YSHA 3FS8A 5E62A 1K9QA 3KCEA 2XP7A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3M85 A;  3KAG A;  1O6W A;  3KAH A;  3KAB A;  2YSI A;  2DK1 A;  2DMV A;  2ZQT A;  1PIN A;  1EG3 A;  2XPB A;  3TDB A;  1WR7 A;  2XP9 A;  2JMF A;  2M8I A;  4U86 A;  2XP3 A;  2ITK A;  4QIB A;  3M7N A;  2XP8 A;  2ZR5 A;  4U85 A;  3KAD A;  2ZR4 A;  1ZCN A;  1JMQ A;  2XP4 A;  2KXQ A;  2YSG A;  3KAF A;  2ZQV A;  3CNG A;  2DJY A;  3L4H A;  1EG4 A;  2M8J A;  3NTP A;  1I5H W;  2L4J A;  2M3O W;  2YSF A;  1K9R A;  2JV4 A;  2MDI A;  5CQ2 A;  2ZQS A;  1TK7 A;  2DK7 A;  1YW5 A;  2ZQU A;  3TCZ A;  2JXW A;  5AHT A;  2EZ5 W;  2F21 A;  2Q5A A;  3TC5 A;  2ZAJ A;  3ODK A;  3OOB A;  2RE3 A;  2E45 A;  2YSB A;  4REX A;  2XPA A;  2BA1 A;  2JX8 A;  3LE4 A;  4U84 A;  2XP5 A;  1F8A B;  2ZR6 A;  3KAI A;  2XP6 A;  4E5R A;  1WMV A;  1NMV A;  2LAJ A;  2DWV A;  3WH0 A;  2YSH A;  1K9Q A;  3KCE A;  2XP7 A; 
#chains in the Genus database with same CATH topology
 3M85 A;  3KAG A;  5E65 A;  3MCB A;  1O6W A;  3KAH A;  3KAB A;  2YSI A;  2DK1 A;  4GLX A;  2DMV A;  3LKX A;  2ZQT A;  1PIN A;  1EG3 A;  2XPB A;  3TDB A;  5E5W A;  1WR7 A;  2YAJ B;  2XP9 A;  2JMF A;  2M8I A;  2ITK A;  2XP3 A;  4U86 A;  4QIB A;  3M7N A;  2XP8 A;  2ZR5 A;  4U85 A;  3FSB A;  3KAD A;  2ZR4 A;  1ZCN A;  1JMQ A;  2XP4 A;  2KXQ A;  2YSG A;  3KAF A;  2ZQV A;  3CNG A;  2DJY A;  3FSC A;  4A0T A;  2QRV A;  3L4H A;  1EG4 A;  2M8J A;  3NTP A;  1I5H W;  2L4J A;  2M3O W;  2YSF A;  1K9R A;  2JV4 A;  2MDI A;  5U47 A;  5CQ2 A;  1RP5 A;  5E66 A;  2ZQS A;  1TK7 A;  2DK7 A;  1YW5 A;  2ZQU A;  3TCZ A;  3MQH A;  2JXW A;  1FLC A;  5AHT A;  3MCB B;  2EZ5 W;  2F21 A;  2Q5A A;  3TC5 A;  2ZAJ A;  3ODK A;  3MQG A;  3OOB A;  3LKX B;  2RE3 A;  2E45 A;  2YSB A;  4REX A;  2XPA A;  2BA1 A;  2WAE A;  2JX8 A;  3PQH A;  3LE4 A;  2WAD A;  4U84 A;  2XP5 A;  1F8A B;  2OWO A;  1TR8 A;  2ZR6 A;  3KAI A;  4A0U A;  2XP6 A;  4E5R A;  5E64 A;  1WMV A;  1NMV A;  2LAJ A;  2DWV A;  2Y8N B;  3WH0 A;  2YSH A;  3FS8 A;  5E62 A;  1K9Q A;  3KCE A;  2XP7 A; 
#chains in the Genus database with same CATH homology
 3M85 A;  3KAG A;  5E65 A;  3MCB A;  1O6W A;  3KAH A;  3KAB A;  2YSI A;  2DK1 A;  4GLX A;  2DMV A;  3LKX A;  2ZQT A;  1PIN A;  1EG3 A;  2XPB A;  3TDB A;  5E5W A;  1WR7 A;  2YAJ B;  2XP9 A;  2JMF A;  2M8I A;  2ITK A;  2XP3 A;  4U86 A;  4QIB A;  3M7N A;  2XP8 A;  2ZR5 A;  4U85 A;  3FSB A;  3KAD A;  2ZR4 A;  1ZCN A;  1JMQ A;  2XP4 A;  2KXQ A;  2YSG A;  3KAF A;  2ZQV A;  3CNG A;  2DJY A;  3FSC A;  4A0T A;  2QRV A;  3L4H A;  1EG4 A;  2M8J A;  3NTP A;  1I5H W;  2L4J A;  2M3O W;  2YSF A;  1K9R A;  2JV4 A;  2MDI A;  5U47 A;  5CQ2 A;  1RP5 A;  5E66 A;  2ZQS A;  1TK7 A;  2DK7 A;  1YW5 A;  2ZQU A;  3TCZ A;  3MQH A;  2JXW A;  1FLC A;  5AHT A;  3MCB B;  2EZ5 W;  2F21 A;  2Q5A A;  3TC5 A;  2ZAJ A;  3ODK A;  3MQG A;  3OOB A;  3LKX B;  2RE3 A;  2E45 A;  2YSB A;  4REX A;  2XPA A;  2BA1 A;  2WAE A;  2JX8 A;  3PQH A;  3LE4 A;  2WAD A;  4U84 A;  2XP5 A;  1F8A B;  2OWO A;  1TR8 A;  2ZR6 A;  3KAI A;  4A0U A;  2XP6 A;  4E5R A;  5E64 A;  1WMV A;  1NMV A;  2LAJ A;  2DWV A;  2Y8N B;  3WH0 A;  2YSH A;  3FS8 A;  5E62 A;  1K9Q A;  3KCE A;  2XP7 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...