5CQ2A

Crystal structure of tandem ww domains of itch in complex with txnip peptide
Total Genus 11
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
11
sequence length
80
structure length
76
Chain Sequence
GPLPPGWEKRTDSNGRVYFVNHNTRITQWEDPRSQEKPLPEGWEMRFTVDGIPYFVDHNRRTTTYIDPRTGKSALD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Ligase
molecule keywords E3 ubiquitin-protein ligase Itchy homolog
publication title Structural basis for the regulatory role of the PPxY motifs in the thioredoxin-interacting protein TXNIP.
pubmed doi rcsb
source organism Homo sapiens
total genus 11
structure length 76
sequence length 80
ec nomenclature ec 2.3.2.26: HECT-type E3 ubiquitin transferase.
pdb deposition date 2015-07-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00397 WW WW domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.20.70.10 Mainly Beta Single Sheet Ubiquitin Ligase Nedd4; Chain: W; Ubiquitin Ligase Nedd4; Chain: W; 5cq2A02
2JV4A 2ZR4A 3WH0A 2KXQA 2M8JA 2YSFA 3LE4A 2XPBA 2ZR6A 1WR7A 2Q5AA 2EZ5W 1PINA 3L4HA 2XPAA 5CQ2A 3TCZA 4REXA 2XP6A 2MDIA 3KADA 2F21A 3M7NA 2YSIA 3TDBA 2M8IA 2ZQSA 2LAJA 2XP8A 2JXWA 3KAGA 4U85A 2ZQTA 1EG3A 3CNGA 3ODKA 2RE3A 3M85A 1EG4A 2ITKA 2ZQUA 3NTPA 4U86A 2DK1A 1O6WA 1JMQA 3KABA 2YSHA 2ZQVA 2DMVA 2DWVA 3OOBA 2DJYA 1ZCNA 2YSBA 5AHTA 1K9RA 2XP3A 2ZAJA 2XP4A 4U84A 3KAHA 2JMFA 1WMVA 3KAFA 2BA1A 2M3OW 2JX8A 2L4JA 2ZR5A 4QIBA 2DK7A 2XP7A 3KAIA 4E5RA 1TK7A 1K9QA 1I5HW 1F8AB 3TC5A 2XP5A 1NMVA 1YW5A 2XP9A 3KCEA 2YSGA 2E45A
chains in the Genus database with same CATH superfamily
3LKXA 5E64A 2JV4A 2ZR4A 3WH0A 2KXQA 2M8JA 2YSFA 3LE4A 2XPBA 2ZR6A 1WR7A 2Q5AA 3MQHA 1FLCA 2EZ5W 1PINA 2QRVA 3L4HA 2XPAA 5CQ2A 3TCZA 4REXA 2XP6A 1TR8A 2MDIA 3KADA 2F21A 4GLXA 2WAEA 5U47A 3M7NA 2YSIA 3TDBA 2M8IA 2ZQSA 2LAJA 2XP8A 2JXWA 2WADA 3KAGA 4U85A 3MQGA 2ZQTA 1EG3A 3CNGA 3MCBA 3ODKA 2RE3A 3M85A 1EG4A 2ITKA 2ZQUA 3NTPA 4U86A 2DK1A 1O6WA 1JMQA 3KABA 2YSHA 2ZQVA 2DMVA 2DWVA 3OOBA 2DJYA 1ZCNA 2YSBA 5AHTA 1K9RA 5E65A 2XP3A 2ZAJA 2XP4A 5E62A 4U84A 3KAHA 2OWOA 2JMFA 1WMVA 3LKXB 3KAFA 5E5WA 2BA1A 2M3OW 2JX8A 2L4JA 2ZR5A 3MCBB 3FSCA 4QIBA 2DK7A 5E66A 2XP7A 3KAIA 3PQHA 4E5RA 4A0UA 1TK7A 1K9QA 1I5HW 1F8AB 3TC5A 2XP5A 1NMVA 1YW5A 2YAJB 3FSBA 4A0TA 1RP5A 3FS8A 2Y8NB 2XP9A 3KCEA 2YSGA 2E45A
chains in the Genus database with same CATH topology
3LKXA 5E64A 2JV4A 2ZR4A 3WH0A 2KXQA 2M8JA 2YSFA 3LE4A 2XPBA 2ZR6A 1WR7A 2Q5AA 3MQHA 1FLCA 2EZ5W 1PINA 2QRVA 3L4HA 2XPAA 5CQ2A 3TCZA 4REXA 2XP6A 1TR8A 2MDIA 3KADA 2F21A 4GLXA 2WAEA 5U47A 3M7NA 2YSIA 3TDBA 2M8IA 2ZQSA 2LAJA 2XP8A 2JXWA 2WADA 3KAGA 4U85A 3MQGA 2ZQTA 1EG3A 3CNGA 3MCBA 3ODKA 2RE3A 3M85A 1EG4A 2ITKA 2ZQUA 3NTPA 4U86A 2DK1A 1O6WA 1JMQA 3KABA 2YSHA 2ZQVA 2DMVA 2DWVA 3OOBA 2DJYA 1ZCNA 2YSBA 5AHTA 1K9RA 5E65A 2XP3A 2ZAJA 2XP4A 5E62A 4U84A 3KAHA 2OWOA 2JMFA 1WMVA 3LKXB 3KAFA 5E5WA 2BA1A 2M3OW 2JX8A 2L4JA 2ZR5A 3MCBB 3FSCA 4QIBA 2DK7A 5E66A 2XP7A 3KAIA 3PQHA 4E5RA 4A0UA 1TK7A 1K9QA 1I5HW 1F8AB 3TC5A 2XP5A 1NMVA 1YW5A 2YAJB 3FSBA 4A0TA 1RP5A 3FS8A 2Y8NB 2XP9A 3KCEA 2YSGA 2E45A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2JV4 A;  2ZR4 A;  3WH0 A;  2KXQ A;  2M8J A;  2YSF A;  3LE4 A;  2XPB A;  2ZR6 A;  1WR7 A;  2Q5A A;  2EZ5 W;  1PIN A;  3L4H A;  2XPA A;  5CQ2 A;  3TCZ A;  4REX A;  2XP6 A;  2MDI A;  3KAD A;  2F21 A;  3M7N A;  2YSI A;  3TDB A;  2M8I A;  2ZQS A;  2LAJ A;  2XP8 A;  2JXW A;  3KAG A;  4U85 A;  2ZQT A;  1EG3 A;  3CNG A;  3ODK A;  2RE3 A;  3M85 A;  1EG4 A;  2ITK A;  2ZQU A;  3NTP A;  4U86 A;  2DK1 A;  1O6W A;  1JMQ A;  3KAB A;  2YSH A;  2ZQV A;  2DMV A;  2DWV A;  3OOB A;  2DJY A;  1ZCN A;  2YSB A;  5AHT A;  1K9R A;  2XP3 A;  2ZAJ A;  2XP4 A;  4U84 A;  3KAH A;  2JMF A;  1WMV A;  3KAF A;  2BA1 A;  2M3O W;  2JX8 A;  2L4J A;  2ZR5 A;  4QIB A;  2DK7 A;  2XP7 A;  3KAI A;  4E5R A;  1TK7 A;  1K9Q A;  1I5H W;  1F8A B;  3TC5 A;  2XP5 A;  1NMV A;  1YW5 A;  2XP9 A;  3KCE A;  2YSG A;  2E45 A; 
#chains in the Genus database with same CATH topology
 3LKX A;  5E64 A;  2JV4 A;  2ZR4 A;  3WH0 A;  2KXQ A;  2M8J A;  2YSF A;  3LE4 A;  2XPB A;  2ZR6 A;  1WR7 A;  2Q5A A;  3MQH A;  1FLC A;  2EZ5 W;  1PIN A;  2QRV A;  3L4H A;  2XPA A;  5CQ2 A;  3TCZ A;  4REX A;  2XP6 A;  1TR8 A;  2MDI A;  3KAD A;  2F21 A;  4GLX A;  2WAE A;  5U47 A;  3M7N A;  2YSI A;  3TDB A;  2M8I A;  2ZQS A;  2LAJ A;  2XP8 A;  2JXW A;  2WAD A;  3KAG A;  4U85 A;  3MQG A;  2ZQT A;  1EG3 A;  3CNG A;  3MCB A;  3ODK A;  2RE3 A;  3M85 A;  1EG4 A;  2ITK A;  2ZQU A;  3NTP A;  4U86 A;  2DK1 A;  1O6W A;  1JMQ A;  3KAB A;  2YSH A;  2ZQV A;  2DMV A;  2DWV A;  3OOB A;  2DJY A;  1ZCN A;  2YSB A;  5AHT A;  1K9R A;  5E65 A;  2XP3 A;  2ZAJ A;  2XP4 A;  5E62 A;  4U84 A;  3KAH A;  2OWO A;  2JMF A;  1WMV A;  3LKX B;  3KAF A;  5E5W A;  2BA1 A;  2M3O W;  2JX8 A;  2L4J A;  2ZR5 A;  3MCB B;  3FSC A;  4QIB A;  2DK7 A;  5E66 A;  2XP7 A;  3KAI A;  3PQH A;  4E5R A;  4A0U A;  1TK7 A;  1K9Q A;  1I5H W;  1F8A B;  3TC5 A;  2XP5 A;  1NMV A;  1YW5 A;  2YAJ B;  3FSB A;  4A0T A;  1RP5 A;  3FS8 A;  2Y8N B;  2XP9 A;  3KCE A;  2YSG A;  2E45 A; 
#chains in the Genus database with same CATH homology
 3LKX A;  5E64 A;  2JV4 A;  2ZR4 A;  3WH0 A;  2KXQ A;  2M8J A;  2YSF A;  3LE4 A;  2XPB A;  2ZR6 A;  1WR7 A;  2Q5A A;  3MQH A;  1FLC A;  2EZ5 W;  1PIN A;  2QRV A;  3L4H A;  2XPA A;  5CQ2 A;  3TCZ A;  4REX A;  2XP6 A;  1TR8 A;  2MDI A;  3KAD A;  2F21 A;  4GLX A;  2WAE A;  5U47 A;  3M7N A;  2YSI A;  3TDB A;  2M8I A;  2ZQS A;  2LAJ A;  2XP8 A;  2JXW A;  2WAD A;  3KAG A;  4U85 A;  3MQG A;  2ZQT A;  1EG3 A;  3CNG A;  3MCB A;  3ODK A;  2RE3 A;  3M85 A;  1EG4 A;  2ITK A;  2ZQU A;  3NTP A;  4U86 A;  2DK1 A;  1O6W A;  1JMQ A;  3KAB A;  2YSH A;  2ZQV A;  2DMV A;  2DWV A;  3OOB A;  2DJY A;  1ZCN A;  2YSB A;  5AHT A;  1K9R A;  5E65 A;  2XP3 A;  2ZAJ A;  2XP4 A;  5E62 A;  4U84 A;  3KAH A;  2OWO A;  2JMF A;  1WMV A;  3LKX B;  3KAF A;  5E5W A;  2BA1 A;  2M3O W;  2JX8 A;  2L4J A;  2ZR5 A;  3MCB B;  3FSC A;  4QIB A;  2DK7 A;  5E66 A;  2XP7 A;  3KAI A;  3PQH A;  4E5R A;  4A0U A;  1TK7 A;  1K9Q A;  1I5H W;  1F8A B;  3TC5 A;  2XP5 A;  1NMV A;  1YW5 A;  2YAJ B;  3FSB A;  4A0T A;  1RP5 A;  3FS8 A;  2Y8N B;  2XP9 A;  3KCE A;  2YSG A;  2E45 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...