2KXQA

Solution structure of smurf2 ww2 and ww3 bound to smad7 py motif containing peptide
Total Genus 9
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
9
sequence length
90
structure length
90
Chain Sequence
GPLGGSPPDLPEGYEQRTTQQGQVYFLHTQTGVSTWHDPRVPRDLSNINCEELGPLPPGWEIRNTATGRVYFVDHNNRTTQFTDPRLSAN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords E3 ubiquitin-protein ligase SMURF2
publication title Coupling of tandem Smad ubiquitination regulatory factor (Smurf) WW domains modulates target specificity.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Protein binding
total genus 9
structure length 90
sequence length 90
ec nomenclature ec 2.3.2.26: HECT-type E3 ubiquitin transferase.
pdb deposition date 2010-05-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00397 WW WW domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.20.70.10 Mainly Beta Single Sheet Ubiquitin Ligase Nedd4; Chain: W; Ubiquitin Ligase Nedd4; Chain: W; 2kxqA01
2.20.70.10 Mainly Beta Single Sheet Ubiquitin Ligase Nedd4; Chain: W; Ubiquitin Ligase Nedd4; Chain: W; 2kxqA02
3LE4A 2Q5AA 2JXWA 3NTPA 1WMVA 5CQ2A 4QIBA 3TCZA 3TC5A 2F21A 3KAHA 1K9RA 2EZ5W 1EG4A 2ZQSA 1O6WA 2ZQTA 1I5HW 4E5RA 2DMVA 2M8JA 2LAJA 2XP7A 2ZR5A 2DK7A 4U86A 2XP5A 3L4HA 1NMVA 2JX8A 3KADA 3KABA 2YSGA 4U85A 3ODKA 2M8IA 1JMQA 2JMFA 2XPBA 2MDIA 4REXA 3KAIA 2XP6A 2ZQVA 1K9QA 2DJYA 1TK7A 2JV4A 2YSHA 2ZQUA 2BA1A 1WR7A 3KAFA 2XP4A 2YSFA 2DWVA 2M3OW 2ZAJA 3TDBA 2KXQA 3WH0A 2XP9A 2DK1A 2XPAA 2ZR4A 1YW5A 1ZCNA 2L4JA 4U84A 3KCEA 2RE3A 3M7NA 2E45A 2YSIA 2XP8A 1EG3A 2XP3A 1F8AB 3KAGA 1PINA 3CNGA 2YSBA 2ZR6A 2ITKA 5AHTA 3M85A 3OOBA
chains in the Genus database with same CATH superfamily
3LE4A 2Q5AA 2JXWA 3FSBA 2Y8NB 3NTPA 1WMVA 2WAEA 5CQ2A 2OWOA 2QRVA 4QIBA 3TCZA 3TC5A 2F21A 3KAHA 5U47A 1K9RA 1TR8A 2EZ5W 1EG4A 2ZQSA 1O6WA 3PQHA 5E5WA 2ZQTA 1I5HW 4E5RA 2DMVA 2M8JA 4A0UA 2LAJA 2XP7A 1RP5A 2ZR5A 2DK7A 4U86A 2XP5A 3L4HA 1NMVA 2JX8A 3KADA 3KABA 2YSGA 4U85A 3ODKA 2M8IA 1JMQA 2JMFA 2XPBA 2MDIA 3KAIA 4REXA 2XP6A 2ZQVA 1K9QA 2DJYA 1TK7A 2JV4A 2YSHA 2ZQUA 2BA1A 1WR7A 3FS8A 3KAFA 2XP4A 2YSFA 2DWVA 2M3OW 3LKXA 2WADA 3LKXB 5E66A 2ZAJA 3FSCA 5E62A 3TDBA 4GLXA 2KXQA 3WH0A 2XP9A 5E65A 2DK1A 2YAJB 2XPAA 2ZR4A 1YW5A 1ZCNA 2L4JA 4U84A 3KCEA 2RE3A 3M7NA 3MCBA 3MCBB 2E45A 2YSIA 2XP8A 1EG3A 2XP3A 1FLCA 1F8AB 3KAGA 1PINA 3MQGA 3CNGA 2YSBA 3MQHA 5E64A 2ZR6A 2ITKA 4A0TA 5AHTA 3M85A 3OOBA
chains in the Genus database with same CATH topology
3LE4A 2Q5AA 2JXWA 3FSBA 2Y8NB 3NTPA 1WMVA 2WAEA 5CQ2A 2OWOA 2QRVA 4QIBA 3TCZA 3TC5A 2F21A 3KAHA 5U47A 1K9RA 1TR8A 2EZ5W 1EG4A 2ZQSA 1O6WA 3PQHA 5E5WA 2ZQTA 1I5HW 4E5RA 2DMVA 2M8JA 4A0UA 2LAJA 2XP7A 1RP5A 2ZR5A 2DK7A 4U86A 2XP5A 3L4HA 1NMVA 2JX8A 3KADA 3KABA 2YSGA 4U85A 3ODKA 2M8IA 1JMQA 2JMFA 2XPBA 2MDIA 3KAIA 4REXA 2XP6A 2ZQVA 1K9QA 2DJYA 1TK7A 2JV4A 2YSHA 2ZQUA 2BA1A 1WR7A 3FS8A 3KAFA 2XP4A 2YSFA 2DWVA 2M3OW 3LKXA 2WADA 3LKXB 5E66A 2ZAJA 3FSCA 5E62A 3TDBA 4GLXA 2KXQA 3WH0A 2XP9A 5E65A 2DK1A 2YAJB 2XPAA 2ZR4A 1YW5A 1ZCNA 2L4JA 4U84A 3KCEA 2RE3A 3M7NA 3MCBA 3MCBB 2E45A 2YSIA 2XP8A 1EG3A 2XP3A 1FLCA 1F8AB 3KAGA 1PINA 3MQGA 3CNGA 2YSBA 3MQHA 5E64A 2ZR6A 2ITKA 4A0TA 5AHTA 3M85A 3OOBA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3LE4 A;  2Q5A A;  2JXW A;  3NTP A;  1WMV A;  5CQ2 A;  4QIB A;  3TCZ A;  3TC5 A;  2F21 A;  3KAH A;  1K9R A;  2EZ5 W;  1EG4 A;  2ZQS A;  1O6W A;  2ZQT A;  1I5H W;  4E5R A;  2DMV A;  2M8J A;  2LAJ A;  2XP7 A;  2ZR5 A;  2DK7 A;  4U86 A;  2XP5 A;  3L4H A;  1NMV A;  2JX8 A;  3KAD A;  3KAB A;  2YSG A;  4U85 A;  3ODK A;  2M8I A;  1JMQ A;  2JMF A;  2XPB A;  2MDI A;  4REX A;  3KAI A;  2XP6 A;  2ZQV A;  1K9Q A;  2DJY A;  1TK7 A;  2JV4 A;  2YSH A;  2ZQU A;  2BA1 A;  1WR7 A;  3KAF A;  2XP4 A;  2YSF A;  2DWV A;  2M3O W;  2ZAJ A;  3TDB A;  2KXQ A;  3WH0 A;  2XP9 A;  2DK1 A;  2XPA A;  2ZR4 A;  1YW5 A;  1ZCN A;  2L4J A;  4U84 A;  3KCE A;  2RE3 A;  3M7N A;  2E45 A;  2YSI A;  2XP8 A;  1EG3 A;  2XP3 A;  1F8A B;  3KAG A;  1PIN A;  3CNG A;  2YSB A;  2ZR6 A;  2ITK A;  5AHT A;  3M85 A;  3OOB A; 
#chains in the Genus database with same CATH topology
 3LE4 A;  2Q5A A;  2JXW A;  3FSB A;  2Y8N B;  3NTP A;  1WMV A;  2WAE A;  5CQ2 A;  2OWO A;  2QRV A;  4QIB A;  3TCZ A;  3TC5 A;  2F21 A;  3KAH A;  5U47 A;  1K9R A;  1TR8 A;  2EZ5 W;  1EG4 A;  2ZQS A;  1O6W A;  3PQH A;  5E5W A;  2ZQT A;  1I5H W;  4E5R A;  2DMV A;  2M8J A;  4A0U A;  2LAJ A;  2XP7 A;  1RP5 A;  2ZR5 A;  2DK7 A;  4U86 A;  2XP5 A;  3L4H A;  1NMV A;  2JX8 A;  3KAD A;  3KAB A;  2YSG A;  4U85 A;  3ODK A;  2M8I A;  1JMQ A;  2JMF A;  2XPB A;  2MDI A;  3KAI A;  4REX A;  2XP6 A;  2ZQV A;  1K9Q A;  2DJY A;  1TK7 A;  2JV4 A;  2YSH A;  2ZQU A;  2BA1 A;  1WR7 A;  3FS8 A;  3KAF A;  2XP4 A;  2YSF A;  2DWV A;  2M3O W;  3LKX A;  2WAD A;  3LKX B;  5E66 A;  2ZAJ A;  3FSC A;  5E62 A;  3TDB A;  4GLX A;  2KXQ A;  3WH0 A;  2XP9 A;  5E65 A;  2DK1 A;  2YAJ B;  2XPA A;  2ZR4 A;  1YW5 A;  1ZCN A;  2L4J A;  4U84 A;  3KCE A;  2RE3 A;  3M7N A;  3MCB A;  3MCB B;  2E45 A;  2YSI A;  2XP8 A;  1EG3 A;  2XP3 A;  1FLC A;  1F8A B;  3KAG A;  1PIN A;  3MQG A;  3CNG A;  2YSB A;  3MQH A;  5E64 A;  2ZR6 A;  2ITK A;  4A0T A;  5AHT A;  3M85 A;  3OOB A; 
#chains in the Genus database with same CATH homology
 3LE4 A;  2Q5A A;  2JXW A;  3FSB A;  2Y8N B;  3NTP A;  1WMV A;  2WAE A;  5CQ2 A;  2OWO A;  2QRV A;  4QIB A;  3TCZ A;  3TC5 A;  2F21 A;  3KAH A;  5U47 A;  1K9R A;  1TR8 A;  2EZ5 W;  1EG4 A;  2ZQS A;  1O6W A;  3PQH A;  5E5W A;  2ZQT A;  1I5H W;  4E5R A;  2DMV A;  2M8J A;  4A0U A;  2LAJ A;  2XP7 A;  1RP5 A;  2ZR5 A;  2DK7 A;  4U86 A;  2XP5 A;  3L4H A;  1NMV A;  2JX8 A;  3KAD A;  3KAB A;  2YSG A;  4U85 A;  3ODK A;  2M8I A;  1JMQ A;  2JMF A;  2XPB A;  2MDI A;  3KAI A;  4REX A;  2XP6 A;  2ZQV A;  1K9Q A;  2DJY A;  1TK7 A;  2JV4 A;  2YSH A;  2ZQU A;  2BA1 A;  1WR7 A;  3FS8 A;  3KAF A;  2XP4 A;  2YSF A;  2DWV A;  2M3O W;  3LKX A;  2WAD A;  3LKX B;  5E66 A;  2ZAJ A;  3FSC A;  5E62 A;  3TDB A;  4GLX A;  2KXQ A;  3WH0 A;  2XP9 A;  5E65 A;  2DK1 A;  2YAJ B;  2XPA A;  2ZR4 A;  1YW5 A;  1ZCN A;  2L4J A;  4U84 A;  3KCE A;  2RE3 A;  3M7N A;  3MCB A;  3MCB B;  2E45 A;  2YSI A;  2XP8 A;  1EG3 A;  2XP3 A;  1FLC A;  1F8A B;  3KAG A;  1PIN A;  3MQG A;  3CNG A;  2YSB A;  3MQH A;  5E64 A;  2ZR6 A;  2ITK A;  4A0T A;  5AHT A;  3M85 A;  3OOB A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...