1EG3A

Structure of a dystrophin ww domain fragment in complex with a beta-dystroglycan peptide
Total Genus 98
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
98
sequence length
260
structure length
260
Chain Sequence
b'PASQHFLSTSVQGPWERAISPNKVPYYINHETQTTCWDHPKMTELYQSLADLNNVRFSAYRTAMKLRRLQKALCLDLLSLSAACDALDQHNLKQNDQPMDILQIINCLTTIYDRLEQEHNNLVNVPLCVDMCLNWLLNVYDTGRTGRIRVLSFKTGIISLCKAHLEDKYRYLFKQVASSTGFCDQRRLGLLLHDSIQIPRQLGEVASFGGSNIEPSVRSCFQFANNKPEIEAALFLDWMRLEPQSMVWLPVLHRVAAAET'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DYSTROPHIN
publication title Structure of a WW domain containing fragment of dystrophin in complex with beta-dystroglycan.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Structural protein
total genus 98
structure length 260
sequence length 260
ec nomenclature
pdb deposition date 2000-02-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00397 WW WW domain
A PF09068 EF-hand_2 EF hand
A PF09069 EF-hand_3 EF-hand
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 1eg3A03
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 1eg3A04
2.20.70.10 Mainly Beta Single Sheet Ubiquitin Ligase Nedd4; Chain: W; Ubiquitin Ligase Nedd4; Chain: W; 1eg3A01
3JTDC 4CFQA 1SNLA 1A03A 1YX8A 2G9BA 2KNEA 3QRXA 4I5LB 3ZNIA 1QV0A 2KQ6A 3CLNA 3OX6A 3VRRA 4DUQA 3KO0A 2CBLA 2EHBA 2LHLA 1C7WA 1B8RA 3ICBA 1EH2A 1ZUZA 1XFWO 1J55A 4N5XA 2LLUA 4PHMA 2MDIA 4DIRA 1BR1B 2L4JA 1JSAA 1TNPA 2ZAJA 4WQ3A 2ZR4A 2ZKMX 2CTNA 4QJ5B 1S6IA 1KQMC 1X02A 3O78A 2COLB 1SYMA 1CFFA 1FI5A 3KAIA 2PMYA 2KHNA 1SMGA 3VRPA 5TNCA 4I5JA 1YX7A 5JOLA 2XP7A 3VROA 1KK7Y 2M0RA 2KXQA 2M8IA 2JU0A 4MLWA 3PN7C 2KFHA 1YR5A 3D10A 3M7NA 3DVKA 1K95A 1S5GZ 4GUKA 1TCFA 3CR5X 4MRXA 4DS7A 1TOPA 1HQVA 1QX5B 1RECA 1OMDA 1KK8C 3A4UB 1G8IA 1PK0D 2L50A 4YGCB 3SG4A 1F8HA 1SCMC 1MF8B 1U5IB 3NSOA 3O2PA 3WHUB 3CZTX 3JTDB 5K89A 2Y1MA 1M46A 4MZLA 3KAGA 1NX3A 4I5KA 1GGZA 2BA1A 1FI6A 3SG5A 1XFXO 1C07A 2EGDA 3CTNA 1DMOA 2JOJA 4MRYA 1SW8A 1XFUO 1JUOA 1QX7A 2K7BA 5CQ2A 2ZQVA 1XO5A 1NCYA 5F6TA 1OMRA 1J7PA 4AOMA 3CR2A 1DJIA 4CLNA 1KQMB 4U8DA 3EKJA 1AHRA 2M1KB 1ALVA 1FW4A 1K9KA 2XP8A 3KABA 2BL0C 4GBAA 1K93D 4OVNF 3KADA 2K61A 3PN7B 3I5IC 5AERA 4REXA 1WRLA 1TN4A 1C7VA 5KSZA 2XP6A 1KK8B 3SIBA 2KBIA 2M97A 2M8JA 4MN0A 1LXFC 2H61C 1DJWA 2JC2A 2K8MB 4HRGA 1O6WA 3DD4A 1SCMB 3OHMB 1EXRA 1AUIB 1W7JB 3H4SE 1EG3A 2KI4C 3OB1B 3HCMA 1Y6WA 4NDBA 2K2FA 4E5RA 2LE9B 1MUXA 4CPVA 1ZMZA 2ZQUA 1PINA 2LHIA 2FCDA 2F3ZA 3M85A 1S5GY 4L9MA 1SCVA 2E45A 1YRTB 5CSFA 1JF2A 5D69A 2JXLA 2CT9A 2WCEA 1L2OB 1YRUB 2KOTA 1IKUA 1Y1UA 4R1EA 1QIVA 3FIAA 1OZOA 5AHTA 2DK7A 1OOJA 1R6PA 1CLMA 1UHIA 1OQPA 2LVJA 3KPXA 3I5IB 1WLMA 1B8LA 1SR6C 2KBMA 2MHHA 3CWGA 1QV1A 2ZNEA 4GPLB 3OB2B 1QASA 5PALA 1BODA 1KFXL 2F2OA 1NSHA 2LMVA 4XJKA 1MXEA 4ETOA 2KGBC 3BOWA 2CCMA 2MAZA 3SIAA 2KDHA 3AKBA 1OE9B 3FWBA 1BOCA 4GGFA 3BUOB 1WRKA 4JPZB 1KWOC 2BCXA 2P6BB 4N1GA 2PASA 2F21A 2KI4B 1DVIA 3PLFB 2LAPA 3GOFA 4HREE 1A2XA 2F8PA 4E68A 1AP4A 2JZIA 1TRFA 2K2AA 2KYFA 1IGVA 2HQ8A 4HRHA 1IH0A 3TDUA 1M39A 2WCBA 5J3XA 4NDDA 4ORCB 2DOQA 2YSFA 2LMUA 1KFXS 1KFUS 2M8UA 4PE7A 5I2QA 2LUXA 3OP0A 3PALA 2YSIA 1MXLC 2AUCA 3IQQA 1S3PA 4GAOA 1IRJA 3KCEA 2SCPA 3GK1A 1IQ3A 2M1UA 3PATA 2JV4A 1J7RA 1SR6B 4MVFA 5FYXA 2I18A 3LLEA 2KAXA 1QVIZ 3O4YA 1QTXA 2JNFA 1F55A 3LE4A 4MEWA 1NX0A 1PULA 2IS9A 3AAJA 2LLTA 2ZRSA 2YSBA 1NMVA 2KGRA 5AANA 2JNXA 5HYDA 4U86A 4USLA 1XK4A 1YUSA 1KWOB 1A75A 2AMIA 4ORAB 5CSIA 4A4CA 1GGWA 1LA3A 3SG2A 1WR7A 1RFJA 4I5NB 1DJXA 3PFVA 3IQOA 2MRDA 4P2YB 2M9GA 1J7OA 2I2RE 2JTTA 3SG3A 4PHJA 3EK4A 4A4BA 4F0ZB 1V1FA 2G2BA 1KCYA 1CFPA 2WNDA 4MZJA 1XFYO 4ICBA 2OPOA 1ZFSA 3WXAA 2FOTA 2Q91A 2JT8A 1N2DA 4NDCA 1GJYA 4QJ3B 3L4HA 3BYAA 3DVEA 4GNKB 2NCPA 1F70A 2WOSA 1NWDA 1QS7A 4XYNA 4C0JA 1K8UA 2I94A 1GQMA 2L5XB 2WCFA 1G33A 2VRGA 1L2OC 1UURA 2XPBA 3KAFA 2M49B 2BKIB 3CR4X 1NPQA 3TCZA 1QLKA 3AKAA 1J7QA 2XPAA 3KHEA 2ZNDA 1I5HW 2F2PA 3BUMB 4HSZA 4YRUA 4U84A 1JMQA 1RWYA 1CTRA 1IG5A 2Y4QA 4YGBB 5I2OA 1PALA 1M31A 2EC6C 3KAHA 2F3YA 1NIWA 1DGUA 1IWQA 4D1EA 1DT7B 2LAJA 4DCKA 2KFFA 5IBWA 1FPWA 2OTGB 3F45A 1DJYA 4PDZA 3C1VA 3GK4X 4U85A 3EVVA 1A4PA 1XA5A 2TN4A 1F4QA 2JULA 2ZQSA 5ER4X 1BMOA 2EZ5W 1JFKA 2DWVA 1H8BA 3DVJA 1CDPA 2XP5A 1IJ5A 1AJ4A 1UHKA 1QVIY 4CIDA 3ZWHA 2ZRTA 3NXAA 1K90D 1LINA 2JRFA 2L4HA 1Y0VH 3NSLA 1AK8A 1PVAA 1MQ1A 1TIZA 1DJHA 1YW5A 3DF0A 1QX2A 1CLBA 2HETA 2LVVA 4JWQA 4AQIA 4BY4A 1DJGA 2QPTA 1PSBA 1YUUA 3WNXB 1B7TZ 2KAYA 1UUSA 4QIBA 4NQGA 1KSMA 1WDCB 1BT6A 1MHOA 2L0PA 1NCXA 1NP8A 1YVHA 2L4IA 1AVSA 1NCZA 4M2PA 2MBXA 1CFDA 1WY9A 5I2LA 1BG1A 1NYAA 1TNXA 5BPJA 1B1GA 2RE3A 1PSRA 1RROA 2CXJA 2EC6B 2I7AA 1G4YR 1BLQA 3TDIA 2ZQTA 2PALA 2HPSA 2RGIA 4GGFC 2PSRA 1YTZC 1ODBA 1B8CA 2JT3A 2K7DA 2SASA 5DKNA 3TUYC 3A8RA 2Q5AA 1WLZA 4JQ0D 2GV5A 2K0JA 2FJUB 4YI8A 1ZCNA 3BUXB 5G08A 2M29A 1CB1A 1QLSA 2D8NA 2JXWA 1A29A 1VRKA 3EKHA 3TZ1A 4OR9B 1F4OA 3TDBA 3JVTC 2L51A 2YSHA 2OS8C 4PE4A 1CNPA 2NCOA 3TC5A 2DMVA 3TS5C 1EG4A 1PRWA 4PHKA 3NTPA 2AAOA 5CSJA 2PVBA 1E8AA 2O60A 1QIWA 2ZFDA 3OX5A 3LL8B 5D7FA 2JT0A 1S1EA 1CKKA 1DF0A 1AJ5A 4GGNA 2PRUA 4UPGA 1Q80A 2DK1A 3EVRA 1OMVA 3IF7A 1TTXA 2LP3A 3O6BA 4TNCA 4XJKB 3TDZA 1U5IA 5JJGA 1CDNA 1EJ3A 1J1EA 1J1DA 3BOWB 4QJ4B 1SL8A 2ZN8A 2LCPA 3AAKA 2WC8A 3KF9A 4CFRA 4N1FA 2JMFA 1DGVA 3WH0A 2FCEA 2V53A 1CFCA 5CPVA 3VRNA 1XK4C 1M63B 1B7TY 1SL7A 3TUYB 3RM1A 5GQQC 2JTZA 3FS7A 1CMFA 2XP9A 3LCPC 1JWDA 1K2HA 2JQ6A 2OTGC 1TNWA 1R2UA 5CSNA 1N0YA 1K9RA 4AQJA 4OKHA 1XFZO 5HLOA 1K9QA 5B8IB 3I5FB 3OOBA 5HKZA 3HX4A 3JVTB 2LANA 3E3RA 3WHTB 1RK9A 1RTP1 2HQWA 2NZ0A 1UHNA 1F8AB 2HF5A 2O5GA 2OS8B 4MSPA 1JBAA 2JPTA 3CGAA 1NX2A 3LK0A 1W7IB 3TS5B 1SKTA 4WRIA 2BBMA 2KI6D 3I5GB 4PHNA 1IQ5A 2LVKA 1B4CA 1K9UA 3SJSA 1HT9A 1DF0B 1YUTA 1XVJA 2E6WA 2KI6C 2Y1NA 5HKYA 5KTYA 2NXQA 1WRZA 1B47A 2LMTA 2JXCA 2MA2A 2JWWA 4P5OE 1WDCC 1JF0A 1NX1A 1SBJA 1UHJA 1LKJA 3GK2A 1UP5A 2BCBA 2XP3A 1CLLA 2MLFC 5AEQA 2GGZA 1A75B 1PVBA 2L2EA 2NLNA 2ITKA 1XFVO 3SG6A 1F54A 3EVUA 3ODKA 4PE1A 5DKQA 3D0YA 1L7ZA 1NUBA 2BE6A 3RLZA 1BF5A 1SPYA 5HKWA 2KFGA 5DKRA 4YI9A 2B1UA 5KU1A 2XP4A 1DJZA 2LM5A 4MBEA 4FTGA 1S26D 4OV2A 1K94A 2BE4A 1TK7A 4ORBB 2M7NA 3I5HC 1K9PA 2E30A 1OSAA 1FBVA 1QATA 2GGMA 1JC2A 2Q4UA 1OZSA 1S6CA 1SRAA 3DVMA 3NSKA 4M2OA 4YGEB 4GFTA 5HLVA 2YSGA 3CNGA 2CNPA 2JX8A 3VRQA 1YURA 3K21A 2LV7A 2ISDA 4YGDB 2R2IA 4BY5A 1QXPA 2DJYA 3NSIA 3KEVA 1QJTA 1LA0A 4WQ2A 1IJ6A 1LVCD 1Y1XA 1SY9A 2BECA 2LUCA 1CM4A 1TCOB 3CS1A 3VGOA 2H61A 2LLSA 1S6JA 2K7CA 1ALWA 2M3WA 4YGAA 1CDLA 1D1OA 1K96A 2BCAA 2LP2A 1CMGA 5AFPA 2H2KA 1RJVA 2WORA 1V1GA 1ZOTB 1MR8A 2KAVA 1MWNA 1Y1AA 3D0YB 2BKHB 4Q04A 1KSOA 1XYDA 3M0WA 1YVLA 1UWOA 1KK7Z 2LC5A 3SG7A 3BXKA 2K7OA 4M2QA 2M7LA 5I8NA 5ER5A 1SK6D 1SL9A 1KQVA 4YBHB 3FWCA 2ZR5A 2KYCA 2F33A 2KQYA 3EK7A 3I5HB 4OCIA 2BL0B 1BU3A 1F71A 4C0KA 2BBNA 4PALA 1CDMA 3DF0B 2ZN9A 3I5FC 4C0LA 4ZCVA 4IL1A 1WMVA 2M3OW 2Y5IA 4PE0A 1B9AA 1KFUL 1TNQA 2KSPA 1N65A 2LNKA 1ZACA 4MZKA 5AXIA 2A4JA 2LVIA 2ZR6A 1FF1A 2MJWB 4PCWA 1H4BA 1BJFA 2MLEC 1UHHA 3I5GC 1DTLA 2L98A 1JFJA 3LK1A 3BQ3A 3EK8A 4ZCUA 1CM1A 3BUWB 3PSRA 1BR4B 1M45A 4FQOA 2QACA 3PM8A 3MSEB 4DRWA 3BUNB 1EL4A 1S36A
chains in the Genus database with same CATH superfamily
3JTDC 4CFQA 1SNLA 1A03A 1YX8A 2G9BA 2KNEA 3QRXA 3NHIA 4I5LB 3ZNIA 1QV0A 2KQ6A 3CLNA 3OX6A 3VRRA 4DUQA 3KO0A 2CBLA 2EHBA 2LHLA 1C7WA 1B8RA 3ICBA 1EH2A 1ZUZA 1XFWO 1J55A 4N5XA 2LLUA 4PHMA 3UO9A 3NHTA 1BR1B 4DIRA 2MDIA 2L4JA 1JSAA 1TNPA 2ZAJA 4WQ3A 2ZR4A 2ZKMX 2CTNA 3S0EA 4QJ5B 1S6IA 1KQMC 1X02A 1OOIX 3O78A 2COLB 1SYMA 1CFFA 1FI5A 3KAIA 2PMYA 2KHNA 1SMGA 3VRPA 5TNCA 3O4XA 4I5JA 1YX7A 5JOLA 1JFJA 3CZ0A 2QEOA 2XP7A 3VROA 1KK7Y 2M0RA 2KXQA 2M8IA 2JU0A 4MLWA 3PN7C 2KFHA 1YR5A 3D10A 3M7NA 3DVKA 1K95A 3VB1A 1S5GZ 4GUKA 1TCFA 3CR5X 4MRXA 4DS7A 1TOPA 1HQVA 1QX5B 3FE6A 1RECA 1OMDA 2L2CA 3B6XA 1KK8C 3A4UB 1G8IA 1QWVA 1PK0D 2L50A 4YGCB 3SG4A 2WC6A 3BJHA 5U47A 1F8HA 1SCMC 1MF8B 1U5IB 2KLDA 3NSOA 3O2PA 3WHUB 2QEVA 3CZTX 3JTDB 4JKTA 5K89A 2Y1MA 1M46A 4MZLA 3KAGA 1NX3A 4I5KA 1GGZA 2BA1A 1FI6A 3SG5A 1W9ZA 3K1EA 2JPOA 1XFXO 1C07A 2EGDA 3R1OA 3CTNA 2YGUA 1DMOA 2JOJA 4MRYA 2KLEA 3DY9A 3S0BA 4A0TA 1SW8A 1XFUO 1JUOA 1QX7A 2K7BA 5CQ2A 2OWOA 2ZQVA 1XO5A 1NCYA 5F6TA 1OMRA 1P28A 1J7PA 4AOMA 3CR2A 1DJIA 4CLNA 3BFHA 3NGVA 1KQMB 4U8DA 3EKJA 1AHRA 3QMEA 2M1KB 2Y8NB 1ALVA 3DZTA 1FW4A 1K9KA 3DXLA 2XP8A 3KABA 3B87A 2QEHA 2BL0C 4GBAA 1K93D 4OVNF 3KADA 2K61A 3PN7B 3I5IC 2BNXA 5AERA 2QEBA 4F7FA 4REXA 1WRLA 1TN4A 1C7VA 5KSZA 2XP6A 3CZ1A 1KK8B 3SIBA 1TWOA 2KBIA 2M97A 3OGNA 2M8JA 4MN0A 1LXFC 2H61C 1DJWA 2JC2A 2K8MB 4HRGA 1O6WA 3DD4A 1SCMB 5FI2A 3OHMB 1EXRA 3D73A 1AUIB 1W7JB 3H4SE 1EG3A 2KI4C 3OB1B 3HCMA 1Y6WA 3FSCA 4NDBA 2K2FA 4E5RA 2LE9B 1MUXA 2PYQA 1ZMZA 4CPVA 2ZQUA 1PINA 2LHIA 2FCDA 1GM0A 2F3ZA 3M85A 1S5GY 3S0GA 2WCMA 1SCVA 4L9MA 2E45A 1YRTB 5CSFA 1JF2A 5D69A 1Z2CB 2JXLA 3Q8IA 4FQTA 3IVTA 2CT9A 3D78A 2WCEA 1L2OB 1YRUB 2KOTA 1IKUA 1Y1UA 4R1EA 1QIVA 3FIAA 4OZDA 3SS3A 1OZOA 3L4LA 5AHTA 2DK7A 1OOJA 1R6PA 1CLMA 1UHIA 1OQPA 2LVJA 3KPXA 3I5IB 1WLMA 1B8LA 1SR6C 2KBMA 2MHHA 3CWGA 1QV1A 2ZNEA 4GPLB 3OB2B 1QASA 5PALA 1BODA 1KFXL 2F2OA 1NSHA 2LMVA 4XJKA 1MXEA 4ETOA 2KGBC 1DC1A 3BOWA 2CCMA 2MAZA 3PJIA 2KDHA 3SIAA 3AKBA 5HL1A 1OE9B 3FWBA 1BOCA 4GGFA 1OOFA 3BUOB 3LKXB 1WRKA 4JPZB 1KWOC 2BCXA 3R72A 2P6BB 4N1GA 2PASA 2F21A 2KI4B 3MCBB 1DVIA 3PLFB 2LAPA 3GOFA 4HREE 1A2XA 2F8PA 3RZSA 4E68A 3DYEA 1AP4A 2JZIA 1TRFA 2K2AA 2KYFA 1DELA 1IGVA 2HQ8A 3PM2A 4HRHA 1IH0A 3TDUA 1M39A 2WCBA 3V2LA 1C3YA 5J3XA 4NDDA 4ORCB 2DOQA 2YSFA 2LMUA 1KFXS 1KFUS 2M8UA 2QDIA 4PE7A 2LUXA 5I2QA 3OP0A 3FE8A 3PALA 2YSIA 1MXLC 2AUCA 2L5YA 1DEKA 3IQQA 1S3PA 4GAOA 1IRJA 3KCEA 2SCPA 3GK1A 1IQ3A 2M1UA 3PATA 1DQEA 4A0UA 2JV4A 1J7RA 5I94A 1SR6B 4MVFA 5FYXA 2WCHA 2P71A 2I18A 3LLEA 2KAXA 2K60A 5D3OA 1QVIZ 3O4YA 1QTXA 2JNFA 1F55A 3LE4A 4MEWA 1NX0A 1PULA 2IS9A 3AAJA 2LLTA 2ZRSA 3MQHA 2YSBA 1NMVA 2KGRA 5AANA 2JNXA 5HYDA 4U86A 3EG5B 4USLA 1XK4A 1YUSA 1KWOB 1A75A 2AMIA 4ORAB 5CSIA 4A4CA 1GGWA 1LA3A 3SG2A 1WR7A 1RFJA 4I5NB 1DJXA 3PFVA 3IQOA 2MRDA 4P2YB 2M9GA 1J7OA 3BFBA 2I2RE 2JTTA 3SG3A 4PHJA 3EK4A 3B88A 4A4BA 4F0ZB 1V1FA 2G2BA 1KCYA 1CFPA 2WNDA 4MZJA 1XFYO 4ICBA 2OPOA 1ZFSA 3WXAA 2FOTA 4INXA 2Q91A 1SSEB 1N2DA 2JT8A 4NDCA 1GJYA 4QJ3B 3L4HA 3BYAA 3S0DA 2FJYA 3DVEA 4GNKB 3S0FA 2NCPA 1F70A 2WOSA 1NWDA 1QS7A 4XYNA 5EL2A 4C0JA 1IIOA 1K8UA 2I94A 1GQMA 2L5XB 2WCFA 3S0AA 1TR8A 1G33A 3SS5A 2VRGA 1L2OC 1UURA 2XPBA 3KAFA 2M49B 2BKIB 3CR4X 1NPQA 3TCZA 1QLKA 3AKAA 1J7QA 2XPAA 3KHEA 2ZNDA 1I5HW 2F2PA 3BUMB 4HSZA 4YRUA 4U84A 1JMQA 3CABA 1RWYA 1CTRA 1IG5A 2Y4QA 3N7HA 4YGBB 5I2OA 1PALA 1M31A 2EC6C 3KAHA 2F3YA 1NIWA 2GTEA 1DGUA 1IWQA 4D1EA 1DT7B 2LAJA 4DCKA 2KFFA 5IBWA 1FPWA 2OTGB 3F45A 1DJYA 4PDZA 3C1VA 3GK4X 4U85A 3EVVA 1A4PA 5E62A 1XA5A 2TN4A 1F4QA 2JULA 2ZQSA 5ER4X 1BMOA 2EZ5W 1JFKA 2DWVA 2QRVA 1H8BA 3DVJA 1C3ZA 1CDPA 2WCKA 2XP5A 1IJ5A 1AJ4A 1UHKA 1QVIY 4CIDA 3ZWHA 2P70A 2ZRTA 3NXAA 1OOHA 1K90D 1LINA 2JRFA 2L4HA 1Y0VH 3NSLA 1AK8A 1PVAA 1MQ1A 1TIZA 1DJHA 1Z4HA 5DICA 1YW5A 3DF0A 1QX2A 1CLBA 2HETA 2LVVA 1TUZA 4JWQA 4AQIA 4BY4A 1DJGA 2QPTA 1PSBA 1YUUA 3WNXB 1B7TZ 2KAYA 1UUSA 4QIBA 4NQGA 3OBVA 1KSMA 1WDCB 1BT6A 1MHOA 2L0PA 1NCXA 1NP8A 1YVHA 2L4IA 1AVSA 1NCZA 4M2PA 2MBXA 1CFDA 1WY9A 5I2LA 1BG1A 1NYAA 1TNXA 5BPJA 1B1GA 2RE3A 1PSRA 1LS8A 1RROA 2CXJA 2EC6B 2WCJA 2I7AA 5E5WA 1G4YR 1BLQA 3TDIA 2ZQTA 2PALA 2HPSA 2WADA 2RGIA 2WC5A 4GGFC 2PSRA 1YTZC 1ODBA 1B8CA 2JT3A 2K7DA 2SASA 5DKNA 4PT1A 3TUYC 3A8RA 2Q5AA 1WLZA 4JQ0D 2GV5A 2K0JA 2FJUB 4YI8A 1T14A 1ZCNA 3BUXB 5G08A 2BAPA 2M29A 1CB1A 1QLSA 2D8NA 2JXWA 1A29A 1VRKA 3EKHA 3TZ1A 4OR9B 1F4OA 3TDBA 3JVTC 2L51A 2YSHA 1RP5A 1FLCA 1TUJA 2OS8C 4PE4A 1CNPA 2NCOA 3TC5A 2DMVA 3TS5C 1EG4A 1PRWA 4PHKA 3NTPA 2AAOA 5CSJA 2PVBA 1E8AA 2O60A 1QIWA 2ZFDA 3OX5A 3LL8B 5D7FA 2JT0A 1S1EA 1CKKA 1DF0A 1AJ5A 4GGNA 2PRUA 4UPGA 5E66A 1Q80A 2DK1A 3EVRA 1OMVA 3IF7A 1TTXA 2LP3A 3O6BA 4TNCA 4XJKB 3L4AA 1U5IA 3BFAA 3TDZA 1EJ3A 1J1EA 1J1DA 3BOWB 4QJ4B 1SL8A 2ZN8A 1CDNA 2LCPA 3AAKA 2WC8A 3KF9A 4CFRA 4N1FA 2JMFA 1DGVA 3WH0A 2FCEA 2V53A 1CFCA 5CPVA 5FI6A 3VRNA 1XK4C 3MQGA 1M63B 1B7TY 1SL7A 3R1PA 3RM1A 3TUYB 5GQQC 2JTZA 2KPHA 3FS7A 1CMFA 2XP9A 3LCPC 1JWDA 1K2HA 2JQ6A 2OTGC 1TNWA 3D77A 1R2UA 2YAJB 5CSNA 1N0YA 5E64A 1K9RA 4AQJA 4OKHA 1OW4A 1XFZO 5HLOA 3UNWA 5B8IB 1K9QA 3I5FB 3OOBA 5HKZA 3HX4A 3JVTB 2LANA 3E3RA 3WHTB 1RK9A 1RTP1 2HQWA 2NZ0A 1UHNA 1F8AB 2HF5A 2O5GA 2OS8B 4MSPA 1JBAA 2JPTA 1OOGA 1NX2A 3CGAA 3LK0A 1W7IB 3D76A 3TS5B 1SKTA 3FS8A 4WRIA 2BBMA 2KI6D 3I5GB 3FSBA 4PHNA 5JJGA 2H8VA 1IQ5A 2LVKA 1B4CA 1K9UA 3SJSA 1HT9A 1DF0B 1YUTA 1XVJA 2E6WA 2KI6C 2Y1NA 5HKYA 5KTYA 4JD9A 2NXQA 1WRZA 1B47A 2LMTA 2WAEA 2JXCA 2MA2A 2JWWA 4P5OE 1WDCC 1JF0A 1NX1A 1SBJA 1UHJA 1LKJA 3GK2A 1UP5A 2BCBA 2XP3A 1CLLA 2MLFC 5AEQA 3D74A 2GGZA 1A75B 1PVBA 2L2EA 2NLNA 2ITKA 1XFVO 3SG6A 1F54A 3EVUA 3ODKA 4PE1A 5DKQA 3D0YA 1L7ZA 1NUBA 2BE6A 3RLZA 1BF5A 1XFRA 1ORGA 1SPYA 5HKWA 2KFGA 5DKRA 4YI9A 2B1UA 5KU1A 2XP4A 1DJZA 2LM5A 4MBEA 4FTGA 1S26D 4OV2A 1K94A 2BE4A 1TK7A 4ORBB 2M7NA 3CYZA 3I5HC 1K9PA 2E30A 1OSAA 1FBVA 1QATA 2GGMA 1JC2A 2Q4UA 1OZSA 1S6CA 1SRAA 3DVMA 3NSKA 4M2OA 4YGEB 4GFTA 5HLVA 2YSGA 3CNGA 2CNPA 2JX8A 3VRQA 1YURA 3K21A 2LV7A 2ISDA 4IJ7A 2R2IA 3L47A 4YGDB 1QXPA 4BY5A 3NSIA 2DJYA 4KYNA 3CDNA 3KEVA 1QJTA 1LA0A 4WQ2A 1IJ6A 1LVCD 1Y1XA 1SY9A 2BECA 2LUCA 1CM4A 1TCOB 3CS1A 3VGOA 2H61A 2LLSA 1S6JA 3LKXA 2K7CA 2WCLA 1ALWA 2M3WA 4YGAA 1CDLA 1D1OA 1K96A 2BCAA 3MCBA 2LP2A 1CMGA 5AFPA 2H2KA 1RJVA 3B86A 2WORA 1V1GA 1ZOTB 1MR8A 2KAVA 1MWNA 1Y1AA 3D0YB 2BKHB 4Q04A 1KSOA 3SS4A 1XYDA 3M0WA 1YVLA 1UWOA 1KK7Z 2LC5A 3FE9A 3SG7A 3BXKA 2K7OA 4M2QA 2M7LA 5I8NA 3D75A 1SK6D 1SL9A 5ER5A 4YBHB 1KQVA 3CZ2A 3FWCA 2ZR5A 2KYCA 4GLXA 2F33A 2KQYA 3EK7A 3I5HB 4OCIA 2BL0B 1BU3A 1F71A 4C0KA 2BBNA 4PALA 1CDMA 2ERBA 3DF0B 2ZN9A 3I5FC 3PQHA 4C0LA 4ZCVA 4IL1A 1WMVA 2M3OW 2Y5IA 4PE0A 1B9AA 1KFUL 1TNQA 2KSPA 1N65A 2LNKA 1ZACA 4MZKA 5AXIA 2A4JA 2LVIA 2ZR6A 1FF1A 2MJWB 3B7AA 4PCWA 1H4BA 1BJFA 2MLEC 1UHHA 2PQLA 1DTLA 2L98A 3I5GC 3R1VA 5FI7A 3LK1A 3BQ3A 3EK8A 4ZCUA 5E65A 1CM1A 3BUWB 3PSRA 1BR4B 1M45A 4FQOA 2QACA 4INWA 3PM8A 3MSEB 4DRWA 3BUNB 1EL4A 1S36A
chains in the Genus database with same CATH topology
3JTDC 4CFQA 1SNLA 1A03A 1YX8A 2G9BA 2KNEA 3QRXA 4I5LB 3ZNIA 1QV0A 2KQ6A 3CLNA 3OX6A 3VRRA 4DUQA 3KO0A 2CBLA 2EHBA 2LHLA 1C7WA 1B8RA 3ICBA 1EH2A 1ZUZA 1XFWO 1J55A 4N5XA 2LLUA 4PHMA 2MDIA 4DIRA 1BR1B 2L4JA 1JSAA 1TNPA 2ZAJA 4WQ3A 2ZR4A 2ZKMX 2CTNA 4QJ5B 1S6IA 1KQMC 1X02A 3O78A 2COLB 1SYMA 1CFFA 1FI5A 3KAIA 2PMYA 2KHNA 1SMGA 3VRPA 5TNCA 4I5JA 1YX7A 5JOLA 2XP7A 3VROA 1KK7Y 2M0RA 2KXQA 2M8IA 2JU0A 4MLWA 3PN7C 2KFHA 1YR5A 3D10A 3M7NA 3DVKA 1K95A 1S5GZ 4GUKA 1TCFA 3CR5X 4MRXA 4DS7A 1TOPA 1HQVA 1QX5B 1RECA 1OMDA 1KK8C 3A4UB 1G8IA 1PK0D 2L50A 4YGCB 3SG4A 5U47A 1F8HA 1SCMC 1MF8B 1U5IB 3NSOA 3O2PA 3WHUB 3CZTX 3JTDB 5K89A 2Y1MA 1M46A 4MZLA 3KAGA 1NX3A 4I5KA 1GGZA 2BA1A 1FI6A 3SG5A 1XFXO 1C07A 2EGDA 3CTNA 1DMOA 2JOJA 4MRYA 4A0TA 1SW8A 1XFUO 1JUOA 1QX7A 2K7BA 5CQ2A 2OWOA 2ZQVA 1XO5A 1NCYA 5F6TA 1OMRA 1J7PA 4AOMA 3CR2A 1DJIA 4CLNA 1KQMB 4U8DA 3EKJA 1AHRA 2M1KB 2Y8NB 1ALVA 1FW4A 1K9KA 2XP8A 3KABA 2BL0C 4GBAA 1K93D 4OVNF 3KADA 2K61A 3PN7B 3I5IC 5AERA 4REXA 1WRLA 1TN4A 1C7VA 5KSZA 2XP6A 1KK8B 3SIBA 2KBIA 2M97A 2M8JA 4MN0A 1LXFC 2H61C 1DJWA 2JC2A 2K8MB 4HRGA 1O6WA 3DD4A 1SCMB 3OHMB 1EXRA 1AUIB 1W7JB 3H4SE 1EG3A 2KI4C 3OB1B 3HCMA 1Y6WA 3FSCA 4NDBA 2K2FA 4E5RA 2LE9B 1MUXA 4CPVA 1ZMZA 2ZQUA 1PINA 2LHIA 2FCDA 2F3ZA 3M85A 1S5GY 4L9MA 1SCVA 2E45A 1YRTB 5CSFA 1JF2A 5D69A 2JXLA 2CT9A 2WCEA 1L2OB 1YRUB 2KOTA 1IKUA 1Y1UA 4R1EA 1QIVA 3FIAA 1OZOA 5AHTA 2DK7A 1OOJA 1R6PA 1CLMA 1UHIA 1OQPA 2LVJA 3KPXA 3I5IB 1WLMA 1B8LA 1SR6C 2KBMA 2MHHA 3CWGA 1QV1A 2ZNEA 4GPLB 3OB2B 1QASA 5PALA 1BODA 1KFXL 2F2OA 1NSHA 2LMVA 4XJKA 1MXEA 4ETOA 2KGBC 3BOWA 2CCMA 2MAZA 3SIAA 2KDHA 3AKBA 1OE9B 3FWBA 1BOCA 4GGFA 3BUOB 3LKXB 1WRKA 4JPZB 1KWOC 2BCXA 2P6BB 4N1GA 2PASA 2F21A 2KI4B 3MCBB 1DVIA 3PLFB 2LAPA 3GOFA 4HREE 1A2XA 2F8PA 4E68A 1AP4A 2JZIA 1TRFA 2K2AA 2KYFA 1IGVA 2HQ8A 4HRHA 1IH0A 3TDUA 1M39A 2WCBA 5J3XA 4NDDA 4ORCB 2DOQA 2YSFA 2LMUA 1KFXS 1KFUS 2M8UA 4PE7A 5I2QA 2LUXA 3OP0A 3PALA 2YSIA 1MXLC 2AUCA 3IQQA 1S3PA 4GAOA 1IRJA 3KCEA 2SCPA 3GK1A 1IQ3A 2M1UA 3PATA 4A0UA 2JV4A 1J7RA 1SR6B 4MVFA 5FYXA 2I18A 3LLEA 2KAXA 1QVIZ 3O4YA 1QTXA 2JNFA 1F55A 3LE4A 4MEWA 1NX0A 1PULA 2IS9A 3AAJA 2LLTA 2ZRSA 3MQHA 2YSBA 1NMVA 2KGRA 5AANA 2JNXA 5HYDA 4U86A 4USLA 1XK4A 1YUSA 1KWOB 1A75A 2AMIA 4ORAB 5CSIA 4A4CA 1GGWA 1LA3A 3SG2A 1WR7A 1RFJA 4I5NB 1DJXA 3PFVA 3IQOA 2MRDA 4P2YB 2M9GA 1J7OA 2I2RE 2JTTA 3SG3A 4PHJA 3EK4A 4A4BA 4F0ZB 1V1FA 2G2BA 1KCYA 1CFPA 2WNDA 4MZJA 1XFYO 4ICBA 2OPOA 1ZFSA 3WXAA 2FOTA 2Q91A 2JT8A 1N2DA 4NDCA 1GJYA 4QJ3B 3L4HA 3BYAA 3DVEA 4GNKB 2NCPA 1F70A 2WOSA 1NWDA 1QS7A 4XYNA 4C0JA 1K8UA 2I94A 1GQMA 2L5XB 2WCFA 1TR8A 1G33A 2VRGA 1L2OC 1UURA 2XPBA 3KAFA 2M49B 2BKIB 3CR4X 1NPQA 3TCZA 1QLKA 3AKAA 1J7QA 2XPAA 3KHEA 2ZNDA 1I5HW 2F2PA 3BUMB 4HSZA 4YRUA 4U84A 1JMQA 1RWYA 1CTRA 1IG5A 2Y4QA 4YGBB 5I2OA 1PALA 1M31A 2EC6C 3KAHA 2F3YA 1NIWA 1DGUA 1IWQA 4D1EA 1DT7B 2LAJA 4DCKA 2KFFA 5IBWA 1FPWA 2OTGB 3F45A 1DJYA 4PDZA 3C1VA 3GK4X 4U85A 3EVVA 1A4PA 5E62A 1XA5A 2TN4A 1F4QA 2JULA 2ZQSA 5ER4X 1BMOA 2EZ5W 1JFKA 2DWVA 2QRVA 1H8BA 3DVJA 1CDPA 2XP5A 1IJ5A 1AJ4A 1UHKA 1QVIY 4CIDA 3ZWHA 2ZRTA 3NXAA 1K90D 1LINA 2JRFA 2L4HA 1Y0VH 3NSLA 1AK8A 1PVAA 1MQ1A 1TIZA 1DJHA 1YW5A 3DF0A 1QX2A 1CLBA 2HETA 2LVVA 4JWQA 4AQIA 4BY4A 1DJGA 2QPTA 1PSBA 1YUUA 3WNXB 1B7TZ 2KAYA 1UUSA 4QIBA 4NQGA 1KSMA 1WDCB 1BT6A 1MHOA 2L0PA 1NCXA 1NP8A 1YVHA 2L4IA 1AVSA 1NCZA 4M2PA 2MBXA 1CFDA 1WY9A 5I2LA 1BG1A 1NYAA 1TNXA 5BPJA 1B1GA 2RE3A 1PSRA 1RROA 2CXJA 2EC6B 2I7AA 5E5WA 1G4YR 1BLQA 3TDIA 2ZQTA 2PALA 2HPSA 2WADA 2RGIA 4GGFC 2PSRA 1YTZC 1ODBA 1B8CA 2JT3A 2K7DA 2SASA 5DKNA 3TUYC 3A8RA 2Q5AA 1WLZA 4JQ0D 2GV5A 2K0JA 2FJUB 4YI8A 1ZCNA 3BUXB 5G08A 2M29A 1CB1A 1QLSA 2D8NA 2JXWA 1A29A 1VRKA 3EKHA 3TZ1A 4OR9B 1F4OA 3TDBA 3JVTC 2L51A 2YSHA 1RP5A 1FLCA 2OS8C 4PE4A 1CNPA 2NCOA 3TC5A 2DMVA 3TS5C 1EG4A 1PRWA 4PHKA 3NTPA 2AAOA 5CSJA 2PVBA 1E8AA 2O60A 1QIWA 2ZFDA 3OX5A 3LL8B 5D7FA 2JT0A 1S1EA 1CKKA 1DF0A 1AJ5A 4GGNA 2PRUA 4UPGA 5E66A 1Q80A 2DK1A 3EVRA 1OMVA 3IF7A 1TTXA 2LP3A 3O6BA 4TNCA 4XJKB 3TDZA 1U5IA 5JJGA 1CDNA 1EJ3A 1J1EA 1J1DA 3BOWB 4QJ4B 1SL8A 2ZN8A 2LCPA 3AAKA 2WC8A 3KF9A 4CFRA 4N1FA 2JMFA 1DGVA 3WH0A 2FCEA 2V53A 1CFCA 5CPVA 3VRNA 1XK4C 3MQGA 1M63B 1B7TY 1SL7A 3TUYB 3RM1A 5GQQC 2JTZA 3FS7A 1CMFA 2XP9A 3LCPC 1JWDA 1K2HA 2JQ6A 2OTGC 1TNWA 1R2UA 2YAJB 5CSNA 1N0YA 5E64A 1K9RA 4AQJA 4OKHA 1XFZO 5HLOA 1K9QA 5B8IB 3I5FB 3OOBA 5HKZA 3HX4A 3JVTB 2LANA 3E3RA 3WHTB 1RK9A 1RTP1 2HQWA 2NZ0A 1UHNA 1F8AB 2HF5A 2O5GA 2OS8B 4MSPA 1JBAA 2JPTA 3CGAA 1NX2A 3LK0A 1W7IB 3TS5B 1SKTA 3FS8A 4WRIA 2BBMA 2KI6D 3I5GB 3FSBA 4PHNA 1IQ5A 2LVKA 1B4CA 1K9UA 3SJSA 1HT9A 1DF0B 1YUTA 1XVJA 2E6WA 2KI6C 2Y1NA 5HKYA 5KTYA 2NXQA 1WRZA 1B47A 2LMTA 2WAEA 2JXCA 2MA2A 2JWWA 4P5OE 1WDCC 1JF0A 1NX1A 1SBJA 1UHJA 1LKJA 3GK2A 1UP5A 2BCBA 2XP3A 1CLLA 2MLFC 5AEQA 2GGZA 1A75B 1PVBA 2L2EA 2NLNA 2ITKA 1XFVO 3SG6A 1F54A 3EVUA 3ODKA 4PE1A 5DKQA 3D0YA 1L7ZA 1NUBA 2BE6A 3RLZA 1BF5A 1SPYA 5HKWA 2KFGA 5DKRA 4YI9A 2B1UA 5KU1A 2XP4A 1DJZA 2LM5A 4MBEA 4FTGA 1S26D 4OV2A 1K94A 2BE4A 1TK7A 4ORBB 2M7NA 3I5HC 1K9PA 2E30A 1OSAA 1FBVA 1QATA 2GGMA 1JC2A 2Q4UA 1OZSA 1S6CA 1SRAA 3DVMA 3NSKA 4M2OA 4YGEB 4GFTA 5HLVA 2YSGA 3CNGA 2CNPA 2JX8A 3VRQA 1YURA 3K21A 2LV7A 2ISDA 4YGDB 2R2IA 4BY5A 1QXPA 2DJYA 3NSIA 3KEVA 1QJTA 1LA0A 4WQ2A 1IJ6A 1LVCD 1Y1XA 1SY9A 2BECA 2LUCA 1CM4A 1TCOB 3CS1A 3VGOA 2H61A 2LLSA 1S6JA 3LKXA 2K7CA 1ALWA 2M3WA 4YGAA 1CDLA 1D1OA 1K96A 2BCAA 3MCBA 2LP2A 1CMGA 5AFPA 2H2KA 1RJVA 2WORA 1V1GA 1ZOTB 1MR8A 2KAVA 1MWNA 1Y1AA 3D0YB 2BKHB 4Q04A 1KSOA 1XYDA 3M0WA 1YVLA 1UWOA 1KK7Z 2LC5A 3SG7A 3BXKA 2K7OA 4M2QA 2M7LA 5I8NA 5ER5A 1SK6D 1SL9A 1KQVA 4YBHB 3FWCA 2ZR5A 2KYCA 4GLXA 2F33A 2KQYA 3EK7A 3I5HB 4OCIA 2BL0B 1BU3A 1F71A 4C0KA 2BBNA 4PALA 1CDMA 3DF0B 2ZN9A 3I5FC 3PQHA 4C0LA 4ZCVA 4IL1A 1WMVA 2M3OW 2Y5IA 4PE0A 1B9AA 1KFUL 1TNQA 2KSPA 1N65A 2LNKA 1ZACA 4MZKA 5AXIA 2A4JA 2LVIA 2ZR6A 1FF1A 2MJWB 4PCWA 1H4BA 1BJFA 2MLEC 1UHHA 3I5GC 1DTLA 2L98A 1JFJA 3LK1A 3BQ3A 3EK8A 4ZCUA 5E65A 1CM1A 3BUWB 3PSRA 1BR4B 1M45A 4FQOA 2QACA 3PM8A 3MSEB 4DRWA 3BUNB 1EL4A 1S36A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3JTD C;  4CFQ A;  1SNL A;  1A03 A;  1YX8 A;  2G9B A;  2KNE A;  3QRX A;  4I5L B;  3ZNI A;  1QV0 A;  2KQ6 A;  3CLN A;  3OX6 A;  3VRR A;  4DUQ A;  3KO0 A;  2CBL A;  2EHB A;  2LHL A;  1C7W A;  1B8R A;  3ICB A;  1EH2 A;  1ZUZ A;  1XFW O;  1J55 A;  4N5X A;  2LLU A;  4PHM A;  2MDI A;  4DIR A;  1BR1 B;  2L4J A;  1JSA A;  1TNP A;  2ZAJ A;  4WQ3 A;  2ZR4 A;  2ZKM X;  2CTN A;  4QJ5 B;  1S6I A;  1KQM C;  1X02 A;  3O78 A;  2COL B;  1SYM A;  1CFF A;  1FI5 A;  3KAI A;  2PMY A;  2KHN A;  1SMG A;  3VRP A;  5TNC A;  4I5J A;  1YX7 A;  5JOL A;  2XP7 A;  3VRO A;  1KK7 Y;  2M0R A;  2KXQ A;  2M8I A;  2JU0 A;  4MLW A;  3PN7 C;  2KFH A;  1YR5 A;  3D10 A;  3M7N A;  3DVK A;  1K95 A;  1S5G Z;  4GUK A;  1TCF A;  3CR5 X;  4MRX A;  4DS7 A;  1TOP A;  1HQV A;  1QX5 B;  1REC A;  1OMD A;  1KK8 C;  3A4U B;  1G8I A;  1PK0 D;  2L50 A;  4YGC B;  3SG4 A;  1F8H A;  1SCM C;  1MF8 B;  1U5I B;  3NSO A;  3O2P A;  3WHU B;  3CZT X;  3JTD B;  5K89 A;  2Y1M A;  1M46 A;  4MZL A;  3KAG A;  1NX3 A;  4I5K A;  1GGZ A;  2BA1 A;  1FI6 A;  3SG5 A;  1XFX O;  1C07 A;  2EGD A;  3CTN A;  1DMO A;  2JOJ A;  4MRY A;  1SW8 A;  1XFU O;  1JUO A;  1QX7 A;  2K7B A;  5CQ2 A;  2ZQV A;  1XO5 A;  1NCY A;  5F6T A;  1OMR A;  1J7P A;  4AOM A;  3CR2 A;  1DJI A;  4CLN A;  1KQM B;  4U8D A;  3EKJ A;  1AHR A;  2M1K B;  1ALV A;  1FW4 A;  1K9K A;  2XP8 A;  3KAB A;  2BL0 C;  4GBA A;  1K93 D;  4OVN F;  3KAD A;  2K61 A;  3PN7 B;  3I5I C;  5AER A;  4REX A;  1WRL A;  1TN4 A;  1C7V A;  5KSZ A;  2XP6 A;  1KK8 B;  3SIB A;  2KBI A;  2M97 A;  2M8J A;  4MN0 A;  1LXF C;  2H61 C;  1DJW A;  2JC2 A;  2K8M B;  4HRG A;  1O6W A;  3DD4 A;  1SCM B;  3OHM B;  1EXR A;  1AUI B;  1W7J B;  3H4S E;  1EG3 A;  2KI4 C;  3OB1 B;  3HCM A;  1Y6W A;  4NDB A;  2K2F A;  4E5R A;  2LE9 B;  1MUX A;  4CPV A;  1ZMZ A;  2ZQU A;  1PIN A;  2LHI A;  2FCD A;  2F3Z A;  3M85 A;  1S5G Y;  4L9M A;  1SCV A;  2E45 A;  1YRT B;  5CSF A;  1JF2 A;  5D69 A;  2JXL A;  2CT9 A;  2WCE A;  1L2O B;  1YRU B;  2KOT A;  1IKU A;  1Y1U A;  4R1E A;  1QIV A;  3FIA A;  1OZO A;  5AHT A;  2DK7 A;  1OOJ A;  1R6P A;  1CLM A;  1UHI A;  1OQP A;  2LVJ A;  3KPX A;  3I5I B;  1WLM A;  1B8L A;  1SR6 C;  2KBM A;  2MHH A;  3CWG A;  1QV1 A;  2ZNE A;  4GPL B;  3OB2 B;  1QAS A;  5PAL A;  1BOD A;  1KFX L;  2F2O A;  1NSH A;  2LMV A;  4XJK A;  1MXE A;  4ETO A;  2KGB C;  3BOW A;  2CCM A;  2MAZ A;  3SIA A;  2KDH A;  3AKB A;  1OE9 B;  3FWB A;  1BOC A;  4GGF A;  3BUO B;  1WRK A;  4JPZ B;  1KWO C;  2BCX A;  2P6B B;  4N1G A;  2PAS A;  2F21 A;  2KI4 B;  1DVI A;  3PLF B;  2LAP A;  3GOF A;  4HRE E;  1A2X A;  2F8P A;  4E68 A;  1AP4 A;  2JZI A;  1TRF A;  2K2A A;  2KYF A;  1IGV A;  2HQ8 A;  4HRH A;  1IH0 A;  3TDU A;  1M39 A;  2WCB A;  5J3X A;  4NDD A;  4ORC B;  2DOQ A;  2YSF A;  2LMU A;  1KFX S;  1KFU S;  2M8U A;  4PE7 A;  5I2Q A;  2LUX A;  3OP0 A;  3PAL A;  2YSI A;  1MXL C;  2AUC A;  3IQQ A;  1S3P A;  4GAO A;  1IRJ A;  3KCE A;  2SCP A;  3GK1 A;  1IQ3 A;  2M1U A;  3PAT A;  2JV4 A;  1J7R A;  1SR6 B;  4MVF A;  5FYX A;  2I18 A;  3LLE A;  2KAX A;  1QVI Z;  3O4Y A;  1QTX A;  2JNF A;  1F55 A;  3LE4 A;  4MEW A;  1NX0 A;  1PUL A;  2IS9 A;  3AAJ A;  2LLT A;  2ZRS A;  2YSB A;  1NMV A;  2KGR A;  5AAN A;  2JNX A;  5HYD A;  4U86 A;  4USL A;  1XK4 A;  1YUS A;  1KWO B;  1A75 A;  2AMI A;  4ORA B;  5CSI A;  4A4C A;  1GGW A;  1LA3 A;  3SG2 A;  1WR7 A;  1RFJ A;  4I5N B;  1DJX A;  3PFV A;  3IQO A;  2MRD A;  4P2Y B;  2M9G A;  1J7O A;  2I2R E;  2JTT A;  3SG3 A;  4PHJ A;  3EK4 A;  4A4B A;  4F0Z B;  1V1F A;  2G2B A;  1KCY A;  1CFP A;  2WND A;  4MZJ A;  1XFY O;  4ICB A;  2OPO A;  1ZFS A;  3WXA A;  2FOT A;  2Q91 A;  2JT8 A;  1N2D A;  4NDC A;  1GJY A;  4QJ3 B;  3L4H A;  3BYA A;  3DVE A;  4GNK B;  2NCP A;  1F70 A;  2WOS A;  1NWD A;  1QS7 A;  4XYN A;  4C0J A;  1K8U A;  2I94 A;  1GQM A;  2L5X B;  2WCF A;  1G33 A;  2VRG A;  1L2O C;  1UUR A;  2XPB A;  3KAF A;  2M49 B;  2BKI B;  3CR4 X;  1NPQ A;  3TCZ A;  1QLK A;  3AKA A;  1J7Q A;  2XPA A;  3KHE A;  2ZND A;  1I5H W;  2F2P A;  3BUM B;  4HSZ A;  4YRU A;  4U84 A;  1JMQ A;  1RWY A;  1CTR A;  1IG5 A;  2Y4Q A;  4YGB B;  5I2O A;  1PAL A;  1M31 A;  2EC6 C;  3KAH A;  2F3Y A;  1NIW A;  1DGU A;  1IWQ A;  4D1E A;  1DT7 B;  2LAJ A;  4DCK A;  2KFF A;  5IBW A;  1FPW A;  2OTG B;  3F45 A;  1DJY A;  4PDZ A;  3C1V A;  3GK4 X;  4U85 A;  3EVV A;  1A4P A;  1XA5 A;  2TN4 A;  1F4Q A;  2JUL A;  2ZQS A;  5ER4 X;  1BMO A;  2EZ5 W;  1JFK A;  2DWV A;  1H8B A;  3DVJ A;  1CDP A;  2XP5 A;  1IJ5 A;  1AJ4 A;  1UHK A;  1QVI Y;  4CID A;  3ZWH A;  2ZRT A;  3NXA A;  1K90 D;  1LIN A;  2JRF A;  2L4H A;  1Y0V H;  3NSL A;  1AK8 A;  1PVA A;  1MQ1 A;  1TIZ A;  1DJH A;  1YW5 A;  3DF0 A;  1QX2 A;  1CLB A;  2HET A;  2LVV A;  4JWQ A;  4AQI A;  4BY4 A;  1DJG A;  2QPT A;  1PSB A;  1YUU A;  3WNX B;  1B7T Z;  2KAY A;  1UUS A;  4QIB A;  4NQG A;  1KSM A;  1WDC B;  1BT6 A;  1MHO A;  2L0P A;  1NCX A;  1NP8 A;  1YVH A;  2L4I A;  1AVS A;  1NCZ A;  4M2P A;  2MBX A;  1CFD A;  1WY9 A;  5I2L A;  1BG1 A;  1NYA A;  1TNX A;  5BPJ A;  1B1G A;  2RE3 A;  1PSR A;  1RRO A;  2CXJ A;  2EC6 B;  2I7A A;  1G4Y R;  1BLQ A;  3TDI A;  2ZQT A;  2PAL A;  2HPS A;  2RGI A;  4GGF C;  2PSR A;  1YTZ C;  1ODB A;  1B8C A;  2JT3 A;  2K7D A;  2SAS A;  5DKN A;  3TUY C;  3A8R A;  2Q5A A;  1WLZ A;  4JQ0 D;  2GV5 A;  2K0J A;  2FJU B;  4YI8 A;  1ZCN A;  3BUX B;  5G08 A;  2M29 A;  1CB1 A;  1QLS A;  2D8N A;  2JXW A;  1A29 A;  1VRK A;  3EKH A;  3TZ1 A;  4OR9 B;  1F4O A;  3TDB A;  3JVT C;  2L51 A;  2YSH A;  2OS8 C;  4PE4 A;  1CNP A;  2NCO A;  3TC5 A;  2DMV A;  3TS5 C;  1EG4 A;  1PRW A;  4PHK A;  3NTP A;  2AAO A;  5CSJ A;  2PVB A;  1E8A A;  2O60 A;  1QIW A;  2ZFD A;  3OX5 A;  3LL8 B;  5D7F A;  2JT0 A;  1S1E A;  1CKK A;  1DF0 A;  1AJ5 A;  4GGN A;  2PRU A;  4UPG A;  1Q80 A;  2DK1 A;  3EVR A;  1OMV A;  3IF7 A;  1TTX A;  2LP3 A;  3O6B A;  4TNC A;  4XJK B;  3TDZ A;  1U5I A;  5JJG A;  1CDN A;  1EJ3 A;  1J1E A;  1J1D A;  3BOW B;  4QJ4 B;  1SL8 A;  2ZN8 A;  2LCP A;  3AAK A;  2WC8 A;  3KF9 A;  4CFR A;  4N1F A;  2JMF A;  1DGV A;  3WH0 A;  2FCE A;  2V53 A;  1CFC A;  5CPV A;  3VRN A;  1XK4 C;  1M63 B;  1B7T Y;  1SL7 A;  3TUY B;  3RM1 A;  5GQQ C;  2JTZ A;  3FS7 A;  1CMF A;  2XP9 A;  3LCP C;  1JWD A;  1K2H A;  2JQ6 A;  2OTG C;  1TNW A;  1R2U A;  5CSN A;  1N0Y A;  1K9R A;  4AQJ A;  4OKH A;  1XFZ O;  5HLO A;  1K9Q A;  5B8I B;  3I5F B;  3OOB A;  5HKZ A;  3HX4 A;  3JVT B;  2LAN A;  3E3R A;  3WHT B;  1RK9 A;  1RTP 1;  2HQW A;  2NZ0 A;  1UHN A;  1F8A B;  2HF5 A;  2O5G A;  2OS8 B;  4MSP A;  1JBA A;  2JPT A;  3CGA A;  1NX2 A;  3LK0 A;  1W7I B;  3TS5 B;  1SKT A;  4WRI A;  2BBM A;  2KI6 D;  3I5G B;  4PHN A;  1IQ5 A;  2LVK A;  1B4C A;  1K9U A;  3SJS A;  1HT9 A;  1DF0 B;  1YUT A;  1XVJ A;  2E6W A;  2KI6 C;  2Y1N A;  5HKY A;  5KTY A;  2NXQ A;  1WRZ A;  1B47 A;  2LMT A;  2JXC A;  2MA2 A;  2JWW A;  4P5O E;  1WDC C;  1JF0 A;  1NX1 A;  1SBJ A;  1UHJ A;  1LKJ A;  3GK2 A;  1UP5 A;  2BCB A;  2XP3 A;  1CLL A;  2MLF C;  5AEQ A;  2GGZ A;  1A75 B;  1PVB A;  2L2E A;  2NLN A;  2ITK A;  1XFV O;  3SG6 A;  1F54 A;  3EVU A;  3ODK A;  4PE1 A;  5DKQ A;  3D0Y A;  1L7Z A;  1NUB A;  2BE6 A;  3RLZ A;  1BF5 A;  1SPY A;  5HKW A;  2KFG A;  5DKR A;  4YI9 A;  2B1U A;  5KU1 A;  2XP4 A;  1DJZ A;  2LM5 A;  4MBE A;  4FTG A;  1S26 D;  4OV2 A;  1K94 A;  2BE4 A;  1TK7 A;  4ORB B;  2M7N A;  3I5H C;  1K9P A;  2E30 A;  1OSA A;  1FBV A;  1QAT A;  2GGM A;  1JC2 A;  2Q4U A;  1OZS A;  1S6C A;  1SRA A;  3DVM A;  3NSK A;  4M2O A;  4YGE B;  4GFT A;  5HLV A;  2YSG A;  3CNG A;  2CNP A;  2JX8 A;  3VRQ A;  1YUR A;  3K21 A;  2LV7 A;  2ISD A;  4YGD B;  2R2I A;  4BY5 A;  1QXP A;  2DJY A;  3NSI A;  3KEV A;  1QJT A;  1LA0 A;  4WQ2 A;  1IJ6 A;  1LVC D;  1Y1X A;  1SY9 A;  2BEC A;  2LUC A;  1CM4 A;  1TCO B;  3CS1 A;  3VGO A;  2H61 A;  2LLS A;  1S6J A;  2K7C A;  1ALW A;  2M3W A;  4YGA A;  1CDL A;  1D1O A;  1K96 A;  2BCA A;  2LP2 A;  1CMG A;  5AFP A;  2H2K A;  1RJV A;  2WOR A;  1V1G A;  1ZOT B;  1MR8 A;  2KAV A;  1MWN A;  1Y1A A;  3D0Y B;  2BKH B;  4Q04 A;  1KSO A;  1XYD A;  3M0W A;  1YVL A;  1UWO A;  1KK7 Z;  2LC5 A;  3SG7 A;  3BXK A;  2K7O A;  4M2Q A;  2M7L A;  5I8N A;  5ER5 A;  1SK6 D;  1SL9 A;  1KQV A;  4YBH B;  3FWC A;  2ZR5 A;  2KYC A;  2F33 A;  2KQY A;  3EK7 A;  3I5H B;  4OCI A;  2BL0 B;  1BU3 A;  1F71 A;  4C0K A;  2BBN A;  4PAL A;  1CDM A;  3DF0 B;  2ZN9 A;  3I5F C;  4C0L A;  4ZCV A;  4IL1 A;  1WMV A;  2M3O W;  2Y5I A;  4PE0 A;  1B9A A;  1KFU L;  1TNQ A;  2KSP A;  1N65 A;  2LNK A;  1ZAC A;  4MZK A;  5AXI A;  2A4J A;  2LVI A;  2ZR6 A;  1FF1 A;  2MJW B;  4PCW A;  1H4B A;  1BJF A;  2MLE C;  1UHH A;  3I5G C;  1DTL A;  2L98 A;  1JFJ A;  3LK1 A;  3BQ3 A;  3EK8 A;  4ZCU A;  1CM1 A;  3BUW B;  3PSR A;  1BR4 B;  1M45 A;  4FQO A;  2QAC A;  3PM8 A;  3MSE B;  4DRW A;  3BUN B;  1EL4 A;  1S36 A; 
#chains in the Genus database with same CATH topology
 3JTD C;  4CFQ A;  1SNL A;  1A03 A;  1YX8 A;  2G9B A;  2KNE A;  3QRX A;  3NHI A;  4I5L B;  3ZNI A;  1QV0 A;  2KQ6 A;  3CLN A;  3OX6 A;  3VRR A;  4DUQ A;  3KO0 A;  2CBL A;  2EHB A;  2LHL A;  1C7W A;  1B8R A;  3ICB A;  1EH2 A;  1ZUZ A;  1XFW O;  1J55 A;  4N5X A;  2LLU A;  4PHM A;  3UO9 A;  3NHT A;  1BR1 B;  4DIR A;  2MDI A;  2L4J A;  1JSA A;  1TNP A;  2ZAJ A;  4WQ3 A;  2ZR4 A;  2ZKM X;  2CTN A;  3S0E A;  4QJ5 B;  1S6I A;  1KQM C;  1X02 A;  1OOI X;  3O78 A;  2COL B;  1SYM A;  1CFF A;  1FI5 A;  3KAI A;  2PMY A;  2KHN A;  1SMG A;  3VRP A;  5TNC A;  3O4X A;  4I5J A;  1YX7 A;  5JOL A;  1JFJ A;  3CZ0 A;  2QEO A;  2XP7 A;  3VRO A;  1KK7 Y;  2M0R A;  2KXQ A;  2M8I A;  2JU0 A;  4MLW A;  3PN7 C;  2KFH A;  1YR5 A;  3D10 A;  3M7N A;  3DVK A;  1K95 A;  3VB1 A;  1S5G Z;  4GUK A;  1TCF A;  3CR5 X;  4MRX A;  4DS7 A;  1TOP A;  1HQV A;  1QX5 B;  3FE6 A;  1REC A;  1OMD A;  2L2C A;  3B6X A;  1KK8 C;  3A4U B;  1G8I A;  1QWV A;  1PK0 D;  2L50 A;  4YGC B;  3SG4 A;  2WC6 A;  3BJH A;  5U47 A;  1F8H A;  1SCM C;  1MF8 B;  1U5I B;  2KLD A;  3NSO A;  3O2P A;  3WHU B;  2QEV A;  3CZT X;  3JTD B;  4JKT A;  5K89 A;  2Y1M A;  1M46 A;  4MZL A;  3KAG A;  1NX3 A;  4I5K A;  1GGZ A;  2BA1 A;  1FI6 A;  3SG5 A;  1W9Z A;  3K1E A;  2JPO A;  1XFX O;  1C07 A;  2EGD A;  3R1O A;  3CTN A;  2YGU A;  1DMO A;  2JOJ A;  4MRY A;  2KLE A;  3DY9 A;  3S0B A;  4A0T A;  1SW8 A;  1XFU O;  1JUO A;  1QX7 A;  2K7B A;  5CQ2 A;  2OWO A;  2ZQV A;  1XO5 A;  1NCY A;  5F6T A;  1OMR A;  1P28 A;  1J7P A;  4AOM A;  3CR2 A;  1DJI A;  4CLN A;  3BFH A;  3NGV A;  1KQM B;  4U8D A;  3EKJ A;  1AHR A;  3QME A;  2M1K B;  2Y8N B;  1ALV A;  3DZT A;  1FW4 A;  1K9K A;  3DXL A;  2XP8 A;  3KAB A;  3B87 A;  2QEH A;  2BL0 C;  4GBA A;  1K93 D;  4OVN F;  3KAD A;  2K61 A;  3PN7 B;  3I5I C;  2BNX A;  5AER A;  2QEB A;  4F7F A;  4REX A;  1WRL A;  1TN4 A;  1C7V A;  5KSZ A;  2XP6 A;  3CZ1 A;  1KK8 B;  3SIB A;  1TWO A;  2KBI A;  2M97 A;  3OGN A;  2M8J A;  4MN0 A;  1LXF C;  2H61 C;  1DJW A;  2JC2 A;  2K8M B;  4HRG A;  1O6W A;  3DD4 A;  1SCM B;  5FI2 A;  3OHM B;  1EXR A;  3D73 A;  1AUI B;  1W7J B;  3H4S E;  1EG3 A;  2KI4 C;  3OB1 B;  3HCM A;  1Y6W A;  3FSC A;  4NDB A;  2K2F A;  4E5R A;  2LE9 B;  1MUX A;  2PYQ A;  1ZMZ A;  4CPV A;  2ZQU A;  1PIN A;  2LHI A;  2FCD A;  1GM0 A;  2F3Z A;  3M85 A;  1S5G Y;  3S0G A;  2WCM A;  1SCV A;  4L9M A;  2E45 A;  1YRT B;  5CSF A;  1JF2 A;  5D69 A;  1Z2C B;  2JXL A;  3Q8I A;  4FQT A;  3IVT A;  2CT9 A;  3D78 A;  2WCE A;  1L2O B;  1YRU B;  2KOT A;  1IKU A;  1Y1U A;  4R1E A;  1QIV A;  3FIA A;  4OZD A;  3SS3 A;  1OZO A;  3L4L A;  5AHT A;  2DK7 A;  1OOJ A;  1R6P A;  1CLM A;  1UHI A;  1OQP A;  2LVJ A;  3KPX A;  3I5I B;  1WLM A;  1B8L A;  1SR6 C;  2KBM A;  2MHH A;  3CWG A;  1QV1 A;  2ZNE A;  4GPL B;  3OB2 B;  1QAS A;  5PAL A;  1BOD A;  1KFX L;  2F2O A;  1NSH A;  2LMV A;  4XJK A;  1MXE A;  4ETO A;  2KGB C;  1DC1 A;  3BOW A;  2CCM A;  2MAZ A;  3PJI A;  2KDH A;  3SIA A;  3AKB A;  5HL1 A;  1OE9 B;  3FWB A;  1BOC A;  4GGF A;  1OOF A;  3BUO B;  3LKX B;  1WRK A;  4JPZ B;  1KWO C;  2BCX A;  3R72 A;  2P6B B;  4N1G A;  2PAS A;  2F21 A;  2KI4 B;  3MCB B;  1DVI A;  3PLF B;  2LAP A;  3GOF A;  4HRE E;  1A2X A;  2F8P A;  3RZS A;  4E68 A;  3DYE A;  1AP4 A;  2JZI A;  1TRF A;  2K2A A;  2KYF A;  1DEL A;  1IGV A;  2HQ8 A;  3PM2 A;  4HRH A;  1IH0 A;  3TDU A;  1M39 A;  2WCB A;  3V2L A;  1C3Y A;  5J3X A;  4NDD A;  4ORC B;  2DOQ A;  2YSF A;  2LMU A;  1KFX S;  1KFU S;  2M8U A;  2QDI A;  4PE7 A;  2LUX A;  5I2Q A;  3OP0 A;  3FE8 A;  3PAL A;  2YSI A;  1MXL C;  2AUC A;  2L5Y A;  1DEK A;  3IQQ A;  1S3P A;  4GAO A;  1IRJ A;  3KCE A;  2SCP A;  3GK1 A;  1IQ3 A;  2M1U A;  3PAT A;  1DQE A;  4A0U A;  2JV4 A;  1J7R A;  5I94 A;  1SR6 B;  4MVF A;  5FYX A;  2WCH A;  2P71 A;  2I18 A;  3LLE A;  2KAX A;  2K60 A;  5D3O A;  1QVI Z;  3O4Y A;  1QTX A;  2JNF A;  1F55 A;  3LE4 A;  4MEW A;  1NX0 A;  1PUL A;  2IS9 A;  3AAJ A;  2LLT A;  2ZRS A;  3MQH A;  2YSB A;  1NMV A;  2KGR A;  5AAN A;  2JNX A;  5HYD A;  4U86 A;  3EG5 B;  4USL A;  1XK4 A;  1YUS A;  1KWO B;  1A75 A;  2AMI A;  4ORA B;  5CSI A;  4A4C A;  1GGW A;  1LA3 A;  3SG2 A;  1WR7 A;  1RFJ A;  4I5N B;  1DJX A;  3PFV A;  3IQO A;  2MRD A;  4P2Y B;  2M9G A;  1J7O A;  3BFB A;  2I2R E;  2JTT A;  3SG3 A;  4PHJ A;  3EK4 A;  3B88 A;  4A4B A;  4F0Z B;  1V1F A;  2G2B A;  1KCY A;  1CFP A;  2WND A;  4MZJ A;  1XFY O;  4ICB A;  2OPO A;  1ZFS A;  3WXA A;  2FOT A;  4INX A;  2Q91 A;  1SSE B;  1N2D A;  2JT8 A;  4NDC A;  1GJY A;  4QJ3 B;  3L4H A;  3BYA A;  3S0D A;  2FJY A;  3DVE A;  4GNK B;  3S0F A;  2NCP A;  1F70 A;  2WOS A;  1NWD A;  1QS7 A;  4XYN A;  5EL2 A;  4C0J A;  1IIO A;  1K8U A;  2I94 A;  1GQM A;  2L5X B;  2WCF A;  3S0A A;  1TR8 A;  1G33 A;  3SS5 A;  2VRG A;  1L2O C;  1UUR A;  2XPB A;  3KAF A;  2M49 B;  2BKI B;  3CR4 X;  1NPQ A;  3TCZ A;  1QLK A;  3AKA A;  1J7Q A;  2XPA A;  3KHE A;  2ZND A;  1I5H W;  2F2P A;  3BUM B;  4HSZ A;  4YRU A;  4U84 A;  1JMQ A;  3CAB A;  1RWY A;  1CTR A;  1IG5 A;  2Y4Q A;  3N7H A;  4YGB B;  5I2O A;  1PAL A;  1M31 A;  2EC6 C;  3KAH A;  2F3Y A;  1NIW A;  2GTE A;  1DGU A;  1IWQ A;  4D1E A;  1DT7 B;  2LAJ A;  4DCK A;  2KFF A;  5IBW A;  1FPW A;  2OTG B;  3F45 A;  1DJY A;  4PDZ A;  3C1V A;  3GK4 X;  4U85 A;  3EVV A;  1A4P A;  5E62 A;  1XA5 A;  2TN4 A;  1F4Q A;  2JUL A;  2ZQS A;  5ER4 X;  1BMO A;  2EZ5 W;  1JFK A;  2DWV A;  2QRV A;  1H8B A;  3DVJ A;  1C3Z A;  1CDP A;  2WCK A;  2XP5 A;  1IJ5 A;  1AJ4 A;  1UHK A;  1QVI Y;  4CID A;  3ZWH A;  2P70 A;  2ZRT A;  3NXA A;  1OOH A;  1K90 D;  1LIN A;  2JRF A;  2L4H A;  1Y0V H;  3NSL A;  1AK8 A;  1PVA A;  1MQ1 A;  1TIZ A;  1DJH A;  1Z4H A;  5DIC A;  1YW5 A;  3DF0 A;  1QX2 A;  1CLB A;  2HET A;  2LVV A;  1TUZ A;  4JWQ A;  4AQI A;  4BY4 A;  1DJG A;  2QPT A;  1PSB A;  1YUU A;  3WNX B;  1B7T Z;  2KAY A;  1UUS A;  4QIB A;  4NQG A;  3OBV A;  1KSM A;  1WDC B;  1BT6 A;  1MHO A;  2L0P A;  1NCX A;  1NP8 A;  1YVH A;  2L4I A;  1AVS A;  1NCZ A;  4M2P A;  2MBX A;  1CFD A;  1WY9 A;  5I2L A;  1BG1 A;  1NYA A;  1TNX A;  5BPJ A;  1B1G A;  2RE3 A;  1PSR A;  1LS8 A;  1RRO A;  2CXJ A;  2EC6 B;  2WCJ A;  2I7A A;  5E5W A;  1G4Y R;  1BLQ A;  3TDI A;  2ZQT A;  2PAL A;  2HPS A;  2WAD A;  2RGI A;  2WC5 A;  4GGF C;  2PSR A;  1YTZ C;  1ODB A;  1B8C A;  2JT3 A;  2K7D A;  2SAS A;  5DKN A;  4PT1 A;  3TUY C;  3A8R A;  2Q5A A;  1WLZ A;  4JQ0 D;  2GV5 A;  2K0J A;  2FJU B;  4YI8 A;  1T14 A;  1ZCN A;  3BUX B;  5G08 A;  2BAP A;  2M29 A;  1CB1 A;  1QLS A;  2D8N A;  2JXW A;  1A29 A;  1VRK A;  3EKH A;  3TZ1 A;  4OR9 B;  1F4O A;  3TDB A;  3JVT C;  2L51 A;  2YSH A;  1RP5 A;  1FLC A;  1TUJ A;  2OS8 C;  4PE4 A;  1CNP A;  2NCO A;  3TC5 A;  2DMV A;  3TS5 C;  1EG4 A;  1PRW A;  4PHK A;  3NTP A;  2AAO A;  5CSJ A;  2PVB A;  1E8A A;  2O60 A;  1QIW A;  2ZFD A;  3OX5 A;  3LL8 B;  5D7F A;  2JT0 A;  1S1E A;  1CKK A;  1DF0 A;  1AJ5 A;  4GGN A;  2PRU A;  4UPG A;  5E66 A;  1Q80 A;  2DK1 A;  3EVR A;  1OMV A;  3IF7 A;  1TTX A;  2LP3 A;  3O6B A;  4TNC A;  4XJK B;  3L4A A;  1U5I A;  3BFA A;  3TDZ A;  1EJ3 A;  1J1E A;  1J1D A;  3BOW B;  4QJ4 B;  1SL8 A;  2ZN8 A;  1CDN A;  2LCP A;  3AAK A;  2WC8 A;  3KF9 A;  4CFR A;  4N1F A;  2JMF A;  1DGV A;  3WH0 A;  2FCE A;  2V53 A;  1CFC A;  5CPV A;  5FI6 A;  3VRN A;  1XK4 C;  3MQG A;  1M63 B;  1B7T Y;  1SL7 A;  3R1P A;  3RM1 A;  3TUY B;  5GQQ C;  2JTZ A;  2KPH A;  3FS7 A;  1CMF A;  2XP9 A;  3LCP C;  1JWD A;  1K2H A;  2JQ6 A;  2OTG C;  1TNW A;  3D77 A;  1R2U A;  2YAJ B;  5CSN A;  1N0Y A;  5E64 A;  1K9R A;  4AQJ A;  4OKH A;  1OW4 A;  1XFZ O;  5HLO A;  3UNW A;  5B8I B;  1K9Q A;  3I5F B;  3OOB A;  5HKZ A;  3HX4 A;  3JVT B;  2LAN A;  3E3R A;  3WHT B;  1RK9 A;  1RTP 1;  2HQW A;  2NZ0 A;  1UHN A;  1F8A B;  2HF5 A;  2O5G A;  2OS8 B;  4MSP A;  1JBA A;  2JPT A;  1OOG A;  1NX2 A;  3CGA A;  3LK0 A;  1W7I B;  3D76 A;  3TS5 B;  1SKT A;  3FS8 A;  4WRI A;  2BBM A;  2KI6 D;  3I5G B;  3FSB A;  4PHN A;  5JJG A;  2H8V A;  1IQ5 A;  2LVK A;  1B4C A;  1K9U A;  3SJS A;  1HT9 A;  1DF0 B;  1YUT A;  1XVJ A;  2E6W A;  2KI6 C;  2Y1N A;  5HKY A;  5KTY A;  4JD9 A;  2NXQ A;  1WRZ A;  1B47 A;  2LMT A;  2WAE A;  2JXC A;  2MA2 A;  2JWW A;  4P5O E;  1WDC C;  1JF0 A;  1NX1 A;  1SBJ A;  1UHJ A;  1LKJ A;  3GK2 A;  1UP5 A;  2BCB A;  2XP3 A;  1CLL A;  2MLF C;  5AEQ A;  3D74 A;  2GGZ A;  1A75 B;  1PVB A;  2L2E A;  2NLN A;  2ITK A;  1XFV O;  3SG6 A;  1F54 A;  3EVU A;  3ODK A;  4PE1 A;  5DKQ A;  3D0Y A;  1L7Z A;  1NUB A;  2BE6 A;  3RLZ A;  1BF5 A;  1XFR A;  1ORG A;  1SPY A;  5HKW A;  2KFG A;  5DKR A;  4YI9 A;  2B1U A;  5KU1 A;  2XP4 A;  1DJZ A;  2LM5 A;  4MBE A;  4FTG A;  1S26 D;  4OV2 A;  1K94 A;  2BE4 A;  1TK7 A;  4ORB B;  2M7N A;  3CYZ A;  3I5H C;  1K9P A;  2E30 A;  1OSA A;  1FBV A;  1QAT A;  2GGM A;  1JC2 A;  2Q4U A;  1OZS A;  1S6C A;  1SRA A;  3DVM A;  3NSK A;  4M2O A;  4YGE B;  4GFT A;  5HLV A;  2YSG A;  3CNG A;  2CNP A;  2JX8 A;  3VRQ A;  1YUR A;  3K21 A;  2LV7 A;  2ISD A;  4IJ7 A;  2R2I A;  3L47 A;  4YGD B;  1QXP A;  4BY5 A;  3NSI A;  2DJY A;  4KYN A;  3CDN A;  3KEV A;  1QJT A;  1LA0 A;  4WQ2 A;  1IJ6 A;  1LVC D;  1Y1X A;  1SY9 A;  2BEC A;  2LUC A;  1CM4 A;  1TCO B;  3CS1 A;  3VGO A;  2H61 A;  2LLS A;  1S6J A;  3LKX A;  2K7C A;  2WCL A;  1ALW A;  2M3W A;  4YGA A;  1CDL A;  1D1O A;  1K96 A;  2BCA A;  3MCB A;  2LP2 A;  1CMG A;  5AFP A;  2H2K A;  1RJV A;  3B86 A;  2WOR A;  1V1G A;  1ZOT B;  1MR8 A;  2KAV A;  1MWN A;  1Y1A A;  3D0Y B;  2BKH B;  4Q04 A;  1KSO A;  3SS4 A;  1XYD A;  3M0W A;  1YVL A;  1UWO A;  1KK7 Z;  2LC5 A;  3FE9 A;  3SG7 A;  3BXK A;  2K7O A;  4M2Q A;  2M7L A;  5I8N A;  3D75 A;  1SK6 D;  1SL9 A;  5ER5 A;  4YBH B;  1KQV A;  3CZ2 A;  3FWC A;  2ZR5 A;  2KYC A;  4GLX A;  2F33 A;  2KQY A;  3EK7 A;  3I5H B;  4OCI A;  2BL0 B;  1BU3 A;  1F71 A;  4C0K A;  2BBN A;  4PAL A;  1CDM A;  2ERB A;  3DF0 B;  2ZN9 A;  3I5F C;  3PQH A;  4C0L A;  4ZCV A;  4IL1 A;  1WMV A;  2M3O W;  2Y5I A;  4PE0 A;  1B9A A;  1KFU L;  1TNQ A;  2KSP A;  1N65 A;  2LNK A;  1ZAC A;  4MZK A;  5AXI A;  2A4J A;  2LVI A;  2ZR6 A;  1FF1 A;  2MJW B;  3B7A A;  4PCW A;  1H4B A;  1BJF A;  2MLE C;  1UHH A;  2PQL A;  1DTL A;  2L98 A;  3I5G C;  3R1V A;  5FI7 A;  3LK1 A;  3BQ3 A;  3EK8 A;  4ZCU A;  5E65 A;  1CM1 A;  3BUW B;  3PSR A;  1BR4 B;  1M45 A;  4FQO A;  2QAC A;  4INW A;  3PM8 A;  3MSE B;  4DRW A;  3BUN B;  1EL4 A;  1S36 A; 
#chains in the Genus database with same CATH homology
 3JTD C;  4CFQ A;  1SNL A;  1A03 A;  1YX8 A;  2G9B A;  2KNE A;  3QRX A;  4I5L B;  3ZNI A;  1QV0 A;  2KQ6 A;  3CLN A;  3OX6 A;  3VRR A;  4DUQ A;  3KO0 A;  2CBL A;  2EHB A;  2LHL A;  1C7W A;  1B8R A;  3ICB A;  1EH2 A;  1ZUZ A;  1XFW O;  1J55 A;  4N5X A;  2LLU A;  4PHM A;  2MDI A;  4DIR A;  1BR1 B;  2L4J A;  1JSA A;  1TNP A;  2ZAJ A;  4WQ3 A;  2ZR4 A;  2ZKM X;  2CTN A;  4QJ5 B;  1S6I A;  1KQM C;  1X02 A;  3O78 A;  2COL B;  1SYM A;  1CFF A;  1FI5 A;  3KAI A;  2PMY A;  2KHN A;  1SMG A;  3VRP A;  5TNC A;  4I5J A;  1YX7 A;  5JOL A;  2XP7 A;  3VRO A;  1KK7 Y;  2M0R A;  2KXQ A;  2M8I A;  2JU0 A;  4MLW A;  3PN7 C;  2KFH A;  1YR5 A;  3D10 A;  3M7N A;  3DVK A;  1K95 A;  1S5G Z;  4GUK A;  1TCF A;  3CR5 X;  4MRX A;  4DS7 A;  1TOP A;  1HQV A;  1QX5 B;  1REC A;  1OMD A;  1KK8 C;  3A4U B;  1G8I A;  1PK0 D;  2L50 A;  4YGC B;  3SG4 A;  5U47 A;  1F8H A;  1SCM C;  1MF8 B;  1U5I B;  3NSO A;  3O2P A;  3WHU B;  3CZT X;  3JTD B;  5K89 A;  2Y1M A;  1M46 A;  4MZL A;  3KAG A;  1NX3 A;  4I5K A;  1GGZ A;  2BA1 A;  1FI6 A;  3SG5 A;  1XFX O;  1C07 A;  2EGD A;  3CTN A;  1DMO A;  2JOJ A;  4MRY A;  4A0T A;  1SW8 A;  1XFU O;  1JUO A;  1QX7 A;  2K7B A;  5CQ2 A;  2OWO A;  2ZQV A;  1XO5 A;  1NCY A;  5F6T A;  1OMR A;  1J7P A;  4AOM A;  3CR2 A;  1DJI A;  4CLN A;  1KQM B;  4U8D A;  3EKJ A;  1AHR A;  2M1K B;  2Y8N B;  1ALV A;  1FW4 A;  1K9K A;  2XP8 A;  3KAB A;  2BL0 C;  4GBA A;  1K93 D;  4OVN F;  3KAD A;  2K61 A;  3PN7 B;  3I5I C;  5AER A;  4REX A;  1WRL A;  1TN4 A;  1C7V A;  5KSZ A;  2XP6 A;  1KK8 B;  3SIB A;  2KBI A;  2M97 A;  2M8J A;  4MN0 A;  1LXF C;  2H61 C;  1DJW A;  2JC2 A;  2K8M B;  4HRG A;  1O6W A;  3DD4 A;  1SCM B;  3OHM B;  1EXR A;  1AUI B;  1W7J B;  3H4S E;  1EG3 A;  2KI4 C;  3OB1 B;  3HCM A;  1Y6W A;  3FSC A;  4NDB A;  2K2F A;  4E5R A;  2LE9 B;  1MUX A;  4CPV A;  1ZMZ A;  2ZQU A;  1PIN A;  2LHI A;  2FCD A;  2F3Z A;  3M85 A;  1S5G Y;  4L9M A;  1SCV A;  2E45 A;  1YRT B;  5CSF A;  1JF2 A;  5D69 A;  2JXL A;  2CT9 A;  2WCE A;  1L2O B;  1YRU B;  2KOT A;  1IKU A;  1Y1U A;  4R1E A;  1QIV A;  3FIA A;  1OZO A;  5AHT A;  2DK7 A;  1OOJ A;  1R6P A;  1CLM A;  1UHI A;  1OQP A;  2LVJ A;  3KPX A;  3I5I B;  1WLM A;  1B8L A;  1SR6 C;  2KBM A;  2MHH A;  3CWG A;  1QV1 A;  2ZNE A;  4GPL B;  3OB2 B;  1QAS A;  5PAL A;  1BOD A;  1KFX L;  2F2O A;  1NSH A;  2LMV A;  4XJK A;  1MXE A;  4ETO A;  2KGB C;  3BOW A;  2CCM A;  2MAZ A;  3SIA A;  2KDH A;  3AKB A;  1OE9 B;  3FWB A;  1BOC A;  4GGF A;  3BUO B;  3LKX B;  1WRK A;  4JPZ B;  1KWO C;  2BCX A;  2P6B B;  4N1G A;  2PAS A;  2F21 A;  2KI4 B;  3MCB B;  1DVI A;  3PLF B;  2LAP A;  3GOF A;  4HRE E;  1A2X A;  2F8P A;  4E68 A;  1AP4 A;  2JZI A;  1TRF A;  2K2A A;  2KYF A;  1IGV A;  2HQ8 A;  4HRH A;  1IH0 A;  3TDU A;  1M39 A;  2WCB A;  5J3X A;  4NDD A;  4ORC B;  2DOQ A;  2YSF A;  2LMU A;  1KFX S;  1KFU S;  2M8U A;  4PE7 A;  5I2Q A;  2LUX A;  3OP0 A;  3PAL A;  2YSI A;  1MXL C;  2AUC A;  3IQQ A;  1S3P A;  4GAO A;  1IRJ A;  3KCE A;  2SCP A;  3GK1 A;  1IQ3 A;  2M1U A;  3PAT A;  4A0U A;  2JV4 A;  1J7R A;  1SR6 B;  4MVF A;  5FYX A;  2I18 A;  3LLE A;  2KAX A;  1QVI Z;  3O4Y A;  1QTX A;  2JNF A;  1F55 A;  3LE4 A;  4MEW A;  1NX0 A;  1PUL A;  2IS9 A;  3AAJ A;  2LLT A;  2ZRS A;  3MQH A;  2YSB A;  1NMV A;  2KGR A;  5AAN A;  2JNX A;  5HYD A;  4U86 A;  4USL A;  1XK4 A;  1YUS A;  1KWO B;  1A75 A;  2AMI A;  4ORA B;  5CSI A;  4A4C A;  1GGW A;  1LA3 A;  3SG2 A;  1WR7 A;  1RFJ A;  4I5N B;  1DJX A;  3PFV A;  3IQO A;  2MRD A;  4P2Y B;  2M9G A;  1J7O A;  2I2R E;  2JTT A;  3SG3 A;  4PHJ A;  3EK4 A;  4A4B A;  4F0Z B;  1V1F A;  2G2B A;  1KCY A;  1CFP A;  2WND A;  4MZJ A;  1XFY O;  4ICB A;  2OPO A;  1ZFS A;  3WXA A;  2FOT A;  2Q91 A;  2JT8 A;  1N2D A;  4NDC A;  1GJY A;  4QJ3 B;  3L4H A;  3BYA A;  3DVE A;  4GNK B;  2NCP A;  1F70 A;  2WOS A;  1NWD A;  1QS7 A;  4XYN A;  4C0J A;  1K8U A;  2I94 A;  1GQM A;  2L5X B;  2WCF A;  1TR8 A;  1G33 A;  2VRG A;  1L2O C;  1UUR A;  2XPB A;  3KAF A;  2M49 B;  2BKI B;  3CR4 X;  1NPQ A;  3TCZ A;  1QLK A;  3AKA A;  1J7Q A;  2XPA A;  3KHE A;  2ZND A;  1I5H W;  2F2P A;  3BUM B;  4HSZ A;  4YRU A;  4U84 A;  1JMQ A;  1RWY A;  1CTR A;  1IG5 A;  2Y4Q A;  4YGB B;  5I2O A;  1PAL A;  1M31 A;  2EC6 C;  3KAH A;  2F3Y A;  1NIW A;  1DGU A;  1IWQ A;  4D1E A;  1DT7 B;  2LAJ A;  4DCK A;  2KFF A;  5IBW A;  1FPW A;  2OTG B;  3F45 A;  1DJY A;  4PDZ A;  3C1V A;  3GK4 X;  4U85 A;  3EVV A;  1A4P A;  5E62 A;  1XA5 A;  2TN4 A;  1F4Q A;  2JUL A;  2ZQS A;  5ER4 X;  1BMO A;  2EZ5 W;  1JFK A;  2DWV A;  2QRV A;  1H8B A;  3DVJ A;  1CDP A;  2XP5 A;  1IJ5 A;  1AJ4 A;  1UHK A;  1QVI Y;  4CID A;  3ZWH A;  2ZRT A;  3NXA A;  1K90 D;  1LIN A;  2JRF A;  2L4H A;  1Y0V H;  3NSL A;  1AK8 A;  1PVA A;  1MQ1 A;  1TIZ A;  1DJH A;  1YW5 A;  3DF0 A;  1QX2 A;  1CLB A;  2HET A;  2LVV A;  4JWQ A;  4AQI A;  4BY4 A;  1DJG A;  2QPT A;  1PSB A;  1YUU A;  3WNX B;  1B7T Z;  2KAY A;  1UUS A;  4QIB A;  4NQG A;  1KSM A;  1WDC B;  1BT6 A;  1MHO A;  2L0P A;  1NCX A;  1NP8 A;  1YVH A;  2L4I A;  1AVS A;  1NCZ A;  4M2P A;  2MBX A;  1CFD A;  1WY9 A;  5I2L A;  1BG1 A;  1NYA A;  1TNX A;  5BPJ A;  1B1G A;  2RE3 A;  1PSR A;  1RRO A;  2CXJ A;  2EC6 B;  2I7A A;  5E5W A;  1G4Y R;  1BLQ A;  3TDI A;  2ZQT A;  2PAL A;  2HPS A;  2WAD A;  2RGI A;  4GGF C;  2PSR A;  1YTZ C;  1ODB A;  1B8C A;  2JT3 A;  2K7D A;  2SAS A;  5DKN A;  3TUY C;  3A8R A;  2Q5A A;  1WLZ A;  4JQ0 D;  2GV5 A;  2K0J A;  2FJU B;  4YI8 A;  1ZCN A;  3BUX B;  5G08 A;  2M29 A;  1CB1 A;  1QLS A;  2D8N A;  2JXW A;  1A29 A;  1VRK A;  3EKH A;  3TZ1 A;  4OR9 B;  1F4O A;  3TDB A;  3JVT C;  2L51 A;  2YSH A;  1RP5 A;  1FLC A;  2OS8 C;  4PE4 A;  1CNP A;  2NCO A;  3TC5 A;  2DMV A;  3TS5 C;  1EG4 A;  1PRW A;  4PHK A;  3NTP A;  2AAO A;  5CSJ A;  2PVB A;  1E8A A;  2O60 A;  1QIW A;  2ZFD A;  3OX5 A;  3LL8 B;  5D7F A;  2JT0 A;  1S1E A;  1CKK A;  1DF0 A;  1AJ5 A;  4GGN A;  2PRU A;  4UPG A;  5E66 A;  1Q80 A;  2DK1 A;  3EVR A;  1OMV A;  3IF7 A;  1TTX A;  2LP3 A;  3O6B A;  4TNC A;  4XJK B;  3TDZ A;  1U5I A;  5JJG A;  1CDN A;  1EJ3 A;  1J1E A;  1J1D A;  3BOW B;  4QJ4 B;  1SL8 A;  2ZN8 A;  2LCP A;  3AAK A;  2WC8 A;  3KF9 A;  4CFR A;  4N1F A;  2JMF A;  1DGV A;  3WH0 A;  2FCE A;  2V53 A;  1CFC A;  5CPV A;  3VRN A;  1XK4 C;  3MQG A;  1M63 B;  1B7T Y;  1SL7 A;  3TUY B;  3RM1 A;  5GQQ C;  2JTZ A;  3FS7 A;  1CMF A;  2XP9 A;  3LCP C;  1JWD A;  1K2H A;  2JQ6 A;  2OTG C;  1TNW A;  1R2U A;  2YAJ B;  5CSN A;  1N0Y A;  5E64 A;  1K9R A;  4AQJ A;  4OKH A;  1XFZ O;  5HLO A;  1K9Q A;  5B8I B;  3I5F B;  3OOB A;  5HKZ A;  3HX4 A;  3JVT B;  2LAN A;  3E3R A;  3WHT B;  1RK9 A;  1RTP 1;  2HQW A;  2NZ0 A;  1UHN A;  1F8A B;  2HF5 A;  2O5G A;  2OS8 B;  4MSP A;  1JBA A;  2JPT A;  3CGA A;  1NX2 A;  3LK0 A;  1W7I B;  3TS5 B;  1SKT A;  3FS8 A;  4WRI A;  2BBM A;  2KI6 D;  3I5G B;  3FSB A;  4PHN A;  1IQ5 A;  2LVK A;  1B4C A;  1K9U A;  3SJS A;  1HT9 A;  1DF0 B;  1YUT A;  1XVJ A;  2E6W A;  2KI6 C;  2Y1N A;  5HKY A;  5KTY A;  2NXQ A;  1WRZ A;  1B47 A;  2LMT A;  2WAE A;  2JXC A;  2MA2 A;  2JWW A;  4P5O E;  1WDC C;  1JF0 A;  1NX1 A;  1SBJ A;  1UHJ A;  1LKJ A;  3GK2 A;  1UP5 A;  2BCB A;  2XP3 A;  1CLL A;  2MLF C;  5AEQ A;  2GGZ A;  1A75 B;  1PVB A;  2L2E A;  2NLN A;  2ITK A;  1XFV O;  3SG6 A;  1F54 A;  3EVU A;  3ODK A;  4PE1 A;  5DKQ A;  3D0Y A;  1L7Z A;  1NUB A;  2BE6 A;  3RLZ A;  1BF5 A;  1SPY A;  5HKW A;  2KFG A;  5DKR A;  4YI9 A;  2B1U A;  5KU1 A;  2XP4 A;  1DJZ A;  2LM5 A;  4MBE A;  4FTG A;  1S26 D;  4OV2 A;  1K94 A;  2BE4 A;  1TK7 A;  4ORB B;  2M7N A;  3I5H C;  1K9P A;  2E30 A;  1OSA A;  1FBV A;  1QAT A;  2GGM A;  1JC2 A;  2Q4U A;  1OZS A;  1S6C A;  1SRA A;  3DVM A;  3NSK A;  4M2O A;  4YGE B;  4GFT A;  5HLV A;  2YSG A;  3CNG A;  2CNP A;  2JX8 A;  3VRQ A;  1YUR A;  3K21 A;  2LV7 A;  2ISD A;  4YGD B;  2R2I A;  4BY5 A;  1QXP A;  2DJY A;  3NSI A;  3KEV A;  1QJT A;  1LA0 A;  4WQ2 A;  1IJ6 A;  1LVC D;  1Y1X A;  1SY9 A;  2BEC A;  2LUC A;  1CM4 A;  1TCO B;  3CS1 A;  3VGO A;  2H61 A;  2LLS A;  1S6J A;  3LKX A;  2K7C A;  1ALW A;  2M3W A;  4YGA A;  1CDL A;  1D1O A;  1K96 A;  2BCA A;  3MCB A;  2LP2 A;  1CMG A;  5AFP A;  2H2K A;  1RJV A;  2WOR A;  1V1G A;  1ZOT B;  1MR8 A;  2KAV A;  1MWN A;  1Y1A A;  3D0Y B;  2BKH B;  4Q04 A;  1KSO A;  1XYD A;  3M0W A;  1YVL A;  1UWO A;  1KK7 Z;  2LC5 A;  3SG7 A;  3BXK A;  2K7O A;  4M2Q A;  2M7L A;  5I8N A;  5ER5 A;  1SK6 D;  1SL9 A;  1KQV A;  4YBH B;  3FWC A;  2ZR5 A;  2KYC A;  4GLX A;  2F33 A;  2KQY A;  3EK7 A;  3I5H B;  4OCI A;  2BL0 B;  1BU3 A;  1F71 A;  4C0K A;  2BBN A;  4PAL A;  1CDM A;  3DF0 B;  2ZN9 A;  3I5F C;  3PQH A;  4C0L A;  4ZCV A;  4IL1 A;  1WMV A;  2M3O W;  2Y5I A;  4PE0 A;  1B9A A;  1KFU L;  1TNQ A;  2KSP A;  1N65 A;  2LNK A;  1ZAC A;  4MZK A;  5AXI A;  2A4J A;  2LVI A;  2ZR6 A;  1FF1 A;  2MJW B;  4PCW A;  1H4B A;  1BJF A;  2MLE C;  1UHH A;  3I5G C;  1DTL A;  2L98 A;  1JFJ A;  3LK1 A;  3BQ3 A;  3EK8 A;  4ZCU A;  5E65 A;  1CM1 A;  3BUW B;  3PSR A;  1BR4 B;  1M45 A;  4FQO A;  2QAC A;  3PM8 A;  3MSE B;  4DRW A;  3BUN B;  1EL4 A;  1S36 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...