5CQ2A

Crystal structure of tandem ww domains of itch in complex with txnip peptide
Total Genus 11
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
11
sequence length
80
structure length
76
Chain Sequence
GPLPPGWEKRTDSNGRVYFVNHNTRITQWEDPRSQEKPLPEGWEMRFTVDGIPYFVDHNRRTTTYIDPRTGKSALD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords E3 ubiquitin-protein ligase Itchy homolog
publication title Structural basis for the regulatory role of the PPxY motifs in the thioredoxin-interacting protein TXNIP.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Ligase
total genus 11
structure length 76
sequence length 80
ec nomenclature ec 2.3.2.26: HECT-type E3 ubiquitin transferase.
pdb deposition date 2015-07-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00397 WW WW domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.20.70.10 Mainly Beta Single Sheet Ubiquitin Ligase Nedd4; Chain: W; Ubiquitin Ligase Nedd4; Chain: W; 5cq2A02
2KXQA 3ODKA 2DK7A 3KAFA 2XPAA 2YSIA 1K9QA 3KAIA 2DMVA 2JMFA 5AHTA 1K9RA 2LAJA 4E5RA 2M3OW 2ZAJA 2BA1A 3M85A 1NMVA 1EG4A 2M8JA 3CNGA 2M8IA 1YW5A 2ZQUA 1EG3A 2ZQVA 2YSHA 2YSBA 2RE3A 4U85A 1F8AB 3TDBA 2XPBA 5CQ2A 4U84A 2ZR5A 3LE4A 2JV4A 2XP6A 2XP4A 2XP8A 3TC5A 1WMVA 3L4HA 3KCEA 2XP5A 3KAGA 2ZQTA 3TCZA 1I5HW 2F21A 2ZR4A 2ZR6A 2ITKA 2E45A 1TK7A 3NTPA 2YSFA 2YSGA 3OOBA 4QIBA 1O6WA 2XP3A 2DWVA 2EZ5W 3M7NA 2XP7A 1PINA 2MDIA 2L4JA 2Q5AA 2DJYA 2ZQSA 1WR7A 3KAHA 3KABA 3KADA 3WH0A 4REXA 4U86A 2DK1A 2JX8A 2XP9A 1ZCNA 2JXWA 1JMQA
chains in the Genus database with same CATH superfamily
2KXQA 3PQHA 2OWOA 3ODKA 3LKXB 2DK7A 3KAFA 2XPAA 2YSIA 5E64A 1K9QA 3KAIA 2DMVA 2JMFA 5AHTA 3FSCA 1K9RA 2LAJA 4E5RA 1TR8A 2M3OW 2ZAJA 2BA1A 3MCBA 3M85A 5U47A 1NMVA 1EG4A 2WAEA 2M8JA 3CNGA 2M8IA 1YW5A 3FSBA 3MQGA 2ZQUA 1EG3A 2ZQVA 2YSHA 2YSBA 2RE3A 3FS8A 2WADA 4U85A 1F8AB 3TDBA 2XPBA 5CQ2A 2Y8NB 5E62A 4U84A 2ZR5A 3LE4A 1RP5A 2JV4A 2XP6A 2YAJB 2XP4A 4A0UA 2XP8A 3TC5A 1WMVA 3L4HA 3KCEA 2XP5A 3KAGA 2ZQTA 3TCZA 1I5HW 2F21A 2ZR4A 2ZR6A 2ITKA 3MCBB 2E45A 1TK7A 3NTPA 2QRVA 3LKXA 4A0TA 2YSFA 2YSGA 3OOBA 4QIBA 1O6WA 2XP3A 2DWVA 2EZ5W 3M7NA 2XP7A 5E5WA 1PINA 5E65A 2MDIA 1FLCA 2L4JA 2Q5AA 2DJYA 3MQHA 2ZQSA 1WR7A 3KAHA 3KABA 3KADA 3WH0A 4REXA 4U86A 2DK1A 4GLXA 2JX8A 2XP9A 5E66A 1ZCNA 2JXWA 1JMQA
chains in the Genus database with same CATH topology
2KXQA 3PQHA 2OWOA 3ODKA 3LKXB 2DK7A 3KAFA 2XPAA 2YSIA 5E64A 1K9QA 3KAIA 2DMVA 2JMFA 5AHTA 3FSCA 1K9RA 2LAJA 4E5RA 1TR8A 2M3OW 2ZAJA 2BA1A 3MCBA 3M85A 5U47A 1NMVA 1EG4A 2WAEA 2M8JA 3CNGA 2M8IA 1YW5A 3FSBA 3MQGA 2ZQUA 1EG3A 2ZQVA 2YSHA 2YSBA 2RE3A 3FS8A 2WADA 4U85A 1F8AB 3TDBA 2XPBA 5CQ2A 2Y8NB 5E62A 4U84A 2ZR5A 3LE4A 1RP5A 2JV4A 2XP6A 2YAJB 2XP4A 4A0UA 2XP8A 3TC5A 1WMVA 3L4HA 3KCEA 2XP5A 3KAGA 2ZQTA 3TCZA 1I5HW 2F21A 2ZR4A 2ZR6A 2ITKA 3MCBB 2E45A 1TK7A 3NTPA 2QRVA 3LKXA 4A0TA 2YSFA 2YSGA 3OOBA 4QIBA 1O6WA 2XP3A 2DWVA 2EZ5W 3M7NA 2XP7A 5E5WA 1PINA 5E65A 2MDIA 1FLCA 2L4JA 2Q5AA 2DJYA 3MQHA 2ZQSA 1WR7A 3KAHA 3KABA 3KADA 3WH0A 4REXA 4U86A 2DK1A 4GLXA 2JX8A 2XP9A 5E66A 1ZCNA 2JXWA 1JMQA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2KXQ A;  3ODK A;  2DK7 A;  3KAF A;  2XPA A;  2YSI A;  1K9Q A;  3KAI A;  2DMV A;  2JMF A;  5AHT A;  1K9R A;  2LAJ A;  4E5R A;  2M3O W;  2ZAJ A;  2BA1 A;  3M85 A;  1NMV A;  1EG4 A;  2M8J A;  3CNG A;  2M8I A;  1YW5 A;  2ZQU A;  1EG3 A;  2ZQV A;  2YSH A;  2YSB A;  2RE3 A;  4U85 A;  1F8A B;  3TDB A;  2XPB A;  5CQ2 A;  4U84 A;  2ZR5 A;  3LE4 A;  2JV4 A;  2XP6 A;  2XP4 A;  2XP8 A;  3TC5 A;  1WMV A;  3L4H A;  3KCE A;  2XP5 A;  3KAG A;  2ZQT A;  3TCZ A;  1I5H W;  2F21 A;  2ZR4 A;  2ZR6 A;  2ITK A;  2E45 A;  1TK7 A;  3NTP A;  2YSF A;  2YSG A;  3OOB A;  4QIB A;  1O6W A;  2XP3 A;  2DWV A;  2EZ5 W;  3M7N A;  2XP7 A;  1PIN A;  2MDI A;  2L4J A;  2Q5A A;  2DJY A;  2ZQS A;  1WR7 A;  3KAH A;  3KAB A;  3KAD A;  3WH0 A;  4REX A;  4U86 A;  2DK1 A;  2JX8 A;  2XP9 A;  1ZCN A;  2JXW A;  1JMQ A; 
#chains in the Genus database with same CATH topology
 2KXQ A;  3PQH A;  2OWO A;  3ODK A;  3LKX B;  2DK7 A;  3KAF A;  2XPA A;  2YSI A;  5E64 A;  1K9Q A;  3KAI A;  2DMV A;  2JMF A;  5AHT A;  3FSC A;  1K9R A;  2LAJ A;  4E5R A;  1TR8 A;  2M3O W;  2ZAJ A;  2BA1 A;  3MCB A;  3M85 A;  5U47 A;  1NMV A;  1EG4 A;  2WAE A;  2M8J A;  3CNG A;  2M8I A;  1YW5 A;  3FSB A;  3MQG A;  2ZQU A;  1EG3 A;  2ZQV A;  2YSH A;  2YSB A;  2RE3 A;  3FS8 A;  2WAD A;  4U85 A;  1F8A B;  3TDB A;  2XPB A;  5CQ2 A;  2Y8N B;  5E62 A;  4U84 A;  2ZR5 A;  3LE4 A;  1RP5 A;  2JV4 A;  2XP6 A;  2YAJ B;  2XP4 A;  4A0U A;  2XP8 A;  3TC5 A;  1WMV A;  3L4H A;  3KCE A;  2XP5 A;  3KAG A;  2ZQT A;  3TCZ A;  1I5H W;  2F21 A;  2ZR4 A;  2ZR6 A;  2ITK A;  3MCB B;  2E45 A;  1TK7 A;  3NTP A;  2QRV A;  3LKX A;  4A0T A;  2YSF A;  2YSG A;  3OOB A;  4QIB A;  1O6W A;  2XP3 A;  2DWV A;  2EZ5 W;  3M7N A;  2XP7 A;  5E5W A;  1PIN A;  5E65 A;  2MDI A;  1FLC A;  2L4J A;  2Q5A A;  2DJY A;  3MQH A;  2ZQS A;  1WR7 A;  3KAH A;  3KAB A;  3KAD A;  3WH0 A;  4REX A;  4U86 A;  2DK1 A;  4GLX A;  2JX8 A;  2XP9 A;  5E66 A;  1ZCN A;  2JXW A;  1JMQ A; 
#chains in the Genus database with same CATH homology
 2KXQ A;  3PQH A;  2OWO A;  3ODK A;  3LKX B;  2DK7 A;  3KAF A;  2XPA A;  2YSI A;  5E64 A;  1K9Q A;  3KAI A;  2DMV A;  2JMF A;  5AHT A;  3FSC A;  1K9R A;  2LAJ A;  4E5R A;  1TR8 A;  2M3O W;  2ZAJ A;  2BA1 A;  3MCB A;  3M85 A;  5U47 A;  1NMV A;  1EG4 A;  2WAE A;  2M8J A;  3CNG A;  2M8I A;  1YW5 A;  3FSB A;  3MQG A;  2ZQU A;  1EG3 A;  2ZQV A;  2YSH A;  2YSB A;  2RE3 A;  3FS8 A;  2WAD A;  4U85 A;  1F8A B;  3TDB A;  2XPB A;  5CQ2 A;  2Y8N B;  5E62 A;  4U84 A;  2ZR5 A;  3LE4 A;  1RP5 A;  2JV4 A;  2XP6 A;  2YAJ B;  2XP4 A;  4A0U A;  2XP8 A;  3TC5 A;  1WMV A;  3L4H A;  3KCE A;  2XP5 A;  3KAG A;  2ZQT A;  3TCZ A;  1I5H W;  2F21 A;  2ZR4 A;  2ZR6 A;  2ITK A;  3MCB B;  2E45 A;  1TK7 A;  3NTP A;  2QRV A;  3LKX A;  4A0T A;  2YSF A;  2YSG A;  3OOB A;  4QIB A;  1O6W A;  2XP3 A;  2DWV A;  2EZ5 W;  3M7N A;  2XP7 A;  5E5W A;  1PIN A;  5E65 A;  2MDI A;  1FLC A;  2L4J A;  2Q5A A;  2DJY A;  3MQH A;  2ZQS A;  1WR7 A;  3KAH A;  3KAB A;  3KAD A;  3WH0 A;  4REX A;  4U86 A;  2DK1 A;  4GLX A;  2JX8 A;  2XP9 A;  5E66 A;  1ZCN A;  2JXW A;  1JMQ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...