1JMQA

Yap65 (l30k mutant) ww domain in complex with gtppppytvg peptide
Total Genus 2
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
2
sequence length
46
structure length
46
Chain Sequence
FEIPDDVPLPAGWEMAKTSSGQRYFKNHIDQTTTWQDPRKAMLSQM
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Structural protein
molecule keywords 65 KDA YES-ASSOCIATED PROTEIN
publication title Solution structures of the YAP65 WW domain and the variant L30 K in complex with the peptides GTPPPPYTVG, N-(n-octyl)-GPPPY and PLPPY and the application of peptide libraries reveal a minimal binding epitope.
pubmed doi rcsb
source organism Homo sapiens
total genus 2
structure length 46
sequence length 46
ec nomenclature
pdb deposition date 2001-07-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00397 WW WW domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.20.70.10 Mainly Beta Single Sheet Ubiquitin Ligase Nedd4; Chain: W; Ubiquitin Ligase Nedd4; Chain: W; 1jmqA00
3M7NA 3LE4A 3TDBA 3CNGA 2JX8A 1JMQA 3TC5A 2F21A 2ZQSA 1EG4A 2MDIA 3NTPA 3KABA 2ITKA 2JXWA 2YSBA 2DWVA 2ZQUA 2M8IA 3ODKA 2XP8A 3KAIA 1F8AB 2EZ5W 2XPAA 2RE3A 3KAFA 4E5RA 2LAJA 3KAHA 2KXQA 2XP9A 3KADA 2DMVA 1WR7A 2DK1A 5CQ2A 2Q5AA 2YSGA 1EG3A 4QIBA 3OOBA 2DJYA 3KAGA 1NMVA 2XPBA 1K9QA 2ZR6A 2XP5A 4U85A 1PINA 2ZR4A 2DK7A 1K9RA 4U86A 2ZQVA 3WH0A 5AHTA 2YSIA 2JV4A 2ZQTA 2ZR5A 3M85A 3KCEA 2L4JA 3TCZA 2M8JA 2JMFA 1I5HW 4U84A 1TK7A 1ZCNA 2ZAJA 2YSFA 2BA1A 2M3OW 2XP3A 2XP6A 2XP4A 2E45A 2XP7A 3L4HA 1O6WA 1YW5A 4REXA 1WMVA 2YSHA
chains in the Genus database with same CATH superfamily
3M7NA 3LE4A 3TDBA 3FSBA 3CNGA 2JX8A 5E62A 1JMQA 3TC5A 2F21A 2ZQSA 1EG4A 2MDIA 3NTPA 1FLCA 3KABA 2ITKA 2JXWA 2YSBA 3MCBA 2DWVA 2QRVA 2ZQUA 2M8IA 3ODKA 2XP8A 3KAIA 1F8AB 2EZ5W 2XPAA 2RE3A 3KAFA 4E5RA 2LAJA 3KAHA 5E66A 2KXQA 2XP9A 3KADA 3PQHA 2DMVA 1WR7A 2DK1A 5CQ2A 3LKXA 2Q5AA 2YSGA 5E5WA 1EG3A 4QIBA 3OOBA 2DJYA 2WAEA 3KAGA 1NMVA 4GLXA 2XPBA 2YAJB 4A0TA 1K9QA 2ZR6A 3FS8A 2XP5A 4U85A 5U47A 1PINA 2ZR4A 3MQGA 5E64A 2DK7A 1K9RA 4U86A 2Y8NB 2ZQVA 3WH0A 5AHTA 2YSIA 2JV4A 2ZQTA 2ZR5A 3M85A 3KCEA 2L4JA 3TCZA 3MCBB 2M8JA 2JMFA 1I5HW 4U84A 1TK7A 1ZCNA 1TR8A 2ZAJA 2YSFA 2BA1A 2M3OW 2WADA 2XP3A 2XP6A 2XP4A 2E45A 2XP7A 2OWOA 3L4HA 3MQHA 3FSCA 1O6WA 4A0UA 1RP5A 3LKXB 1YW5A 5E65A 4REXA 1WMVA 2YSHA
chains in the Genus database with same CATH topology
3M7NA 3LE4A 3TDBA 3FSBA 3CNGA 2JX8A 5E62A 1JMQA 3TC5A 2F21A 2ZQSA 1EG4A 2MDIA 3NTPA 1FLCA 3KABA 2ITKA 2JXWA 2YSBA 3MCBA 2DWVA 2QRVA 2ZQUA 2M8IA 3ODKA 2XP8A 3KAIA 1F8AB 2EZ5W 2XPAA 2RE3A 3KAFA 4E5RA 2LAJA 3KAHA 5E66A 2KXQA 2XP9A 3KADA 3PQHA 2DMVA 1WR7A 2DK1A 5CQ2A 3LKXA 2Q5AA 2YSGA 5E5WA 1EG3A 4QIBA 3OOBA 2DJYA 2WAEA 3KAGA 1NMVA 4GLXA 2XPBA 2YAJB 4A0TA 1K9QA 2ZR6A 3FS8A 2XP5A 4U85A 5U47A 1PINA 2ZR4A 3MQGA 5E64A 2DK7A 1K9RA 4U86A 2Y8NB 2ZQVA 3WH0A 5AHTA 2YSIA 2JV4A 2ZQTA 2ZR5A 3M85A 3KCEA 2L4JA 3TCZA 3MCBB 2M8JA 2JMFA 1I5HW 4U84A 1TK7A 1ZCNA 1TR8A 2ZAJA 2YSFA 2BA1A 2M3OW 2WADA 2XP3A 2XP6A 2XP4A 2E45A 2XP7A 2OWOA 3L4HA 3MQHA 3FSCA 1O6WA 4A0UA 1RP5A 3LKXB 1YW5A 5E65A 4REXA 1WMVA 2YSHA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3M7N A;  3LE4 A;  3TDB A;  3CNG A;  2JX8 A;  1JMQ A;  3TC5 A;  2F21 A;  2ZQS A;  1EG4 A;  2MDI A;  3NTP A;  3KAB A;  2ITK A;  2JXW A;  2YSB A;  2DWV A;  2ZQU A;  2M8I A;  3ODK A;  2XP8 A;  3KAI A;  1F8A B;  2EZ5 W;  2XPA A;  2RE3 A;  3KAF A;  4E5R A;  2LAJ A;  3KAH A;  2KXQ A;  2XP9 A;  3KAD A;  2DMV A;  1WR7 A;  2DK1 A;  5CQ2 A;  2Q5A A;  2YSG A;  1EG3 A;  4QIB A;  3OOB A;  2DJY A;  3KAG A;  1NMV A;  2XPB A;  1K9Q A;  2ZR6 A;  2XP5 A;  4U85 A;  1PIN A;  2ZR4 A;  2DK7 A;  1K9R A;  4U86 A;  2ZQV A;  3WH0 A;  5AHT A;  2YSI A;  2JV4 A;  2ZQT A;  2ZR5 A;  3M85 A;  3KCE A;  2L4J A;  3TCZ A;  2M8J A;  2JMF A;  1I5H W;  4U84 A;  1TK7 A;  1ZCN A;  2ZAJ A;  2YSF A;  2BA1 A;  2M3O W;  2XP3 A;  2XP6 A;  2XP4 A;  2E45 A;  2XP7 A;  3L4H A;  1O6W A;  1YW5 A;  4REX A;  1WMV A;  2YSH A; 
#chains in the Genus database with same CATH topology
 3M7N A;  3LE4 A;  3TDB A;  3FSB A;  3CNG A;  2JX8 A;  5E62 A;  1JMQ A;  3TC5 A;  2F21 A;  2ZQS A;  1EG4 A;  2MDI A;  3NTP A;  1FLC A;  3KAB A;  2ITK A;  2JXW A;  2YSB A;  3MCB A;  2DWV A;  2QRV A;  2ZQU A;  2M8I A;  3ODK A;  2XP8 A;  3KAI A;  1F8A B;  2EZ5 W;  2XPA A;  2RE3 A;  3KAF A;  4E5R A;  2LAJ A;  3KAH A;  5E66 A;  2KXQ A;  2XP9 A;  3KAD A;  3PQH A;  2DMV A;  1WR7 A;  2DK1 A;  5CQ2 A;  3LKX A;  2Q5A A;  2YSG A;  5E5W A;  1EG3 A;  4QIB A;  3OOB A;  2DJY A;  2WAE A;  3KAG A;  1NMV A;  4GLX A;  2XPB A;  2YAJ B;  4A0T A;  1K9Q A;  2ZR6 A;  3FS8 A;  2XP5 A;  4U85 A;  5U47 A;  1PIN A;  2ZR4 A;  3MQG A;  5E64 A;  2DK7 A;  1K9R A;  4U86 A;  2Y8N B;  2ZQV A;  3WH0 A;  5AHT A;  2YSI A;  2JV4 A;  2ZQT A;  2ZR5 A;  3M85 A;  3KCE A;  2L4J A;  3TCZ A;  3MCB B;  2M8J A;  2JMF A;  1I5H W;  4U84 A;  1TK7 A;  1ZCN A;  1TR8 A;  2ZAJ A;  2YSF A;  2BA1 A;  2M3O W;  2WAD A;  2XP3 A;  2XP6 A;  2XP4 A;  2E45 A;  2XP7 A;  2OWO A;  3L4H A;  3MQH A;  3FSC A;  1O6W A;  4A0U A;  1RP5 A;  3LKX B;  1YW5 A;  5E65 A;  4REX A;  1WMV A;  2YSH A; 
#chains in the Genus database with same CATH homology
 3M7N A;  3LE4 A;  3TDB A;  3FSB A;  3CNG A;  2JX8 A;  5E62 A;  1JMQ A;  3TC5 A;  2F21 A;  2ZQS A;  1EG4 A;  2MDI A;  3NTP A;  1FLC A;  3KAB A;  2ITK A;  2JXW A;  2YSB A;  3MCB A;  2DWV A;  2QRV A;  2ZQU A;  2M8I A;  3ODK A;  2XP8 A;  3KAI A;  1F8A B;  2EZ5 W;  2XPA A;  2RE3 A;  3KAF A;  4E5R A;  2LAJ A;  3KAH A;  5E66 A;  2KXQ A;  2XP9 A;  3KAD A;  3PQH A;  2DMV A;  1WR7 A;  2DK1 A;  5CQ2 A;  3LKX A;  2Q5A A;  2YSG A;  5E5W A;  1EG3 A;  4QIB A;  3OOB A;  2DJY A;  2WAE A;  3KAG A;  1NMV A;  4GLX A;  2XPB A;  2YAJ B;  4A0T A;  1K9Q A;  2ZR6 A;  3FS8 A;  2XP5 A;  4U85 A;  5U47 A;  1PIN A;  2ZR4 A;  3MQG A;  5E64 A;  2DK7 A;  1K9R A;  4U86 A;  2Y8N B;  2ZQV A;  3WH0 A;  5AHT A;  2YSI A;  2JV4 A;  2ZQT A;  2ZR5 A;  3M85 A;  3KCE A;  2L4J A;  3TCZ A;  3MCB B;  2M8J A;  2JMF A;  1I5H W;  4U84 A;  1TK7 A;  1ZCN A;  1TR8 A;  2ZAJ A;  2YSF A;  2BA1 A;  2M3O W;  2WAD A;  2XP3 A;  2XP6 A;  2XP4 A;  2E45 A;  2XP7 A;  2OWO A;  3L4H A;  3MQH A;  3FSC A;  1O6W A;  4A0U A;  1RP5 A;  3LKX B;  1YW5 A;  5E65 A;  4REX A;  1WMV A;  2YSH A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...