5CQ2A

Crystal structure of tandem ww domains of itch in complex with txnip peptide
Total Genus 11
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
11
sequence length
80
structure length
76
Chain Sequence
GPLPPGWEKRTDSNGRVYFVNHNTRITQWEDPRSQEKPLPEGWEMRFTVDGIPYFVDHNRRTTTYIDPRTGKSALD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords E3 ubiquitin-protein ligase Itchy homolog
publication title Structural basis for the regulatory role of the PPxY motifs in the thioredoxin-interacting protein TXNIP.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Ligase
total genus 11
structure length 76
sequence length 80
ec nomenclature ec 2.3.2.26: HECT-type E3 ubiquitin transferase.
pdb deposition date 2015-07-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00397 WW WW domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.20.70.10 Mainly Beta Single Sheet Ubiquitin Ligase Nedd4; Chain: W; Ubiquitin Ligase Nedd4; Chain: W; 5cq2A02
2YSGA 3M7NA 2XP4A 1YW5A 3KCEA 2RE3A 2Q5AA 3TCZA 1TK7A 3KAGA 2DK7A 2ZQVA 3KADA 3KAHA 2LAJA 2JV4A 3TC5A 4U86A 1PINA 1I5HW 1EG4A 2L4JA 2ZQSA 3CNGA 3L4HA 2ZR6A 2M8IA 1K9QA 1EG3A 2BA1A 1O6WA 2ZQTA 2KXQA 2DJYA 2JX8A 2YSHA 3KAIA 2YSIA 2ZR5A 2ZAJA 2YSBA 4U84A 1WR7A 3OOBA 2M3OW 2XP5A 2YSFA 5CQ2A 1ZCNA 3KABA 3TDBA 5AHTA 1JMQA 2F21A 2MDIA 4QIBA 2XP9A 3ODKA 4U85A 2XPAA 2DWVA 2JXWA 2XP3A 2XP6A 1F8AB 3WH0A 2XPBA 3LE4A 3NTPA 2ZR4A 2JMFA 4E5RA 1WMVA 2DMVA 2M8JA 2EZ5W 2E45A 3KAFA 1NMVA 3M85A 4REXA 2DK1A 2XP7A 1K9RA 2XP8A 2ITKA 2ZQUA
chains in the Genus database with same CATH superfamily
2YSGA 5E62A 3M7NA 2XP4A 1YW5A 3KCEA 2RE3A 2Q5AA 3TCZA 1TK7A 3KAGA 2DK7A 4A0TA 2ZQVA 3KADA 3KAHA 2LAJA 2JV4A 5U47A 4U86A 3TC5A 1PINA 1I5HW 3MCBA 1EG4A 2L4JA 2ZQSA 3CNGA 3L4HA 2ZR6A 2M8IA 1K9QA 1EG3A 1FLCA 2BA1A 1O6WA 3MCBB 3FSCA 2ZQTA 2KXQA 2DJYA 2JX8A 2YSHA 3KAIA 2YSIA 2ZR5A 2ZAJA 3FS8A 2YSBA 4U84A 1WR7A 3OOBA 2M3OW 2WADA 3PQHA 2XP5A 2YSFA 1RP5A 5CQ2A 1ZCNA 3KABA 5E5WA 3TDBA 5AHTA 1JMQA 1TR8A 2F21A 2MDIA 4QIBA 2XP9A 3ODKA 4U85A 2XPAA 2DWVA 2JXWA 5E64A 2XP3A 2XP6A 1F8AB 3WH0A 2XPBA 3LE4A 3NTPA 2OWOA 2ZR4A 3MQHA 2JMFA 3LKXA 5E65A 4E5RA 1WMVA 5E66A 2DMVA 2M8JA 2EZ5W 4GLXA 3LKXB 2E45A 3KAFA 1NMVA 2Y8NB 3M85A 2WAEA 4REXA 4A0UA 2DK1A 2XP7A 2YAJB 1K9RA 3MQGA 2QRVA 2XP8A 3FSBA 2ITKA 2ZQUA
chains in the Genus database with same CATH topology
2YSGA 5E62A 3M7NA 2XP4A 1YW5A 3KCEA 2RE3A 2Q5AA 3TCZA 1TK7A 3KAGA 2DK7A 4A0TA 2ZQVA 3KADA 3KAHA 2LAJA 2JV4A 5U47A 4U86A 3TC5A 1PINA 1I5HW 3MCBA 1EG4A 2L4JA 2ZQSA 3CNGA 3L4HA 2ZR6A 2M8IA 1K9QA 1EG3A 1FLCA 2BA1A 1O6WA 3MCBB 3FSCA 2ZQTA 2KXQA 2DJYA 2JX8A 2YSHA 3KAIA 2YSIA 2ZR5A 2ZAJA 3FS8A 2YSBA 4U84A 1WR7A 3OOBA 2M3OW 2WADA 3PQHA 2XP5A 2YSFA 1RP5A 5CQ2A 1ZCNA 3KABA 5E5WA 3TDBA 5AHTA 1JMQA 1TR8A 2F21A 2MDIA 4QIBA 2XP9A 3ODKA 4U85A 2XPAA 2DWVA 2JXWA 5E64A 2XP3A 2XP6A 1F8AB 3WH0A 2XPBA 3LE4A 3NTPA 2OWOA 2ZR4A 3MQHA 2JMFA 3LKXA 5E65A 4E5RA 1WMVA 5E66A 2DMVA 2M8JA 2EZ5W 4GLXA 3LKXB 2E45A 3KAFA 1NMVA 2Y8NB 3M85A 2WAEA 4REXA 4A0UA 2DK1A 2XP7A 2YAJB 1K9RA 3MQGA 2QRVA 2XP8A 3FSBA 2ITKA 2ZQUA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2YSG A;  3M7N A;  2XP4 A;  1YW5 A;  3KCE A;  2RE3 A;  2Q5A A;  3TCZ A;  1TK7 A;  3KAG A;  2DK7 A;  2ZQV A;  3KAD A;  3KAH A;  2LAJ A;  2JV4 A;  3TC5 A;  4U86 A;  1PIN A;  1I5H W;  1EG4 A;  2L4J A;  2ZQS A;  3CNG A;  3L4H A;  2ZR6 A;  2M8I A;  1K9Q A;  1EG3 A;  2BA1 A;  1O6W A;  2ZQT A;  2KXQ A;  2DJY A;  2JX8 A;  2YSH A;  3KAI A;  2YSI A;  2ZR5 A;  2ZAJ A;  2YSB A;  4U84 A;  1WR7 A;  3OOB A;  2M3O W;  2XP5 A;  2YSF A;  5CQ2 A;  1ZCN A;  3KAB A;  3TDB A;  5AHT A;  1JMQ A;  2F21 A;  2MDI A;  4QIB A;  2XP9 A;  3ODK A;  4U85 A;  2XPA A;  2DWV A;  2JXW A;  2XP3 A;  2XP6 A;  1F8A B;  3WH0 A;  2XPB A;  3LE4 A;  3NTP A;  2ZR4 A;  2JMF A;  4E5R A;  1WMV A;  2DMV A;  2M8J A;  2EZ5 W;  2E45 A;  3KAF A;  1NMV A;  3M85 A;  4REX A;  2DK1 A;  2XP7 A;  1K9R A;  2XP8 A;  2ITK A;  2ZQU A; 
#chains in the Genus database with same CATH topology
 2YSG A;  5E62 A;  3M7N A;  2XP4 A;  1YW5 A;  3KCE A;  2RE3 A;  2Q5A A;  3TCZ A;  1TK7 A;  3KAG A;  2DK7 A;  4A0T A;  2ZQV A;  3KAD A;  3KAH A;  2LAJ A;  2JV4 A;  5U47 A;  4U86 A;  3TC5 A;  1PIN A;  1I5H W;  3MCB A;  1EG4 A;  2L4J A;  2ZQS A;  3CNG A;  3L4H A;  2ZR6 A;  2M8I A;  1K9Q A;  1EG3 A;  1FLC A;  2BA1 A;  1O6W A;  3MCB B;  3FSC A;  2ZQT A;  2KXQ A;  2DJY A;  2JX8 A;  2YSH A;  3KAI A;  2YSI A;  2ZR5 A;  2ZAJ A;  3FS8 A;  2YSB A;  4U84 A;  1WR7 A;  3OOB A;  2M3O W;  2WAD A;  3PQH A;  2XP5 A;  2YSF A;  1RP5 A;  5CQ2 A;  1ZCN A;  3KAB A;  5E5W A;  3TDB A;  5AHT A;  1JMQ A;  1TR8 A;  2F21 A;  2MDI A;  4QIB A;  2XP9 A;  3ODK A;  4U85 A;  2XPA A;  2DWV A;  2JXW A;  5E64 A;  2XP3 A;  2XP6 A;  1F8A B;  3WH0 A;  2XPB A;  3LE4 A;  3NTP A;  2OWO A;  2ZR4 A;  3MQH A;  2JMF A;  3LKX A;  5E65 A;  4E5R A;  1WMV A;  5E66 A;  2DMV A;  2M8J A;  2EZ5 W;  4GLX A;  3LKX B;  2E45 A;  3KAF A;  1NMV A;  2Y8N B;  3M85 A;  2WAE A;  4REX A;  4A0U A;  2DK1 A;  2XP7 A;  2YAJ B;  1K9R A;  3MQG A;  2QRV A;  2XP8 A;  3FSB A;  2ITK A;  2ZQU A; 
#chains in the Genus database with same CATH homology
 2YSG A;  5E62 A;  3M7N A;  2XP4 A;  1YW5 A;  3KCE A;  2RE3 A;  2Q5A A;  3TCZ A;  1TK7 A;  3KAG A;  2DK7 A;  4A0T A;  2ZQV A;  3KAD A;  3KAH A;  2LAJ A;  2JV4 A;  5U47 A;  4U86 A;  3TC5 A;  1PIN A;  1I5H W;  3MCB A;  1EG4 A;  2L4J A;  2ZQS A;  3CNG A;  3L4H A;  2ZR6 A;  2M8I A;  1K9Q A;  1EG3 A;  1FLC A;  2BA1 A;  1O6W A;  3MCB B;  3FSC A;  2ZQT A;  2KXQ A;  2DJY A;  2JX8 A;  2YSH A;  3KAI A;  2YSI A;  2ZR5 A;  2ZAJ A;  3FS8 A;  2YSB A;  4U84 A;  1WR7 A;  3OOB A;  2M3O W;  2WAD A;  3PQH A;  2XP5 A;  2YSF A;  1RP5 A;  5CQ2 A;  1ZCN A;  3KAB A;  5E5W A;  3TDB A;  5AHT A;  1JMQ A;  1TR8 A;  2F21 A;  2MDI A;  4QIB A;  2XP9 A;  3ODK A;  4U85 A;  2XPA A;  2DWV A;  2JXW A;  5E64 A;  2XP3 A;  2XP6 A;  1F8A B;  3WH0 A;  2XPB A;  3LE4 A;  3NTP A;  2OWO A;  2ZR4 A;  3MQH A;  2JMF A;  3LKX A;  5E65 A;  4E5R A;  1WMV A;  5E66 A;  2DMV A;  2M8J A;  2EZ5 W;  4GLX A;  3LKX B;  2E45 A;  3KAF A;  1NMV A;  2Y8N B;  3M85 A;  2WAE A;  4REX A;  4A0U A;  2DK1 A;  2XP7 A;  2YAJ B;  1K9R A;  3MQG A;  2QRV A;  2XP8 A;  3FSB A;  2ITK A;  2ZQU A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...