1JMQA

Yap65 (l30k mutant) ww domain in complex with gtppppytvg peptide
Total Genus 2
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
2
sequence length
46
structure length
46
Chain Sequence
FEIPDDVPLPAGWEMAKTSSGQRYFKNHIDQTTTWQDPRKAMLSQM
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 65 KDA YES-ASSOCIATED PROTEIN
publication title Solution structures of the YAP65 WW domain and the variant L30 K in complex with the peptides GTPPPPYTVG, N-(n-octyl)-GPPPY and PLPPY and the application of peptide libraries reveal a minimal binding epitope.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Structural protein
total genus 2
structure length 46
sequence length 46
ec nomenclature
pdb deposition date 2001-07-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00397 WW WW domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.20.70.10 Mainly Beta Single Sheet Ubiquitin Ligase Nedd4; Chain: W; Ubiquitin Ligase Nedd4; Chain: W; 1jmqA00
1WMVA 2ZQUA 2F21A 2XP9A 4REXA 2DMVA 2JX8A 2DK7A 3LE4A 1F8AB 2XP6A 2YSIA 1YW5A 2LAJA 2L4JA 3CNGA 3NTPA 3TDBA 2E45A 2DJYA 3TCZA 3KAHA 1K9QA 2JXWA 2JV4A 2XP3A 4U85A 2DWVA 3KCEA 2ZR4A 1O6WA 1EG3A 3KADA 2RE3A 2BA1A 2ZAJA 2ZR6A 1K9RA 3ODKA 2ZQTA 2M3OW 2EZ5W 3KAGA 3TC5A 2YSBA 1ZCNA 3WH0A 4E5RA 1JMQA 2ZQSA 2XP5A 3KAFA 2ITKA 2XP7A 3OOBA 2XP4A 2Q5AA 2JMFA 2M8IA 3KABA 2MDIA 1I5HW 2YSHA 2XPAA 5CQ2A 2YSGA 1WR7A 2DK1A 3M7NA 5AHTA 1NMVA 1EG4A 2XP8A 2ZQVA 2M8JA 2YSFA 2KXQA 3L4HA 2XPBA 4U86A 3KAIA 3M85A 4U84A 1PINA 1TK7A 2ZR5A 4QIBA
chains in the Genus database with same CATH superfamily
3MQHA 2OWOA 1WMVA 1TR8A 2ZQUA 2F21A 2XP9A 4REXA 2DMVA 2JX8A 2DK7A 3LE4A 5U47A 3FSCA 1F8AB 2XP6A 3LKXB 2YSIA 1YW5A 2LAJA 5E66A 2L4JA 3CNGA 3NTPA 3TDBA 2E45A 2DJYA 3TCZA 3KAHA 1RP5A 5E5WA 1K9QA 2JXWA 2JV4A 2XP3A 4U85A 2DWVA 3KCEA 3LKXA 2ZR4A 1O6WA 1EG3A 3KADA 2Y8NB 2RE3A 2BA1A 2ZAJA 2ZR6A 1K9RA 3ODKA 2ZQTA 2M3OW 3FS8A 2EZ5W 3KAGA 3TC5A 2YAJB 2YSBA 1FLCA 1ZCNA 3FSBA 3WH0A 2WAEA 4E5RA 4GLXA 1JMQA 2ZQSA 5E62A 2XP5A 3KAFA 3MCBA 2ITKA 2XP7A 3OOBA 2XP4A 2Q5AA 3MQGA 3PQHA 2JMFA 2M8IA 3KABA 2MDIA 1I5HW 2YSHA 3MCBB 2XPAA 5CQ2A 2YSGA 4A0TA 1WR7A 2DK1A 4A0UA 3M7NA 5AHTA 2WADA 1NMVA 1EG4A 2QRVA 2XP8A 2ZQVA 2M8JA 2YSFA 5E64A 5E65A 2KXQA 3L4HA 2XPBA 4U86A 3KAIA 3M85A 4U84A 1PINA 1TK7A 2ZR5A 4QIBA
chains in the Genus database with same CATH topology
3MQHA 2OWOA 1WMVA 1TR8A 2ZQUA 2F21A 2XP9A 4REXA 2DMVA 2JX8A 2DK7A 3LE4A 5U47A 3FSCA 1F8AB 2XP6A 3LKXB 2YSIA 1YW5A 2LAJA 5E66A 2L4JA 3CNGA 3NTPA 3TDBA 2E45A 2DJYA 3TCZA 3KAHA 1RP5A 5E5WA 1K9QA 2JXWA 2JV4A 2XP3A 4U85A 2DWVA 3KCEA 3LKXA 2ZR4A 1O6WA 1EG3A 3KADA 2Y8NB 2RE3A 2BA1A 2ZAJA 2ZR6A 1K9RA 3ODKA 2ZQTA 2M3OW 3FS8A 2EZ5W 3KAGA 3TC5A 2YAJB 2YSBA 1FLCA 1ZCNA 3FSBA 3WH0A 2WAEA 4E5RA 4GLXA 1JMQA 2ZQSA 5E62A 2XP5A 3KAFA 3MCBA 2ITKA 2XP7A 3OOBA 2XP4A 2Q5AA 3MQGA 3PQHA 2JMFA 2M8IA 3KABA 2MDIA 1I5HW 2YSHA 3MCBB 2XPAA 5CQ2A 2YSGA 4A0TA 1WR7A 2DK1A 4A0UA 3M7NA 5AHTA 2WADA 1NMVA 1EG4A 2QRVA 2XP8A 2ZQVA 2M8JA 2YSFA 5E64A 5E65A 2KXQA 3L4HA 2XPBA 4U86A 3KAIA 3M85A 4U84A 1PINA 1TK7A 2ZR5A 4QIBA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1WMV A;  2ZQU A;  2F21 A;  2XP9 A;  4REX A;  2DMV A;  2JX8 A;  2DK7 A;  3LE4 A;  1F8A B;  2XP6 A;  2YSI A;  1YW5 A;  2LAJ A;  2L4J A;  3CNG A;  3NTP A;  3TDB A;  2E45 A;  2DJY A;  3TCZ A;  3KAH A;  1K9Q A;  2JXW A;  2JV4 A;  2XP3 A;  4U85 A;  2DWV A;  3KCE A;  2ZR4 A;  1O6W A;  1EG3 A;  3KAD A;  2RE3 A;  2BA1 A;  2ZAJ A;  2ZR6 A;  1K9R A;  3ODK A;  2ZQT A;  2M3O W;  2EZ5 W;  3KAG A;  3TC5 A;  2YSB A;  1ZCN A;  3WH0 A;  4E5R A;  1JMQ A;  2ZQS A;  2XP5 A;  3KAF A;  2ITK A;  2XP7 A;  3OOB A;  2XP4 A;  2Q5A A;  2JMF A;  2M8I A;  3KAB A;  2MDI A;  1I5H W;  2YSH A;  2XPA A;  5CQ2 A;  2YSG A;  1WR7 A;  2DK1 A;  3M7N A;  5AHT A;  1NMV A;  1EG4 A;  2XP8 A;  2ZQV A;  2M8J A;  2YSF A;  2KXQ A;  3L4H A;  2XPB A;  4U86 A;  3KAI A;  3M85 A;  4U84 A;  1PIN A;  1TK7 A;  2ZR5 A;  4QIB A; 
#chains in the Genus database with same CATH topology
 3MQH A;  2OWO A;  1WMV A;  1TR8 A;  2ZQU A;  2F21 A;  2XP9 A;  4REX A;  2DMV A;  2JX8 A;  2DK7 A;  3LE4 A;  5U47 A;  3FSC A;  1F8A B;  2XP6 A;  3LKX B;  2YSI A;  1YW5 A;  2LAJ A;  5E66 A;  2L4J A;  3CNG A;  3NTP A;  3TDB A;  2E45 A;  2DJY A;  3TCZ A;  3KAH A;  1RP5 A;  5E5W A;  1K9Q A;  2JXW A;  2JV4 A;  2XP3 A;  4U85 A;  2DWV A;  3KCE A;  3LKX A;  2ZR4 A;  1O6W A;  1EG3 A;  3KAD A;  2Y8N B;  2RE3 A;  2BA1 A;  2ZAJ A;  2ZR6 A;  1K9R A;  3ODK A;  2ZQT A;  2M3O W;  3FS8 A;  2EZ5 W;  3KAG A;  3TC5 A;  2YAJ B;  2YSB A;  1FLC A;  1ZCN A;  3FSB A;  3WH0 A;  2WAE A;  4E5R A;  4GLX A;  1JMQ A;  2ZQS A;  5E62 A;  2XP5 A;  3KAF A;  3MCB A;  2ITK A;  2XP7 A;  3OOB A;  2XP4 A;  2Q5A A;  3MQG A;  3PQH A;  2JMF A;  2M8I A;  3KAB A;  2MDI A;  1I5H W;  2YSH A;  3MCB B;  2XPA A;  5CQ2 A;  2YSG A;  4A0T A;  1WR7 A;  2DK1 A;  4A0U A;  3M7N A;  5AHT A;  2WAD A;  1NMV A;  1EG4 A;  2QRV A;  2XP8 A;  2ZQV A;  2M8J A;  2YSF A;  5E64 A;  5E65 A;  2KXQ A;  3L4H A;  2XPB A;  4U86 A;  3KAI A;  3M85 A;  4U84 A;  1PIN A;  1TK7 A;  2ZR5 A;  4QIB A; 
#chains in the Genus database with same CATH homology
 3MQH A;  2OWO A;  1WMV A;  1TR8 A;  2ZQU A;  2F21 A;  2XP9 A;  4REX A;  2DMV A;  2JX8 A;  2DK7 A;  3LE4 A;  5U47 A;  3FSC A;  1F8A B;  2XP6 A;  3LKX B;  2YSI A;  1YW5 A;  2LAJ A;  5E66 A;  2L4J A;  3CNG A;  3NTP A;  3TDB A;  2E45 A;  2DJY A;  3TCZ A;  3KAH A;  1RP5 A;  5E5W A;  1K9Q A;  2JXW A;  2JV4 A;  2XP3 A;  4U85 A;  2DWV A;  3KCE A;  3LKX A;  2ZR4 A;  1O6W A;  1EG3 A;  3KAD A;  2Y8N B;  2RE3 A;  2BA1 A;  2ZAJ A;  2ZR6 A;  1K9R A;  3ODK A;  2ZQT A;  2M3O W;  3FS8 A;  2EZ5 W;  3KAG A;  3TC5 A;  2YAJ B;  2YSB A;  1FLC A;  1ZCN A;  3FSB A;  3WH0 A;  2WAE A;  4E5R A;  4GLX A;  1JMQ A;  2ZQS A;  5E62 A;  2XP5 A;  3KAF A;  3MCB A;  2ITK A;  2XP7 A;  3OOB A;  2XP4 A;  2Q5A A;  3MQG A;  3PQH A;  2JMF A;  2M8I A;  3KAB A;  2MDI A;  1I5H W;  2YSH A;  3MCB B;  2XPA A;  5CQ2 A;  2YSG A;  4A0T A;  1WR7 A;  2DK1 A;  4A0U A;  3M7N A;  5AHT A;  2WAD A;  1NMV A;  1EG4 A;  2QRV A;  2XP8 A;  2ZQV A;  2M8J A;  2YSF A;  5E64 A;  5E65 A;  2KXQ A;  3L4H A;  2XPB A;  4U86 A;  3KAI A;  3M85 A;  4U84 A;  1PIN A;  1TK7 A;  2ZR5 A;  4QIB A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...