2KXQA

Solution structure of smurf2 ww2 and ww3 bound to smad7 py motif containing peptide
Total Genus 9
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
9
sequence length
90
structure length
90
Chain Sequence
GPLGGSPPDLPEGYEQRTTQQGQVYFLHTQTGVSTWHDPRVPRDLSNINCEELGPLPPGWEIRNTATGRVYFVDHNNRTTQFTDPRLSAN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Protein binding
molecule keywords E3 ubiquitin-protein ligase SMURF2
publication title Coupling of tandem Smad ubiquitination regulatory factor (Smurf) WW domains modulates target specificity.
pubmed doi rcsb
source organism Homo sapiens
total genus 9
structure length 90
sequence length 90
ec nomenclature ec 2.3.2.26: HECT-type E3 ubiquitin transferase.
pdb deposition date 2010-05-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00397 WW WW domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.20.70.10 Mainly Beta Single Sheet Ubiquitin Ligase Nedd4; Chain: W; Ubiquitin Ligase Nedd4; Chain: W; 2kxqA01
2.20.70.10 Mainly Beta Single Sheet Ubiquitin Ligase Nedd4; Chain: W; Ubiquitin Ligase Nedd4; Chain: W; 2kxqA02
3ODKA 2XP9A 1TK7A 4QIBA 2DJYA 2YSHA 2YSIA 3TCZA 3NTPA 2M8IA 2XP7A 4U85A 3KADA 2EZ5W 3LE4A 2DWVA 3KAFA 1JMQA 2XP3A 2JX8A 1PINA 2Q5AA 1I5HW 1K9RA 2YSGA 2XP6A 1EG3A 4REXA 2XP5A 1WR7A 2JV4A 5AHTA 2E45A 1F8AB 2JMFA 3KAHA 3WH0A 3CNGA 2DK1A 2M8JA 2LAJA 4U84A 2MDIA 2ZQSA 2YSBA 2ZR4A 3KABA 3L4HA 1ZCNA 3TC5A 2ZQVA 2ZR5A 2KXQA 2BA1A 3M7NA 2L4JA 2ZAJA 2M3OW 2RE3A 2ZQTA 2XP4A 2DK7A 2ITKA 1K9QA 2XP8A 1O6WA 3KCEA 4E5RA 3KAGA 3OOBA 2ZR6A 3KAIA 3TDBA 2XPAA 4U86A 2F21A 1NMVA 1EG4A 5CQ2A 2DMVA 1WMVA 2JXWA 1YW5A 2ZQUA 3M85A 2YSFA 2XPBA
chains in the Genus database with same CATH superfamily
3ODKA 2XP9A 1TK7A 4QIBA 2DJYA 2YSHA 2YSIA 3TCZA 3NTPA 2M8IA 2XP7A 4U85A 3KADA 2EZ5W 3LE4A 2DWVA 3KAFA 1JMQA 2XP3A 2JX8A 1PINA 1TR8A 2Q5AA 5E64A 3MCBA 1I5HW 1K9RA 2YSGA 2XP6A 1EG3A 2WADA 4REXA 2XP5A 1WR7A 2JV4A 5AHTA 2E45A 1FLCA 1F8AB 2JMFA 3MQGA 3KAHA 3WH0A 3CNGA 1RP5A 2DK1A 2M8JA 2LAJA 4U84A 2OWOA 3FSCA 3LKXB 2MDIA 3PQHA 2ZQSA 2YSBA 2ZR4A 3KABA 3L4HA 4A0UA 1ZCNA 3TC5A 2YAJB 3FS8A 2ZQVA 2ZR5A 2KXQA 3FSBA 2BA1A 3M7NA 2L4JA 2ZAJA 2M3OW 2RE3A 2ZQTA 2WAEA 2XP4A 2DK7A 4GLXA 2ITKA 5E62A 1K9QA 2XP8A 1O6WA 2QRVA 3KCEA 4E5RA 3KAGA 3OOBA 3LKXA 3MCBB 5E66A 2ZR6A 5U47A 5E65A 3KAIA 2Y8NB 3TDBA 2XPAA 4U86A 2F21A 1NMVA 1EG4A 5CQ2A 5E5WA 2DMVA 4A0TA 1WMVA 2JXWA 1YW5A 2ZQUA 3MQHA 3M85A 2YSFA 2XPBA
chains in the Genus database with same CATH topology
3ODKA 2XP9A 1TK7A 4QIBA 2DJYA 2YSHA 2YSIA 3TCZA 3NTPA 2M8IA 2XP7A 4U85A 3KADA 2EZ5W 3LE4A 2DWVA 3KAFA 1JMQA 2XP3A 2JX8A 1PINA 1TR8A 2Q5AA 5E64A 3MCBA 1I5HW 1K9RA 2YSGA 2XP6A 1EG3A 2WADA 4REXA 2XP5A 1WR7A 2JV4A 5AHTA 2E45A 1FLCA 1F8AB 2JMFA 3MQGA 3KAHA 3WH0A 3CNGA 1RP5A 2DK1A 2M8JA 2LAJA 4U84A 2OWOA 3FSCA 3LKXB 2MDIA 3PQHA 2ZQSA 2YSBA 2ZR4A 3KABA 3L4HA 4A0UA 1ZCNA 3TC5A 2YAJB 3FS8A 2ZQVA 2ZR5A 2KXQA 3FSBA 2BA1A 3M7NA 2L4JA 2ZAJA 2M3OW 2RE3A 2ZQTA 2WAEA 2XP4A 2DK7A 4GLXA 2ITKA 5E62A 1K9QA 2XP8A 1O6WA 2QRVA 3KCEA 4E5RA 3KAGA 3OOBA 3LKXA 3MCBB 5E66A 2ZR6A 5U47A 5E65A 3KAIA 2Y8NB 3TDBA 2XPAA 4U86A 2F21A 1NMVA 1EG4A 5CQ2A 5E5WA 2DMVA 4A0TA 1WMVA 2JXWA 1YW5A 2ZQUA 3MQHA 3M85A 2YSFA 2XPBA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3ODK A;  2XP9 A;  1TK7 A;  4QIB A;  2DJY A;  2YSH A;  2YSI A;  3TCZ A;  3NTP A;  2M8I A;  2XP7 A;  4U85 A;  3KAD A;  2EZ5 W;  3LE4 A;  2DWV A;  3KAF A;  1JMQ A;  2XP3 A;  2JX8 A;  1PIN A;  2Q5A A;  1I5H W;  1K9R A;  2YSG A;  2XP6 A;  1EG3 A;  4REX A;  2XP5 A;  1WR7 A;  2JV4 A;  5AHT A;  2E45 A;  1F8A B;  2JMF A;  3KAH A;  3WH0 A;  3CNG A;  2DK1 A;  2M8J A;  2LAJ A;  4U84 A;  2MDI A;  2ZQS A;  2YSB A;  2ZR4 A;  3KAB A;  3L4H A;  1ZCN A;  3TC5 A;  2ZQV A;  2ZR5 A;  2KXQ A;  2BA1 A;  3M7N A;  2L4J A;  2ZAJ A;  2M3O W;  2RE3 A;  2ZQT A;  2XP4 A;  2DK7 A;  2ITK A;  1K9Q A;  2XP8 A;  1O6W A;  3KCE A;  4E5R A;  3KAG A;  3OOB A;  2ZR6 A;  3KAI A;  3TDB A;  2XPA A;  4U86 A;  2F21 A;  1NMV A;  1EG4 A;  5CQ2 A;  2DMV A;  1WMV A;  2JXW A;  1YW5 A;  2ZQU A;  3M85 A;  2YSF A;  2XPB A; 
#chains in the Genus database with same CATH topology
 3ODK A;  2XP9 A;  1TK7 A;  4QIB A;  2DJY A;  2YSH A;  2YSI A;  3TCZ A;  3NTP A;  2M8I A;  2XP7 A;  4U85 A;  3KAD A;  2EZ5 W;  3LE4 A;  2DWV A;  3KAF A;  1JMQ A;  2XP3 A;  2JX8 A;  1PIN A;  1TR8 A;  2Q5A A;  5E64 A;  3MCB A;  1I5H W;  1K9R A;  2YSG A;  2XP6 A;  1EG3 A;  2WAD A;  4REX A;  2XP5 A;  1WR7 A;  2JV4 A;  5AHT A;  2E45 A;  1FLC A;  1F8A B;  2JMF A;  3MQG A;  3KAH A;  3WH0 A;  3CNG A;  1RP5 A;  2DK1 A;  2M8J A;  2LAJ A;  4U84 A;  2OWO A;  3FSC A;  3LKX B;  2MDI A;  3PQH A;  2ZQS A;  2YSB A;  2ZR4 A;  3KAB A;  3L4H A;  4A0U A;  1ZCN A;  3TC5 A;  2YAJ B;  3FS8 A;  2ZQV A;  2ZR5 A;  2KXQ A;  3FSB A;  2BA1 A;  3M7N A;  2L4J A;  2ZAJ A;  2M3O W;  2RE3 A;  2ZQT A;  2WAE A;  2XP4 A;  2DK7 A;  4GLX A;  2ITK A;  5E62 A;  1K9Q A;  2XP8 A;  1O6W A;  2QRV A;  3KCE A;  4E5R A;  3KAG A;  3OOB A;  3LKX A;  3MCB B;  5E66 A;  2ZR6 A;  5U47 A;  5E65 A;  3KAI A;  2Y8N B;  3TDB A;  2XPA A;  4U86 A;  2F21 A;  1NMV A;  1EG4 A;  5CQ2 A;  5E5W A;  2DMV A;  4A0T A;  1WMV A;  2JXW A;  1YW5 A;  2ZQU A;  3MQH A;  3M85 A;  2YSF A;  2XPB A; 
#chains in the Genus database with same CATH homology
 3ODK A;  2XP9 A;  1TK7 A;  4QIB A;  2DJY A;  2YSH A;  2YSI A;  3TCZ A;  3NTP A;  2M8I A;  2XP7 A;  4U85 A;  3KAD A;  2EZ5 W;  3LE4 A;  2DWV A;  3KAF A;  1JMQ A;  2XP3 A;  2JX8 A;  1PIN A;  1TR8 A;  2Q5A A;  5E64 A;  3MCB A;  1I5H W;  1K9R A;  2YSG A;  2XP6 A;  1EG3 A;  2WAD A;  4REX A;  2XP5 A;  1WR7 A;  2JV4 A;  5AHT A;  2E45 A;  1FLC A;  1F8A B;  2JMF A;  3MQG A;  3KAH A;  3WH0 A;  3CNG A;  1RP5 A;  2DK1 A;  2M8J A;  2LAJ A;  4U84 A;  2OWO A;  3FSC A;  3LKX B;  2MDI A;  3PQH A;  2ZQS A;  2YSB A;  2ZR4 A;  3KAB A;  3L4H A;  4A0U A;  1ZCN A;  3TC5 A;  2YAJ B;  3FS8 A;  2ZQV A;  2ZR5 A;  2KXQ A;  3FSB A;  2BA1 A;  3M7N A;  2L4J A;  2ZAJ A;  2M3O W;  2RE3 A;  2ZQT A;  2WAE A;  2XP4 A;  2DK7 A;  4GLX A;  2ITK A;  5E62 A;  1K9Q A;  2XP8 A;  1O6W A;  2QRV A;  3KCE A;  4E5R A;  3KAG A;  3OOB A;  3LKX A;  3MCB B;  5E66 A;  2ZR6 A;  5U47 A;  5E65 A;  3KAI A;  2Y8N B;  3TDB A;  2XPA A;  4U86 A;  2F21 A;  1NMV A;  1EG4 A;  5CQ2 A;  5E5W A;  2DMV A;  4A0T A;  1WMV A;  2JXW A;  1YW5 A;  2ZQU A;  3MQH A;  3M85 A;  2YSF A;  2XPB A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...