1EG3A

Structure of a dystrophin ww domain fragment in complex with a beta-dystroglycan peptide
Total Genus 98
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
98
sequence length
260
structure length
260
Chain Sequence
PASQHFLSTSVQGPWERAISPNKVPYYINHETQTTCWDHPKMTELYQSLADLNNVRFSAYRTAMKLRRLQKALCLDLLSLSAACDALDQHNLKQNDQPMDILQIINCLTTIYDRLEQEHNNLVNVPLCVDMCLNWLLNVYDTGRTGRIRVLSFKTGIISLCKAHLEDKYRYLFKQVASSTGFCDQRRLGLLLHDSIQIPRQLGEVASFGGSNIEPSVRSCFQFANNKPEIEAALFLDWMRLEPQSMVWLPVLHRVAAAET
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure of a WW domain containing fragment of dystrophin in complex with beta-dystroglycan.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Structural protein
molecule keywords DYSTROPHIN
total genus 98
structure length 260
sequence length 260
ec nomenclature
pdb deposition date 2000-02-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00397 WW WW domain
A PF09068 EF-hand_2 EF hand
A PF09069 EF-hand_3 EF-hand
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 1eg3A03
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 1eg3A04
2.20.70.10 Mainly Beta Single Sheet Ubiquitin Ligase Nedd4; Chain: W; Ubiquitin Ligase Nedd4; Chain: W; 1eg3A01
2AMIA 5HKYA 2KXQA 2BA1A 2LMUA 1CB1A 2L5XB 2OS8C 2P6BB 2Y1NA 1MXEA 4GNKB 1AP4A 3VRPA 1YRTB 4CIDA 1MR8A 4PE0A 1SCVA 1U5IB 1F8AB 2LUCA 1FI5A 4MZLA 3KCEA 2M1UA 4PHJA 2XP9A 2LAJA 2EGDA 2Y4QA 3OB2B 2KQ6A 3KAHA 2YSGA 2KAXA 1OZSA 1TN4A 2MLFC 4BY4A 1XFXO 1IQ5A 1CDMA 3CLNA 2ZQSA 2ZNDA 2H2KA 3NXAA 2LV7A 2EZ5W 3BUNB 1NX2A 3IQOA 1A75B 1PK0D 3KABA 1SMGA 1YURA 1LXFC 5I2QA 2E6WA 1AK8A 2RE3A 2F2OA 2M49B 2PASA 3TZ1A 1CMGA 4REXA 1KWOC 1S5GY 2JT0A 1SRAA 2JTZA 4QJ3B 1YUTA 2M29A 5DKRA 3KAGA 4XJKB 2JC2A 2K7DA 2BKIB 5CQ2A 1YW5A 3D0YA 5B8IB 3KAIA 1B8LA 1S5GZ 1ZACA 2L2EA 3AAJA 3IF7A 2BE4A 2M8JA 4HSZA 3SJSA 3ZWHA 4TNCA 1YRUB 3AKAA 4YBHB 2G9BA 1BMOA 2OS8B 2Q91A 5PALA 3PM8A 1AUIB 1KK8B 2BBMA 1YVHA 5DKQA 2K7CA 1WMVA 2NZ0A 3CWGA 1NWDA 2BBNA 2I2RE 2L98A 4MZKA 3BYAA 2HQWA 1S26D 1QS7A 1NIWA 1OSAA 1LA0A 1QVIY 1QX5B 4DRWA 1JFJA 4OR9B 3PSRA 2ITKA 3LE4A 3TDZA 3OOBA 1PRWA 1JMQA 1AHRA 4CFQA 2XPBA 3KF9A 3TUYC 1FI6A 2SASA 2LLSA 4UPGA 4U85A 1NSHA 5TNCA 1TTXA 1PVAA 1TNWA 1OMDA 2L4HA 3WHTB 1CM4A 4MRYA 4ORBB 3CR5X 2L4JA 1KK7Y 1BR1B 1F55A 2LP2A 5CSIA 5HLVA 1RTP1 1J1DA 1S3PA 2XP4A 4JWQA 2F33A 1V1FA 4M2OA 1B8CA 2CCMA 2LNKA 3PN7C 4P5OE 3TDUA 1CFDA 3A4UB 1DF0A 2EC6C 1FW4A 4YGCB 1NCYA 3VRNA 1J55A 5K89A 3TC5A 3NSLA 1L2OC 1XFZO 2KI4B 3FIAA 4GGNA 4L9MA 1M63B 3O4YA 4JPZB 4CFRA 1SL9A 3CGAA 2BE6A 3EVRA 4BY5A 1GGWA 1SBJA 1IWQA 4ETOA 2Q4UA 1G8IA 2XP7A 4GPLB 1F8HA 1K9UA 1YUSA 3LLEA 2L50A 4PHKA 1O6WA 1QX2A 2SCPA 1IJ6A 2MDIA 1CM1A 2K2FA 2YSFA 3DF0B 3OX5A 3WNXB 3H4SE 1CDLA 1QV0A 2LVKA 1CFCA 1RWYA 1QATA 4ZCVA 1Y1UA 2K7OA 1JSAA 1GQMA 1J7PA 3NSIA 2CTNA 1CDPA 3EK4A 1PULA 1YUUA 2EHBA 2ZFDA 1SCMB 2LHLA 3EVUA 3KHEA 3HCMA 3LCPC 2MBXA 2BECA 4A4CA 2XPAA 2LMTA 4I5JA 1ODBA 1EXRA 1QTXA 2L51A 2LCPA 4N1FA 2KYCA 1VRKA 2M8UA 2MHHA 1NPQA 2NCOA 2GGMA 2O60A 2OPOA 4U8DA 4USLA 1SW8A 1KK8C 5BPJA 4A4BA 1UHIA 2JTTA 2F21A 1BF5A 3O2PA 1LVCD 1HQVA 3D0YB 4WQ3A 2XP5A 2KOTA 1NX3A 2JT3A 1MF8B 3RLZA 2MLEC 1PVBA 2V53A 3KAFA 2K7BA 2NCPA 1J7OA 1EH2A 5AERA 3F45A 2AUCA 4OCIA 1DJWA 1RFJA 2KBIA 4MBEA 5AHTA 3PLFB 1SL8A 4OV2A 1F4QA 3RM1A 3PFVA 4PDZA 1ZCNA 1CLLA 4YGAA 2CT9A 2JQ6A 2FCDA 2OTGB 2LAPA 2ZAJA 5HKZA 1MUXA 1NX1A 3CZTX 4E68A 1RJVA 2WC8A 5AFPA 4C0LA 1R6PA 1QLSA 4QIBA 1B9AA 1F54A 1XO5A 1C7VA 4MRXA 1FF1A 1BG1A 4QJ5B 3CNGA 4FQOA 3QRXA 5JOLA 1SR6C 2HETA 1DVIA 4ORAB 2ZR5A 4M2QA 2M3OW 1BT6A 2KGRA 1JWDA 3K21A 1K93D 3JVTC 2KHNA 2JWWA 2KI4C 5DKNA 4GBAA 1SL7A 2COLB 1S6JA 2JXLA 4DUQA 1K8UA 1EJ3A 1X02A 1FPWA 4WRIA 1UHJA 1DJGA 2B1UA 3NSOA 5CSNA 2YSBA 2WCBA 1A29A 2ZRSA 4NDBA 3I5GB 1KWOB 3SG4A 1IQ3A 1TCFA 5FYXA 4M2PA 1TCOB 1KSMA 2JPTA 4DCKA 4HREE 4MEWA 1K9PA 2MRDA 2M7LA 2BCBA 3KPXA 3O6BA 1KQMC 1WRZA 1SCMC 1Y6WA 4AQJA 2HQ8A 4PCWA 1KFXS 3EK8A 1XVJA 2AAOA 1SKTA 2KFGA 1S6IA 1WLZA 2ZRTA 4GAOA 2DK7A 1Y1AA 2EC6B 1WDCC 1QIWA 2CXJA 2WOSA 2KAYA 3I5FB 3LL8B 1TRFA 1XFVO 2FOTA 1L2OB 4OVNF 2NXQA 1BLQA 2ZN8A 3WXAA 1UURA 1IKUA 1B47A 1ZFSA 1IJ5A 4PE4A 1UP5A 1YX8A 1N0YA 5JJGA 2ZKMX 4HRGA 1A2XA 2KFFA 1NX0A 1CTRA 4C0JA 3M85A 3JTDC 5J3XA 2DJYA 2KSPA 1EG4A 2M0RA 5I2OA 1XYDA 4ICBA 1KFUL 1JUOA 1C07A 1ZUZA 2LP3A 4Q04A 1IGVA 2TN4A 1WRLA 1BR4B 1YVLA 1CDNA 2PALA 2NLNA 1E8AA 2K8MB 2QPTA 3OB1B 1SNLA 4U84A 2LHIA 2GGZA 2HF5A 4NDCA 1V1GA 1TIZA 2JXWA 2JULA 1QIVA 5D69A 2M9GA 4CLNA 2KQYA 1B1GA 1BOCA 2KBMA 2JOJA 1M46A 4PHMA 1I5HW 4NDDA 1QASA 2LM5A 3MSEB 2KAVA 1DMOA 3TDIA 2I7AA 3EK7A 2K0JA 3VROA 4MN0A 3BQ3A 3O78A 1PSBA 1M39A 3PALA 2LLTA 4AQIA 1BJFA 1DJZA 1KFUS 3C1VA 1WRKA 2Y5IA 1M31A 1IRJA 2BCXA 1HT9A 1UUSA 2DOQA 2JRFA 2JU0A 3EKJA 1QV1A 2O5GA 3WH0A 2OTGC 2F3YA 2Y1MA 3DD4A 3SIBA 1CNPA 4I5KA 1K95A 1MXLC 1DJIA 3BOWA 1XFWO 3GOFA 3TCZA 1S6CA 2KGBC 3TDBA 4YGBB 3CTNA 4GFTA 4CPVA 5G08A 2BL0C 4PHNA 2PRUA 2LLUA 1OZOA 4MLWA 2ZQTA 3BXKA 2XP6A 2YSHA 1DGUA 1WDCB 3I5FC 4GGFC 3DVEA 1CMFA 1XK4C 2KYFA 2LMVA 4JQ0D 1GJYA 2ZQUA 4IL1A 1BU3A 2M7NA 2K2AA 1K9RA 1FBVA 1S36A 1XFUO 2D8NA 2LVVA 3LK0A 2F2PA 1KQVA 3ODKA 1ZOTB 4FTGA 2M97A 2JMFA 3NSKA 2ISDA 2LC5A 1DJYA 1C7WA 4ZCUA 3I5GC 1NCXA 4OKHA 1OOJA 1ZMZA 1QX7A 2DWVA 1QLKA 3BUMB 1B4CA 2KFHA 3DF0A 3BUXB 2RGIA 4ORCB 2KDHA 4PALA 1N65A 1D1OA 2I94A 1JF2A 2XP3A 1W7IB 2FCEA 3EKHA 2XP8A 1G33A 2FJUB 3BOWB 4HRHA 1EG3A 2JT8A 1H8BA 1WY9A 1OMVA 4F0ZB 2CNPA 1XA5A 2JNXA 2LE9B 3SIAA 1LINA 4C0KA 2JNFA 2E45A 1TNPA 1SK6D 2BCAA 3GK2A 4R1EA 3EVVA 4MZJA 1DT7B 2M8IA 4N5XA 1RECA 1K9KA 1S1EA 2KNEA 4I5LB 1J7RA 2WORA 3TS5B 3AKBA 1WLMA 3OP0A 1AJ4A 3KADA 3FWBA 3SG6A 3CR2A 4YI9A 1NYAA 2VRGA 1SR6B 4YGDB 1K2HA 1MWNA 1KFXL 1UHNA 4PE1A 2I18A 3SG3A 4YRUA 3I5HB 4E5RA 4MVFA 1R2UA 3I5IB 2JV4A 3D10A 1QJTA 5CSJA 1SY9A 1F70A 3LK1A 1ALVA 1DGVA 3KO0A 1BODA 5ER4X 2IS9A 2M3WA 1JBAA 1OQPA 1YTZC 2L0PA 2LANA 1IG5A 5KTYA 3TUYB 5KU1A 5CSFA 2MAZA 4AOMA 1K94A 2BL0B 1Y1XA 2H61A 1MQ1A 1TNQA 4YI8A 3ZNIA 1KQMB 3CS1A 1CLBA 2ZR4A 1XK4A 4YGEB 2DK1A 2R2IA 2ZN9A 2GV5A 2MJWB 3JVTB 2A4JA 1AJ5A 1F4OA 3BUWB 4XYNA 2HPSA 3BUOB 2KI6D 1B7TY 3M7NA 3SG7A 3I5IC 1L7ZA 5I2LA 1RK9A 2PMYA 2QACA 1YX7A 4XJKA 2K61A 1JC2A 5CPVA 2E30A 1KCYA 1DJXA 5AANA 1G4YR 1UWOA 4MSPA 1CFFA 1RROA 3GK4X 2PSRA 4PE7A 2ZNEA 1WR7A 5F6TA 1UHKA 3SG5A 5I8NA 2DMVA 4D1EA 3DVMA 1MHOA 2MA2A 1B7TZ 1YR5A 3M0WA 1JFKA 5HKWA 1J7QA 4WQ2A 1OE9B 1PALA 1XFYO 1KK7Z 1IH0A 2F8PA 1EL4A 2WCFA 5AXIA 1PINA 3VRRA 2ZR6A 3VGOA 1OMRA 1K96A 1N2DA 1GGZA 1ALWA 3KEVA 3GK1A 1QXPA 4GUKA 1K90D 2WNDA 4U86A 1DF0B 4DS7A 4I5NB 1QVIZ 1PSRA 3ICBA 3IQQA 2YSIA 1A75A 1F71A 5KSZA 1NCZA 2PVBA 3PATA 1TNXA 3HX4A 1CFPA 3I5HC 1A4PA 1B8RA 5ER5A 2JZIA 1LKJA 3CR4X 2BKHB 3E3RA 3PN7B 5GQQC 3TS5C 1Q80A 1NMVA 3DVJA 3OX6A 4DIRA 5D7FA 3NTPA 1U5IA 1TOPA 1Y0VH 2JXCA 2L4IA 2M1KB 1J1EA 1A03A 2JX8A 3A8RA 1UHHA 5IBWA 1KSOA 1LA3A 2LVJA 3DVKA 1H4BA 2G2BA 1CLMA 4GGFA 5AEQA 2KI6C 1AVSA 3JTDB 1SYMA 1DTLA 3OHMB 3SG2A 5HYDA 3AAKA 3VRQA 1K9QA 1NP8A 1CKKA 3WHUB 4QJ4B 2F3ZA 4NQGA 2LUXA 2ZQVA 5HLOA 2CBLA 2LVIA 3FWCA 2WCEA 1NUBA 2Q5AA 1JF0A 1W7JB 1TK7A 4N1GA 1DJHA 4P2YB 3FS7A 1SPYA 1M45A 2H61C 3L4HA
chains in the Genus database with same CATH superfamily
2AMIA 5HKYA 2KXQA 2BA1A 3NHTA 2LMUA 1CB1A 2L5XB 2OS8C 2P6BB 2K60A 1MXEA 2Y1NA 4GNKB 1AP4A 3FS8A 3VRPA 1YRTB 2YGUA 3SS4A 4CIDA 1MR8A 4PE0A 1SCVA 1U5IB 1F8AB 2LUCA 1FI5A 4MZLA 3VB1A 3O4XA 3KCEA 2M1UA 4PHJA 2XP9A 2LAJA 2EGDA 2Y4QA 2Y8NB 3OB2B 2KQ6A 3KAHA 2YSGA 2KAXA 1OZSA 1TN4A 2MLFC 4BY4A 1XFXO 1TUJA 1IQ5A 1CDMA 3CLNA 2ZQSA 2ZNDA 2H2KA 3NXAA 2LV7A 2EZ5W 3BUNB 2PQLA 1NX2A 3IQOA 1A75B 1PK0D 3KABA 1SMGA 2KPHA 4INWA 2OWOA 1YURA 1LXFC 5I2QA 2E6WA 1AK8A 2RE3A 2F2OA 2M49B 2PASA 3TZ1A 1CMGA 4REXA 1KWOC 1S5GY 2JT0A 1SRAA 2JTZA 2WCMA 2KLDA 4QJ3B 1YUTA 2M29A 3DYEA 5DKRA 2YAJB 3KAGA 4XJKB 2JC2A 2K7DA 2BKIB 2L2CA 1YW5A 5CQ2A 3D0YA 3PM2A 5B8IB 1B8LA 3FE8A 3KAIA 1S5GZ 1ZACA 2L2EA 3AAJA 3IF7A 2BE4A 2M8JA 3D73A 4HSZA 3SJSA 3ZWHA 4TNCA 1YRUB 3AKAA 4YBHB 2G9BA 1BMOA 2OS8B 2Q91A 5PALA 3PM8A 3S0EA 1AUIB 1KK8B 2BBMA 3FSCA 1YVHA 5DKQA 2K7CA 1WMVA 2NZ0A 3CWGA 1NWDA 2BBNA 2I2RE 2L98A 4MZKA 5D3OA 3BYAA 2HQWA 1S26D 1QS7A 1NIWA 1OSAA 1LA0A 1QVIY 1QX5B 4DRWA 1JFJA 4OR9B 3PSRA 2ITKA 3LE4A 3TDZA 3OOBA 1PRWA 1JMQA 1AHRA 2WCHA 4CFQA 2XPBA 3KF9A 3TUYC 1FI6A 2SASA 2LLSA 3FSBA 3DXLA 4UPGA 4U85A 1NSHA 5TNCA 1TTXA 1PVAA 1TNWA 1OMDA 1OOFA 2L4HA 1CM4A 4MRYA 4ORBB 3CR5X 3WHTB 2L4JA 1KK7Y 3D74A 1BR1B 1F55A 2LP2A 5CSIA 5HLVA 1RTP1 1J1DA 1S3PA 2XP4A 4JWQA 1SSEB 2F33A 1V1FA 4M2OA 1B8CA 1W9ZA 2CCMA 2LNKA 3PN7C 4P5OE 3TDUA 1CFDA 3A4UB 1DF0A 2EC6C 3CZ1A 1FW4A 4YGCB 1T14A 3OGNA 1NCYA 3VRNA 1J55A 5K89A 2QRVA 2QEVA 3TC5A 3NSLA 1L2OC 1XFZO 2KI4B 3FIAA 4GGNA 4L9MA 4OZDA 1M63B 3O4YA 4JPZB 5DICA 1SL9A 3CGAA 2BE6A 3EVRA 3QMEA 4BY5A 4CFRA 1GGWA 1SBJA 2P71A 1IWQA 4ETOA 2Q4UA 1G8IA 2XP7A 2WC6A 4GPLB 1F8HA 1K9UA 1YUSA 3LLEA 2L50A 4PHKA 1O6WA 1QX2A 2SCPA 1IJ6A 2MDIA 1CM1A 2K2FA 2YSFA 1RP5A 3DF0B 3OX5A 3WNXB 3H4SE 1CDLA 3BFAA 1QV0A 2LVKA 1CFCA 2GTEA 1RWYA 1QATA 2P70A 4ZCVA 1Y1UA 2K7OA 1JSAA 1GQMA 1J7PA 3NSIA 2CTNA 1CDPA 1OOIX 3EK4A 1PULA 1YUUA 2EHBA 2ZFDA 1SCMB 2LHLA 3EVUA 3KHEA 3HCMA 3L4AA 3LCPC 3N7HA 2BECA 2MBXA 3S0DA 4A4CA 2XPAA 3OBVA 2LMTA 4I5JA 1ODBA 1EXRA 1QTXA 2L51A 2LCPA 4N1FA 2KYCA 1VRKA 2M8UA 2MHHA 1NPQA 2NCOA 2GGMA 2O60A 3PJIA 2OPOA 4U8DA 4USLA 1SW8A 1KK8C 5BPJA 4A4BA 1UHIA 2JTTA 2F21A 1BF5A 1DEKA 3O2PA 1LVCD 1HQVA 3D0YB 4WQ3A 2XP5A 2KOTA 1NX3A 2JT3A 1MF8B 3RLZA 2MLEC 1PVBA 2V53A 3KAFA 2K7BA 2NCPA 3CDNA 1J7OA 1EH2A 5AERA 3F45A 2AUCA 4OCIA 1DJWA 1RFJA 2KBIA 4MBEA 3LKXB 5AHTA 3PLFB 1SL8A 4OV2A 1F4QA 3RM1A 1C3YA 3PFVA 4PDZA 1ZCNA 1CLLA 4YGAA 2CT9A 2JQ6A 3BFHA 3D75A 2FCDA 2OTGB 2LAPA 2ZAJA 5HKZA 4A0TA 1MUXA 1NX1A 3CZTX 4E68A 1RJVA 3DZTA 2WC8A 5AFPA 4C0LA 2BNXA 1R6PA 2WCKA 1QLSA 3MCBB 4QIBA 1B9AA 3V2LA 1XO5A 1F54A 1C7VA 4MRXA 1FF1A 1BG1A 3B86A 4QJ5B 3CNGA 3EG5B 4FQOA 3QRXA 5JOLA 3R72A 1SR6C 3L47A 2HETA 1DVIA 4ORAB 2ZR5A 4M2QA 2M3OW 2QEBA 1BT6A 2KGRA 3R1PA 1JWDA 3K21A 1K93D 3JVTC 2KHNA 1TWOA 2JWWA 2KI4C 5DKNA 4GBAA 1SL7A 2L5YA 2COLB 1S6JA 2JXLA 4DUQA 1K8UA 5E62A 1EJ3A 1X02A 1FPWA 4FQTA 4WRIA 1UHJA 1DJGA 2B1UA 3NSOA 5CSNA 2YSBA 2WCBA 1A29A 2ZRSA 5FI2A 4NDBA 3I5GB 1KWOB 3SG4A 1IQ3A 1TCFA 3D77A 4M2PA 5FYXA 1TCOB 1KSMA 2JPTA 4DCKA 4HREE 4MEWA 1K9PA 2MRDA 2M7LA 2BCBA 3KPXA 3O6BA 1KQMC 1C3ZA 1SCMC 1WRZA 1Y6WA 4AQJA 2QEHA 2HQ8A 1DQEA 4PCWA 1TR8A 1KFXS 3EK8A 5I94A 1XVJA 2AAOA 1SKTA 2KFGA 1S6IA 1WLZA 2QEOA 2ZRTA 4GAOA 1Y1AA 1XFRA 2EC6B 1WDCC 1QIWA 2CXJA 2WOSA 2KAYA 3I5FB 3LL8B 1TRFA 1XFVO 3SS5A 2FOTA 1L2OB 1DC1A 4OVNF 2NXQA 1BLQA 2ZN8A 3WXAA 1UURA 1IKUA 1B47A 1ZFSA 1IJ5A 4PE4A 1UP5A 1YX8A 1N0YA 3CZ0A 2ZKMX 5JJGA 3D76A 4HRGA 1A2XA 2KFFA 1NX0A 1CTRA 4C0JA 3PQHA 3MQHA 3M85A 3JTDC 3CYZA 5J3XA 2DJYA 2KSPA 3BFBA 1EG4A 2M0RA 5I2OA 1XYDA 4ICBA 1KFUL 1JUOA 2FJYA 5FI6A 1C07A 1ZUZA 2LP3A 4Q04A 5EL2A 1IGVA 2TN4A 1LS8A 3L4LA 1WRLA 1BR4B 1YVLA 3CZ2A 1CDNA 2PALA 2NLNA 1E8AA 2K8MB 2QPTA 3OB1B 1SNLA 4U84A 2LHIA 2GGZA 2HF5A 4NDCA 3Q8IA 4INXA 1V1GA 1TIZA 2JXWA 2JULA 1QIVA 5D69A 2M9GA 3B6XA 2KQYA 4CLNA 1B1GA 1BOCA 2KBMA 2JOJA 1M46A 4PHMA 1I5HW 4NDDA 1QASA 1ORGA 2LM5A 3B87A 3MSEB 2KAVA 1DMOA 3MQGA 3TDIA 2I7AA 3D78A 3EK7A 2K0JA 3VROA 4MN0A 3BQ3A 3O78A 1PSBA 1M39A 3PALA 2LLTA 4AQIA 1BJFA 1DJZA 1GM0A 1KFUS 3MCBA 3C1VA 1WRKA 2Y5IA 1M31A 1IRJA 2BCXA 1HT9A 1UUSA 2BAPA 2DOQA 2JRFA 2JU0A 3EKJA 1QV1A 2O5GA 1QWVA 4IJ7A 3WH0A 2OTGC 2F3YA 2Y1MA 3DD4A 3SIBA 1CNPA 4I5KA 1K95A 1MXLC 1P28A 1DJIA 3BOWA 2DK7A 1XFWO 3GOFA 3TCZA 1S6CA 2KGBC 3TDBA 4YGBB 3CTNA 4GFTA 4CPVA 5G08A 2BL0C 4PHNA 2PRUA 2LLUA 1OZOA 4MLWA 2ZQTA 3BXKA 2XP6A 2YSHA 1DGUA 1WDCB 3I5FC 4GGFC 3DVEA 3RZSA 1CMFA 1XK4C 2KYFA 2LMVA 4JQ0D 1Z2CB 1GJYA 2ZQUA 4IL1A 1BU3A 2M7NA 2K2AA 3LKXA 1K9RA 1FBVA 1S36A 1XFUO 2D8NA 2LVVA 1FLCA 3LK0A 2F2PA 1KQVA 3ODKA 1ZOTB 4FTGA 2M97A 2JMFA 1OOGA 3NSKA 2LC5A 1DJYA 1C7WA 4ZCUA 2ISDA 4GLXA 3I5GC 1NCXA 4OKHA 1OOJA 1ZMZA 1QX7A 1OOHA 2KLEA 2DWVA 1QLKA 3BUMB 1B4CA 2KFHA 3DF0A 3BUXB 2RGIA 4ORCB 2KDHA 4PALA 1DELA 1N65A 2I94A 1JF2A 4PT1A 1W7IB 1D1OA 2FCEA 2XP3A 3EKHA 5U47A 2XP8A 3R1OA 1G33A 2FJUB 3BOWB 3NHIA 1EG3A 2JT8A 4HRHA 1H8BA 1WY9A 1OMVA 4F0ZB 2CNPA 1XA5A 3R1VA 2JNXA 2LE9B 3SIAA 1LINA 4C0KA 2JNFA 2E45A 3S0BA 1TNPA 1SK6D 2BCAA 3GK2A 4R1EA 3EVVA 4MZJA 1DT7B 2M8IA 4N5XA 1RECA 3CABA 1K9KA 1S1EA 2KNEA 3IVTA 4I5LB 2WADA 1J7RA 2WORA 5E65A 3TS5B 3AKBA 1WLMA 3OP0A 1AJ4A 3KADA 3FWBA 3SG6A 3CR2A 4YI9A 1NYAA 2VRGA 1SR6B 4YGDB 1K2HA 1MWNA 1KFXL 1UHNA 4PE1A 2I18A 3SG3A 4YRUA 3I5HB 4E5RA 4MVFA 1R2UA 3I5IB 5E5WA 5E64A 2JV4A 3D10A 1QJTA 5CSJA 1SY9A 1F70A 2ERBA 3LK1A 1ALVA 1DGVA 3KO0A 1BODA 5ER4X 2IS9A 2M3WA 1JBAA 1OQPA 1YTZC 2L0PA 2LANA 1IG5A 2WCJA 3B7AA 3FE9A 5KTYA 3TUYB 5KU1A 5CSFA 2MAZA 4AOMA 1K94A 2BL0B 1Y1XA 2H61A 1MQ1A 1TNQA 4YI8A 3ZNIA 1KQMB 3CS1A 1CLBA 1Z4HA 2ZR4A 1XK4A 4YGEB 3K1EA 2DK1A 2R2IA 3B88A 2ZN9A 2GV5A 2MJWB 3JVTB 3S0AA 1IIOA 2A4JA 1AJ5A 1F4OA 3BUWB 4XYNA 2HPSA 3BUOB 2KI6D 4F7FA 1B7TY 4A0UA 2PYQA 3SG7A 3M7NA 3I5IC 1L7ZA 5I2LA 1RK9A 2PMYA 2QACA 1YX7A 4XJKA 2K61A 1JC2A 5CPVA 2E30A 1KCYA 1DJXA 5AANA 1G4YR 1UWOA 4MSPA 1CFFA 1RROA 3GK4X 2PSRA 4PE7A 2ZNEA 1WR7A 5F6TA 1UHKA 3SG5A 4KYNA 5I8NA 4D1EA 3DVMA 2DMVA 1MHOA 2MA2A 1B7TZ 1YR5A 3M0WA 1JFKA 4JD9A 5HKWA 2WC5A 3NGVA 1J7QA 4WQ2A 1OE9B 1PALA 1XFYO 3DY9A 1OW4A 1KK7Z 1IH0A 2F8PA 1EL4A 2WCFA 5FI7A 5AXIA 2WCLA 1PINA 2JPOA 3VRRA 3VGOA 2ZR6A 1OMRA 1K96A 1N2DA 1GGZA 1ALWA 3KEVA 3UNWA 3GK1A 1QXPA 4GUKA 1K90D 2WNDA 4U86A 1DF0B 3UO9A 4DS7A 3S0GA 4I5NB 1QVIZ 1PSRA 3ICBA 3IQQA 2YSIA 1A75A 1F71A 5KSZA 1NCZA 2PVBA 3PATA 1TNXA 3HX4A 1CFPA 3I5HC 3SS3A 1A4PA 1B8RA 2QDIA 5ER5A 2JZIA 1LKJA 3CR4X 2BKHB 3E3RA 3PN7B 4JKTA 5GQQC 1TUZA 3TS5C 1Q80A 1NMVA 3DVJA 3OX6A 4DIRA 5D7FA 3NTPA 1U5IA 1TOPA 1Y0VH 2JXCA 2L4IA 2M1KB 1J1EA 1A03A 2JX8A 2WAEA 3A8RA 1UHHA 5IBWA 1KSOA 1LA3A 2LVJA 3DVKA 1H4BA 2G2BA 1CLMA 4GGFA 5AEQA 2KI6C 1AVSA 3JTDB 1SYMA 1DTLA 3OHMB 3SG2A 5HYDA 3AAKA 5HL1A 5E66A 3VRQA 1K9QA 1NP8A 3BJHA 1CKKA 3S0FA 2H8VA 3WHUB 3FE6A 4QJ4B 2F3ZA 4NQGA 2LUXA 2ZQVA 5HLOA 2CBLA 2LVIA 3FWCA 2WCEA 1NUBA 2Q5AA 1JF0A 1W7JB 1TK7A 4N1GA 1DJHA 4P2YB 3FS7A 1SPYA 1M45A 2H61C 3L4HA
chains in the Genus database with same CATH topology
2AMIA 5HKYA 2KXQA 2BA1A 2LMUA 1CB1A 2L5XB 2OS8C 2P6BB 2Y1NA 1MXEA 4GNKB 1AP4A 3FS8A 3VRPA 1YRTB 4CIDA 1MR8A 4PE0A 1SCVA 1U5IB 1F8AB 2LUCA 1FI5A 4MZLA 3KCEA 2M1UA 4PHJA 2XP9A 2LAJA 2EGDA 2Y4QA 2Y8NB 3OB2B 2KQ6A 3KAHA 2YSGA 2KAXA 1OZSA 1TN4A 2MLFC 4BY4A 1XFXO 1IQ5A 1CDMA 3CLNA 2ZQSA 2ZNDA 2H2KA 3NXAA 2LV7A 2EZ5W 3BUNB 1NX2A 3IQOA 1A75B 1PK0D 3KABA 1SMGA 2OWOA 1YURA 1LXFC 5I2QA 2E6WA 1AK8A 2RE3A 2F2OA 2M49B 2PASA 3TZ1A 1CMGA 4REXA 1KWOC 1S5GY 2JT0A 1SRAA 2JTZA 4QJ3B 1YUTA 2M29A 5DKRA 2YAJB 3KAGA 4XJKB 2JC2A 2K7DA 2BKIB 5CQ2A 1YW5A 3D0YA 5B8IB 3KAIA 1B8LA 1S5GZ 1ZACA 2L2EA 3AAJA 3IF7A 2BE4A 2M8JA 4HSZA 3SJSA 3ZWHA 4TNCA 1YRUB 3AKAA 4YBHB 2G9BA 1BMOA 2OS8B 2Q91A 5PALA 3PM8A 1AUIB 1KK8B 2BBMA 3FSCA 1YVHA 5DKQA 2K7CA 1WMVA 2NZ0A 3CWGA 1NWDA 2BBNA 2I2RE 2L98A 4MZKA 3BYAA 2HQWA 1S26D 1QS7A 1NIWA 1OSAA 1LA0A 1QVIY 1QX5B 4DRWA 1JFJA 4OR9B 3PSRA 2ITKA 3LE4A 3TDZA 3OOBA 1PRWA 1JMQA 1AHRA 4CFQA 2XPBA 3KF9A 3TUYC 1FI6A 2SASA 2LLSA 3FSBA 4UPGA 4U85A 1NSHA 5TNCA 1TTXA 1PVAA 1TNWA 1OMDA 2L4HA 3WHTB 1CM4A 4MRYA 4ORBB 3CR5X 2L4JA 1KK7Y 1BR1B 1F55A 2LP2A 5CSIA 5HLVA 1RTP1 1J1DA 1S3PA 2XP4A 4JWQA 2F33A 1V1FA 4M2OA 1B8CA 2CCMA 2LNKA 3PN7C 4P5OE 3TDUA 1CFDA 3A4UB 1DF0A 2EC6C 1FW4A 4YGCB 1NCYA 3VRNA 1J55A 5K89A 2QRVA 3TC5A 3NSLA 1L2OC 1XFZO 2KI4B 3FIAA 4GGNA 4L9MA 1M63B 3O4YA 4JPZB 4CFRA 1SL9A 3CGAA 2BE6A 3EVRA 4BY5A 1GGWA 1SBJA 1IWQA 4ETOA 2Q4UA 1G8IA 2XP7A 4GPLB 1F8HA 1K9UA 1YUSA 3LLEA 2L50A 4PHKA 1O6WA 1QX2A 2SCPA 1IJ6A 2MDIA 1CM1A 2K2FA 2YSFA 1RP5A 3DF0B 3OX5A 3WNXB 3H4SE 1CDLA 1QV0A 2LVKA 1CFCA 1RWYA 1QATA 4ZCVA 1Y1UA 2K7OA 1JSAA 1GQMA 1J7PA 3NSIA 2CTNA 1CDPA 3EK4A 1PULA 1YUUA 2EHBA 2ZFDA 1SCMB 2LHLA 3EVUA 3KHEA 3HCMA 3LCPC 2MBXA 2BECA 4A4CA 2XPAA 2LMTA 4I5JA 1ODBA 1EXRA 1QTXA 2L51A 2LCPA 4N1FA 2KYCA 1VRKA 2M8UA 2MHHA 1NPQA 2NCOA 2GGMA 2O60A 2OPOA 4U8DA 4USLA 1SW8A 1KK8C 5BPJA 4A4BA 1UHIA 2JTTA 2F21A 1BF5A 3O2PA 1LVCD 1HQVA 3D0YB 4WQ3A 2XP5A 2KOTA 1NX3A 2JT3A 1MF8B 3RLZA 2MLEC 1PVBA 2V53A 3KAFA 2K7BA 2NCPA 1J7OA 1EH2A 5AERA 3F45A 2AUCA 4OCIA 1DJWA 1RFJA 2KBIA 4MBEA 3LKXB 5AHTA 3PLFB 1SL8A 4OV2A 1F4QA 3RM1A 3PFVA 4PDZA 1ZCNA 1CLLA 4YGAA 2CT9A 2JQ6A 2FCDA 2OTGB 2LAPA 2ZAJA 5HKZA 4A0TA 1MUXA 1NX1A 3CZTX 4E68A 1RJVA 2WC8A 5AFPA 4C0LA 1R6PA 1QLSA 3MCBB 4QIBA 1B9AA 1F54A 1XO5A 1C7VA 4MRXA 1FF1A 1BG1A 4QJ5B 3CNGA 4FQOA 3QRXA 5JOLA 1SR6C 2HETA 1DVIA 4ORAB 2ZR5A 4M2QA 2M3OW 1BT6A 2KGRA 1JWDA 3K21A 1K93D 3JVTC 2KHNA 2JWWA 2KI4C 5DKNA 4GBAA 1SL7A 2COLB 1S6JA 2JXLA 4DUQA 1K8UA 5E62A 1EJ3A 1X02A 1FPWA 4WRIA 1UHJA 1DJGA 2B1UA 3NSOA 5CSNA 2YSBA 2WCBA 1A29A 2ZRSA 4NDBA 3I5GB 1KWOB 3SG4A 1IQ3A 1TCFA 5FYXA 4M2PA 1TCOB 1KSMA 2JPTA 4DCKA 4HREE 4MEWA 1K9PA 2MRDA 2M7LA 2BCBA 3KPXA 3O6BA 1KQMC 1WRZA 1SCMC 1Y6WA 4AQJA 2HQ8A 4PCWA 1TR8A 1KFXS 3EK8A 1XVJA 2AAOA 1SKTA 2KFGA 1S6IA 1WLZA 2ZRTA 4GAOA 2DK7A 1Y1AA 2EC6B 1WDCC 1QIWA 2CXJA 2WOSA 2KAYA 3I5FB 3LL8B 1TRFA 1XFVO 2FOTA 1L2OB 4OVNF 2NXQA 1BLQA 2ZN8A 3WXAA 1UURA 1IKUA 1B47A 1ZFSA 1IJ5A 4PE4A 1UP5A 1YX8A 1N0YA 5JJGA 2ZKMX 4HRGA 1A2XA 2KFFA 1NX0A 1CTRA 4C0JA 3PQHA 3MQHA 3M85A 3JTDC 5J3XA 2DJYA 2KSPA 1EG4A 2M0RA 5I2OA 1XYDA 4ICBA 1KFUL 1JUOA 1C07A 1ZUZA 2LP3A 4Q04A 1IGVA 2TN4A 1WRLA 1BR4B 1YVLA 1CDNA 2PALA 2NLNA 1E8AA 2K8MB 2QPTA 3OB1B 1SNLA 4U84A 2LHIA 2GGZA 2HF5A 4NDCA 1V1GA 1TIZA 2JXWA 2JULA 1QIVA 5D69A 2M9GA 4CLNA 2KQYA 1B1GA 1BOCA 2KBMA 2JOJA 1M46A 4PHMA 1I5HW 4NDDA 1QASA 2LM5A 3MSEB 2KAVA 1DMOA 3MQGA 3TDIA 2I7AA 3EK7A 2K0JA 3VROA 4MN0A 3BQ3A 3O78A 1PSBA 1M39A 3PALA 2LLTA 4AQIA 1BJFA 1DJZA 1KFUS 3MCBA 3C1VA 1WRKA 2Y5IA 1M31A 1IRJA 2BCXA 1HT9A 1UUSA 2DOQA 2JRFA 2JU0A 3EKJA 1QV1A 2O5GA 3WH0A 2OTGC 2F3YA 2Y1MA 3DD4A 3SIBA 1CNPA 4I5KA 1K95A 1MXLC 1DJIA 3BOWA 1XFWO 3GOFA 3TCZA 1S6CA 2KGBC 3TDBA 4YGBB 3CTNA 4GFTA 4CPVA 5G08A 2BL0C 4PHNA 2PRUA 2LLUA 1OZOA 4MLWA 2ZQTA 3BXKA 2XP6A 2YSHA 1DGUA 1WDCB 3I5FC 4GGFC 3DVEA 1CMFA 1XK4C 2KYFA 2LMVA 4JQ0D 1GJYA 2ZQUA 4IL1A 1BU3A 2M7NA 2K2AA 3LKXA 1K9RA 1FBVA 1S36A 1XFUO 2D8NA 2LVVA 1FLCA 3LK0A 2F2PA 1KQVA 3ODKA 1ZOTB 4FTGA 2M97A 2JMFA 3NSKA 2ISDA 2LC5A 1DJYA 1C7WA 4ZCUA 4GLXA 3I5GC 1NCXA 4OKHA 1OOJA 1ZMZA 1QX7A 2DWVA 1QLKA 3BUMB 1B4CA 2KFHA 3DF0A 3BUXB 2RGIA 4ORCB 2KDHA 4PALA 1N65A 1D1OA 2I94A 1JF2A 2XP3A 1W7IB 2FCEA 3EKHA 5U47A 2XP8A 1G33A 2FJUB 3BOWB 4HRHA 1EG3A 2JT8A 1H8BA 1WY9A 1OMVA 4F0ZB 2CNPA 1XA5A 2JNXA 2LE9B 3SIAA 1LINA 4C0KA 2JNFA 2E45A 1TNPA 1SK6D 2BCAA 3GK2A 4R1EA 3EVVA 4MZJA 1DT7B 2M8IA 4N5XA 1RECA 1K9KA 1S1EA 2KNEA 4I5LB 2WADA 1J7RA 2WORA 5E65A 3TS5B 3AKBA 1WLMA 3OP0A 1AJ4A 3KADA 3FWBA 3SG6A 3CR2A 4YI9A 1NYAA 2VRGA 1SR6B 4YGDB 1K2HA 1MWNA 1KFXL 1UHNA 4PE1A 2I18A 3SG3A 4YRUA 3I5HB 4E5RA 4MVFA 1R2UA 3I5IB 5E5WA 5E64A 2JV4A 3D10A 1QJTA 5CSJA 1SY9A 1F70A 3LK1A 1ALVA 1DGVA 3KO0A 1BODA 5ER4X 2IS9A 2M3WA 1JBAA 1OQPA 1YTZC 2L0PA 2LANA 1IG5A 5KTYA 3TUYB 5KU1A 5CSFA 2MAZA 4AOMA 1K94A 2BL0B 1Y1XA 2H61A 1MQ1A 1TNQA 4YI8A 3ZNIA 1KQMB 3CS1A 1CLBA 2ZR4A 1XK4A 4YGEB 2DK1A 2R2IA 2ZN9A 2GV5A 2MJWB 3JVTB 2A4JA 1AJ5A 1F4OA 3BUWB 4XYNA 2HPSA 3BUOB 2KI6D 1B7TY 4A0UA 3M7NA 3SG7A 3I5IC 1L7ZA 5I2LA 1RK9A 2PMYA 2QACA 1YX7A 4XJKA 2K61A 1JC2A 5CPVA 2E30A 1KCYA 1DJXA 5AANA 1G4YR 1UWOA 4MSPA 1CFFA 1RROA 3GK4X 2PSRA 4PE7A 2ZNEA 1WR7A 5F6TA 1UHKA 3SG5A 5I8NA 2DMVA 4D1EA 3DVMA 1MHOA 2MA2A 1B7TZ 1YR5A 3M0WA 1JFKA 5HKWA 1J7QA 4WQ2A 1OE9B 1PALA 1XFYO 1KK7Z 1IH0A 2F8PA 1EL4A 2WCFA 5AXIA 1PINA 3VRRA 2ZR6A 3VGOA 1OMRA 1K96A 1N2DA 1GGZA 1ALWA 3KEVA 3GK1A 1QXPA 4GUKA 1K90D 2WNDA 4U86A 1DF0B 4DS7A 4I5NB 1QVIZ 1PSRA 3ICBA 3IQQA 2YSIA 1A75A 1F71A 5KSZA 1NCZA 2PVBA 3PATA 1TNXA 3HX4A 1CFPA 3I5HC 1A4PA 1B8RA 5ER5A 2JZIA 1LKJA 3CR4X 2BKHB 3E3RA 3PN7B 5GQQC 3TS5C 1Q80A 1NMVA 3DVJA 3OX6A 4DIRA 5D7FA 3NTPA 1U5IA 1TOPA 1Y0VH 2JXCA 2L4IA 2M1KB 1J1EA 1A03A 2JX8A 2WAEA 3A8RA 1UHHA 5IBWA 1KSOA 1LA3A 2LVJA 3DVKA 1H4BA 2G2BA 1CLMA 4GGFA 5AEQA 2KI6C 1AVSA 3JTDB 1SYMA 1DTLA 3OHMB 3SG2A 5HYDA 3AAKA 5E66A 3VRQA 1K9QA 1NP8A 1CKKA 3WHUB 4QJ4B 2F3ZA 4NQGA 2LUXA 2ZQVA 5HLOA 2CBLA 2LVIA 3FWCA 2WCEA 1NUBA 2Q5AA 1JF0A 1W7JB 1TK7A 4N1GA 1DJHA 4P2YB 3FS7A 1SPYA 1M45A 2H61C 3L4HA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2AMI A;  5HKY A;  2KXQ A;  2BA1 A;  2LMU A;  1CB1 A;  2L5X B;  2OS8 C;  2P6B B;  2Y1N A;  1MXE A;  4GNK B;  1AP4 A;  3VRP A;  1YRT B;  4CID A;  1MR8 A;  4PE0 A;  1SCV A;  1U5I B;  1F8A B;  2LUC A;  1FI5 A;  4MZL A;  3KCE A;  2M1U A;  4PHJ A;  2XP9 A;  2LAJ A;  2EGD A;  2Y4Q A;  3OB2 B;  2KQ6 A;  3KAH A;  2YSG A;  2KAX A;  1OZS A;  1TN4 A;  2MLF C;  4BY4 A;  1XFX O;  1IQ5 A;  1CDM A;  3CLN A;  2ZQS A;  2ZND A;  2H2K A;  3NXA A;  2LV7 A;  2EZ5 W;  3BUN B;  1NX2 A;  3IQO A;  1A75 B;  1PK0 D;  3KAB A;  1SMG A;  1YUR A;  1LXF C;  5I2Q A;  2E6W A;  1AK8 A;  2RE3 A;  2F2O A;  2M49 B;  2PAS A;  3TZ1 A;  1CMG A;  4REX A;  1KWO C;  1S5G Y;  2JT0 A;  1SRA A;  2JTZ A;  4QJ3 B;  1YUT A;  2M29 A;  5DKR A;  3KAG A;  4XJK B;  2JC2 A;  2K7D A;  2BKI B;  5CQ2 A;  1YW5 A;  3D0Y A;  5B8I B;  3KAI A;  1B8L A;  1S5G Z;  1ZAC A;  2L2E A;  3AAJ A;  3IF7 A;  2BE4 A;  2M8J A;  4HSZ A;  3SJS A;  3ZWH A;  4TNC A;  1YRU B;  3AKA A;  4YBH B;  2G9B A;  1BMO A;  2OS8 B;  2Q91 A;  5PAL A;  3PM8 A;  1AUI B;  1KK8 B;  2BBM A;  1YVH A;  5DKQ A;  2K7C A;  1WMV A;  2NZ0 A;  3CWG A;  1NWD A;  2BBN A;  2I2R E;  2L98 A;  4MZK A;  3BYA A;  2HQW A;  1S26 D;  1QS7 A;  1NIW A;  1OSA A;  1LA0 A;  1QVI Y;  1QX5 B;  4DRW A;  1JFJ A;  4OR9 B;  3PSR A;  2ITK A;  3LE4 A;  3TDZ A;  3OOB A;  1PRW A;  1JMQ A;  1AHR A;  4CFQ A;  2XPB A;  3KF9 A;  3TUY C;  1FI6 A;  2SAS A;  2LLS A;  4UPG A;  4U85 A;  1NSH A;  5TNC A;  1TTX A;  1PVA A;  1TNW A;  1OMD A;  2L4H A;  3WHT B;  1CM4 A;  4MRY A;  4ORB B;  3CR5 X;  2L4J A;  1KK7 Y;  1BR1 B;  1F55 A;  2LP2 A;  5CSI A;  5HLV A;  1RTP 1;  1J1D A;  1S3P A;  2XP4 A;  4JWQ A;  2F33 A;  1V1F A;  4M2O A;  1B8C A;  2CCM A;  2LNK A;  3PN7 C;  4P5O E;  3TDU A;  1CFD A;  3A4U B;  1DF0 A;  2EC6 C;  1FW4 A;  4YGC B;  1NCY A;  3VRN A;  1J55 A;  5K89 A;  3TC5 A;  3NSL A;  1L2O C;  1XFZ O;  2KI4 B;  3FIA A;  4GGN A;  4L9M A;  1M63 B;  3O4Y A;  4JPZ B;  4CFR A;  1SL9 A;  3CGA A;  2BE6 A;  3EVR A;  4BY5 A;  1GGW A;  1SBJ A;  1IWQ A;  4ETO A;  2Q4U A;  1G8I A;  2XP7 A;  4GPL B;  1F8H A;  1K9U A;  1YUS A;  3LLE A;  2L50 A;  4PHK A;  1O6W A;  1QX2 A;  2SCP A;  1IJ6 A;  2MDI A;  1CM1 A;  2K2F A;  2YSF A;  3DF0 B;  3OX5 A;  3WNX B;  3H4S E;  1CDL A;  1QV0 A;  2LVK A;  1CFC A;  1RWY A;  1QAT A;  4ZCV A;  1Y1U A;  2K7O A;  1JSA A;  1GQM A;  1J7P A;  3NSI A;  2CTN A;  1CDP A;  3EK4 A;  1PUL A;  1YUU A;  2EHB A;  2ZFD A;  1SCM B;  2LHL A;  3EVU A;  3KHE A;  3HCM A;  3LCP C;  2MBX A;  2BEC A;  4A4C A;  2XPA A;  2LMT A;  4I5J A;  1ODB A;  1EXR A;  1QTX A;  2L51 A;  2LCP A;  4N1F A;  2KYC A;  1VRK A;  2M8U A;  2MHH A;  1NPQ A;  2NCO A;  2GGM A;  2O60 A;  2OPO A;  4U8D A;  4USL A;  1SW8 A;  1KK8 C;  5BPJ A;  4A4B A;  1UHI A;  2JTT A;  2F21 A;  1BF5 A;  3O2P A;  1LVC D;  1HQV A;  3D0Y B;  4WQ3 A;  2XP5 A;  2KOT A;  1NX3 A;  2JT3 A;  1MF8 B;  3RLZ A;  2MLE C;  1PVB A;  2V53 A;  3KAF A;  2K7B A;  2NCP A;  1J7O A;  1EH2 A;  5AER A;  3F45 A;  2AUC A;  4OCI A;  1DJW A;  1RFJ A;  2KBI A;  4MBE A;  5AHT A;  3PLF B;  1SL8 A;  4OV2 A;  1F4Q A;  3RM1 A;  3PFV A;  4PDZ A;  1ZCN A;  1CLL A;  4YGA A;  2CT9 A;  2JQ6 A;  2FCD A;  2OTG B;  2LAP A;  2ZAJ A;  5HKZ A;  1MUX A;  1NX1 A;  3CZT X;  4E68 A;  1RJV A;  2WC8 A;  5AFP A;  4C0L A;  1R6P A;  1QLS A;  4QIB A;  1B9A A;  1F54 A;  1XO5 A;  1C7V A;  4MRX A;  1FF1 A;  1BG1 A;  4QJ5 B;  3CNG A;  4FQO A;  3QRX A;  5JOL A;  1SR6 C;  2HET A;  1DVI A;  4ORA B;  2ZR5 A;  4M2Q A;  2M3O W;  1BT6 A;  2KGR A;  1JWD A;  3K21 A;  1K93 D;  3JVT C;  2KHN A;  2JWW A;  2KI4 C;  5DKN A;  4GBA A;  1SL7 A;  2COL B;  1S6J A;  2JXL A;  4DUQ A;  1K8U A;  1EJ3 A;  1X02 A;  1FPW A;  4WRI A;  1UHJ A;  1DJG A;  2B1U A;  3NSO A;  5CSN A;  2YSB A;  2WCB A;  1A29 A;  2ZRS A;  4NDB A;  3I5G B;  1KWO B;  3SG4 A;  1IQ3 A;  1TCF A;  5FYX A;  4M2P A;  1TCO B;  1KSM A;  2JPT A;  4DCK A;  4HRE E;  4MEW A;  1K9P A;  2MRD A;  2M7L A;  2BCB A;  3KPX A;  3O6B A;  1KQM C;  1WRZ A;  1SCM C;  1Y6W A;  4AQJ A;  2HQ8 A;  4PCW A;  1KFX S;  3EK8 A;  1XVJ A;  2AAO A;  1SKT A;  2KFG A;  1S6I A;  1WLZ A;  2ZRT A;  4GAO A;  2DK7 A;  1Y1A A;  2EC6 B;  1WDC C;  1QIW A;  2CXJ A;  2WOS A;  2KAY A;  3I5F B;  3LL8 B;  1TRF A;  1XFV O;  2FOT A;  1L2O B;  4OVN F;  2NXQ A;  1BLQ A;  2ZN8 A;  3WXA A;  1UUR A;  1IKU A;  1B47 A;  1ZFS A;  1IJ5 A;  4PE4 A;  1UP5 A;  1YX8 A;  1N0Y A;  5JJG A;  2ZKM X;  4HRG A;  1A2X A;  2KFF A;  1NX0 A;  1CTR A;  4C0J A;  3M85 A;  3JTD C;  5J3X A;  2DJY A;  2KSP A;  1EG4 A;  2M0R A;  5I2O A;  1XYD A;  4ICB A;  1KFU L;  1JUO A;  1C07 A;  1ZUZ A;  2LP3 A;  4Q04 A;  1IGV A;  2TN4 A;  1WRL A;  1BR4 B;  1YVL A;  1CDN A;  2PAL A;  2NLN A;  1E8A A;  2K8M B;  2QPT A;  3OB1 B;  1SNL A;  4U84 A;  2LHI A;  2GGZ A;  2HF5 A;  4NDC A;  1V1G A;  1TIZ A;  2JXW A;  2JUL A;  1QIV A;  5D69 A;  2M9G A;  4CLN A;  2KQY A;  1B1G A;  1BOC A;  2KBM A;  2JOJ A;  1M46 A;  4PHM A;  1I5H W;  4NDD A;  1QAS A;  2LM5 A;  3MSE B;  2KAV A;  1DMO A;  3TDI A;  2I7A A;  3EK7 A;  2K0J A;  3VRO A;  4MN0 A;  3BQ3 A;  3O78 A;  1PSB A;  1M39 A;  3PAL A;  2LLT A;  4AQI A;  1BJF A;  1DJZ A;  1KFU S;  3C1V A;  1WRK A;  2Y5I A;  1M31 A;  1IRJ A;  2BCX A;  1HT9 A;  1UUS A;  2DOQ A;  2JRF A;  2JU0 A;  3EKJ A;  1QV1 A;  2O5G A;  3WH0 A;  2OTG C;  2F3Y A;  2Y1M A;  3DD4 A;  3SIB A;  1CNP A;  4I5K A;  1K95 A;  1MXL C;  1DJI A;  3BOW A;  1XFW O;  3GOF A;  3TCZ A;  1S6C A;  2KGB C;  3TDB A;  4YGB B;  3CTN A;  4GFT A;  4CPV A;  5G08 A;  2BL0 C;  4PHN A;  2PRU A;  2LLU A;  1OZO A;  4MLW A;  2ZQT A;  3BXK A;  2XP6 A;  2YSH A;  1DGU A;  1WDC B;  3I5F C;  4GGF C;  3DVE A;  1CMF A;  1XK4 C;  2KYF A;  2LMV A;  4JQ0 D;  1GJY A;  2ZQU A;  4IL1 A;  1BU3 A;  2M7N A;  2K2A A;  1K9R A;  1FBV A;  1S36 A;  1XFU O;  2D8N A;  2LVV A;  3LK0 A;  2F2P A;  1KQV A;  3ODK A;  1ZOT B;  4FTG A;  2M97 A;  2JMF A;  3NSK A;  2ISD A;  2LC5 A;  1DJY A;  1C7W A;  4ZCU A;  3I5G C;  1NCX A;  4OKH A;  1OOJ A;  1ZMZ A;  1QX7 A;  2DWV A;  1QLK A;  3BUM B;  1B4C A;  2KFH A;  3DF0 A;  3BUX B;  2RGI A;  4ORC B;  2KDH A;  4PAL A;  1N65 A;  1D1O A;  2I94 A;  1JF2 A;  2XP3 A;  1W7I B;  2FCE A;  3EKH A;  2XP8 A;  1G33 A;  2FJU B;  3BOW B;  4HRH A;  1EG3 A;  2JT8 A;  1H8B A;  1WY9 A;  1OMV A;  4F0Z B;  2CNP A;  1XA5 A;  2JNX A;  2LE9 B;  3SIA A;  1LIN A;  4C0K A;  2JNF A;  2E45 A;  1TNP A;  1SK6 D;  2BCA A;  3GK2 A;  4R1E A;  3EVV A;  4MZJ A;  1DT7 B;  2M8I A;  4N5X A;  1REC A;  1K9K A;  1S1E A;  2KNE A;  4I5L B;  1J7R A;  2WOR A;  3TS5 B;  3AKB A;  1WLM A;  3OP0 A;  1AJ4 A;  3KAD A;  3FWB A;  3SG6 A;  3CR2 A;  4YI9 A;  1NYA A;  2VRG A;  1SR6 B;  4YGD B;  1K2H A;  1MWN A;  1KFX L;  1UHN A;  4PE1 A;  2I18 A;  3SG3 A;  4YRU A;  3I5H B;  4E5R A;  4MVF A;  1R2U A;  3I5I B;  2JV4 A;  3D10 A;  1QJT A;  5CSJ A;  1SY9 A;  1F70 A;  3LK1 A;  1ALV A;  1DGV A;  3KO0 A;  1BOD A;  5ER4 X;  2IS9 A;  2M3W A;  1JBA A;  1OQP A;  1YTZ C;  2L0P A;  2LAN A;  1IG5 A;  5KTY A;  3TUY B;  5KU1 A;  5CSF A;  2MAZ A;  4AOM A;  1K94 A;  2BL0 B;  1Y1X A;  2H61 A;  1MQ1 A;  1TNQ A;  4YI8 A;  3ZNI A;  1KQM B;  3CS1 A;  1CLB A;  2ZR4 A;  1XK4 A;  4YGE B;  2DK1 A;  2R2I A;  2ZN9 A;  2GV5 A;  2MJW B;  3JVT B;  2A4J A;  1AJ5 A;  1F4O A;  3BUW B;  4XYN A;  2HPS A;  3BUO B;  2KI6 D;  1B7T Y;  3M7N A;  3SG7 A;  3I5I C;  1L7Z A;  5I2L A;  1RK9 A;  2PMY A;  2QAC A;  1YX7 A;  4XJK A;  2K61 A;  1JC2 A;  5CPV A;  2E30 A;  1KCY A;  1DJX A;  5AAN A;  1G4Y R;  1UWO A;  4MSP A;  1CFF A;  1RRO A;  3GK4 X;  2PSR A;  4PE7 A;  2ZNE A;  1WR7 A;  5F6T A;  1UHK A;  3SG5 A;  5I8N A;  2DMV A;  4D1E A;  3DVM A;  1MHO A;  2MA2 A;  1B7T Z;  1YR5 A;  3M0W A;  1JFK A;  5HKW A;  1J7Q A;  4WQ2 A;  1OE9 B;  1PAL A;  1XFY O;  1KK7 Z;  1IH0 A;  2F8P A;  1EL4 A;  2WCF A;  5AXI A;  1PIN A;  3VRR A;  2ZR6 A;  3VGO A;  1OMR A;  1K96 A;  1N2D A;  1GGZ A;  1ALW A;  3KEV A;  3GK1 A;  1QXP A;  4GUK A;  1K90 D;  2WND A;  4U86 A;  1DF0 B;  4DS7 A;  4I5N B;  1QVI Z;  1PSR A;  3ICB A;  3IQQ A;  2YSI A;  1A75 A;  1F71 A;  5KSZ A;  1NCZ A;  2PVB A;  3PAT A;  1TNX A;  3HX4 A;  1CFP A;  3I5H C;  1A4P A;  1B8R A;  5ER5 A;  2JZI A;  1LKJ A;  3CR4 X;  2BKH B;  3E3R A;  3PN7 B;  5GQQ C;  3TS5 C;  1Q80 A;  1NMV A;  3DVJ A;  3OX6 A;  4DIR A;  5D7F A;  3NTP A;  1U5I A;  1TOP A;  1Y0V H;  2JXC A;  2L4I A;  2M1K B;  1J1E A;  1A03 A;  2JX8 A;  3A8R A;  1UHH A;  5IBW A;  1KSO A;  1LA3 A;  2LVJ A;  3DVK A;  1H4B A;  2G2B A;  1CLM A;  4GGF A;  5AEQ A;  2KI6 C;  1AVS A;  3JTD B;  1SYM A;  1DTL A;  3OHM B;  3SG2 A;  5HYD A;  3AAK A;  3VRQ A;  1K9Q A;  1NP8 A;  1CKK A;  3WHU B;  4QJ4 B;  2F3Z A;  4NQG A;  2LUX A;  2ZQV A;  5HLO A;  2CBL A;  2LVI A;  3FWC A;  2WCE A;  1NUB A;  2Q5A A;  1JF0 A;  1W7J B;  1TK7 A;  4N1G A;  1DJH A;  4P2Y B;  3FS7 A;  1SPY A;  1M45 A;  2H61 C;  3L4H A; 
#chains in the Genus database with same CATH topology
 2AMI A;  5HKY A;  2KXQ A;  2BA1 A;  3NHT A;  2LMU A;  1CB1 A;  2L5X B;  2OS8 C;  2P6B B;  2K60 A;  1MXE A;  2Y1N A;  4GNK B;  1AP4 A;  3FS8 A;  3VRP A;  1YRT B;  2YGU A;  3SS4 A;  4CID A;  1MR8 A;  4PE0 A;  1SCV A;  1U5I B;  1F8A B;  2LUC A;  1FI5 A;  4MZL A;  3VB1 A;  3O4X A;  3KCE A;  2M1U A;  4PHJ A;  2XP9 A;  2LAJ A;  2EGD A;  2Y4Q A;  2Y8N B;  3OB2 B;  2KQ6 A;  3KAH A;  2YSG A;  2KAX A;  1OZS A;  1TN4 A;  2MLF C;  4BY4 A;  1XFX O;  1TUJ A;  1IQ5 A;  1CDM A;  3CLN A;  2ZQS A;  2ZND A;  2H2K A;  3NXA A;  2LV7 A;  2EZ5 W;  3BUN B;  2PQL A;  1NX2 A;  3IQO A;  1A75 B;  1PK0 D;  3KAB A;  1SMG A;  2KPH A;  4INW A;  2OWO A;  1YUR A;  1LXF C;  5I2Q A;  2E6W A;  1AK8 A;  2RE3 A;  2F2O A;  2M49 B;  2PAS A;  3TZ1 A;  1CMG A;  4REX A;  1KWO C;  1S5G Y;  2JT0 A;  1SRA A;  2JTZ A;  2WCM A;  2KLD A;  4QJ3 B;  1YUT A;  2M29 A;  3DYE A;  5DKR A;  2YAJ B;  3KAG A;  4XJK B;  2JC2 A;  2K7D A;  2BKI B;  2L2C A;  1YW5 A;  5CQ2 A;  3D0Y A;  3PM2 A;  5B8I B;  1B8L A;  3FE8 A;  3KAI A;  1S5G Z;  1ZAC A;  2L2E A;  3AAJ A;  3IF7 A;  2BE4 A;  2M8J A;  3D73 A;  4HSZ A;  3SJS A;  3ZWH A;  4TNC A;  1YRU B;  3AKA A;  4YBH B;  2G9B A;  1BMO A;  2OS8 B;  2Q91 A;  5PAL A;  3PM8 A;  3S0E A;  1AUI B;  1KK8 B;  2BBM A;  3FSC A;  1YVH A;  5DKQ A;  2K7C A;  1WMV A;  2NZ0 A;  3CWG A;  1NWD A;  2BBN A;  2I2R E;  2L98 A;  4MZK A;  5D3O A;  3BYA A;  2HQW A;  1S26 D;  1QS7 A;  1NIW A;  1OSA A;  1LA0 A;  1QVI Y;  1QX5 B;  4DRW A;  1JFJ A;  4OR9 B;  3PSR A;  2ITK A;  3LE4 A;  3TDZ A;  3OOB A;  1PRW A;  1JMQ A;  1AHR A;  2WCH A;  4CFQ A;  2XPB A;  3KF9 A;  3TUY C;  1FI6 A;  2SAS A;  2LLS A;  3FSB A;  3DXL A;  4UPG A;  4U85 A;  1NSH A;  5TNC A;  1TTX A;  1PVA A;  1TNW A;  1OMD A;  1OOF A;  2L4H A;  1CM4 A;  4MRY A;  4ORB B;  3CR5 X;  3WHT B;  2L4J A;  1KK7 Y;  3D74 A;  1BR1 B;  1F55 A;  2LP2 A;  5CSI A;  5HLV A;  1RTP 1;  1J1D A;  1S3P A;  2XP4 A;  4JWQ A;  1SSE B;  2F33 A;  1V1F A;  4M2O A;  1B8C A;  1W9Z A;  2CCM A;  2LNK A;  3PN7 C;  4P5O E;  3TDU A;  1CFD A;  3A4U B;  1DF0 A;  2EC6 C;  3CZ1 A;  1FW4 A;  4YGC B;  1T14 A;  3OGN A;  1NCY A;  3VRN A;  1J55 A;  5K89 A;  2QRV A;  2QEV A;  3TC5 A;  3NSL A;  1L2O C;  1XFZ O;  2KI4 B;  3FIA A;  4GGN A;  4L9M A;  4OZD A;  1M63 B;  3O4Y A;  4JPZ B;  5DIC A;  1SL9 A;  3CGA A;  2BE6 A;  3EVR A;  3QME A;  4BY5 A;  4CFR A;  1GGW A;  1SBJ A;  2P71 A;  1IWQ A;  4ETO A;  2Q4U A;  1G8I A;  2XP7 A;  2WC6 A;  4GPL B;  1F8H A;  1K9U A;  1YUS A;  3LLE A;  2L50 A;  4PHK A;  1O6W A;  1QX2 A;  2SCP A;  1IJ6 A;  2MDI A;  1CM1 A;  2K2F A;  2YSF A;  1RP5 A;  3DF0 B;  3OX5 A;  3WNX B;  3H4S E;  1CDL A;  3BFA A;  1QV0 A;  2LVK A;  1CFC A;  2GTE A;  1RWY A;  1QAT A;  2P70 A;  4ZCV A;  1Y1U A;  2K7O A;  1JSA A;  1GQM A;  1J7P A;  3NSI A;  2CTN A;  1CDP A;  1OOI X;  3EK4 A;  1PUL A;  1YUU A;  2EHB A;  2ZFD A;  1SCM B;  2LHL A;  3EVU A;  3KHE A;  3HCM A;  3L4A A;  3LCP C;  3N7H A;  2BEC A;  2MBX A;  3S0D A;  4A4C A;  2XPA A;  3OBV A;  2LMT A;  4I5J A;  1ODB A;  1EXR A;  1QTX A;  2L51 A;  2LCP A;  4N1F A;  2KYC A;  1VRK A;  2M8U A;  2MHH A;  1NPQ A;  2NCO A;  2GGM A;  2O60 A;  3PJI A;  2OPO A;  4U8D A;  4USL A;  1SW8 A;  1KK8 C;  5BPJ A;  4A4B A;  1UHI A;  2JTT A;  2F21 A;  1BF5 A;  1DEK A;  3O2P A;  1LVC D;  1HQV A;  3D0Y B;  4WQ3 A;  2XP5 A;  2KOT A;  1NX3 A;  2JT3 A;  1MF8 B;  3RLZ A;  2MLE C;  1PVB A;  2V53 A;  3KAF A;  2K7B A;  2NCP A;  3CDN A;  1J7O A;  1EH2 A;  5AER A;  3F45 A;  2AUC A;  4OCI A;  1DJW A;  1RFJ A;  2KBI A;  4MBE A;  3LKX B;  5AHT A;  3PLF B;  1SL8 A;  4OV2 A;  1F4Q A;  3RM1 A;  1C3Y A;  3PFV A;  4PDZ A;  1ZCN A;  1CLL A;  4YGA A;  2CT9 A;  2JQ6 A;  3BFH A;  3D75 A;  2FCD A;  2OTG B;  2LAP A;  2ZAJ A;  5HKZ A;  4A0T A;  1MUX A;  1NX1 A;  3CZT X;  4E68 A;  1RJV A;  3DZT A;  2WC8 A;  5AFP A;  4C0L A;  2BNX A;  1R6P A;  2WCK A;  1QLS A;  3MCB B;  4QIB A;  1B9A A;  3V2L A;  1XO5 A;  1F54 A;  1C7V A;  4MRX A;  1FF1 A;  1BG1 A;  3B86 A;  4QJ5 B;  3CNG A;  3EG5 B;  4FQO A;  3QRX A;  5JOL A;  3R72 A;  1SR6 C;  3L47 A;  2HET A;  1DVI A;  4ORA B;  2ZR5 A;  4M2Q A;  2M3O W;  2QEB A;  1BT6 A;  2KGR A;  3R1P A;  1JWD A;  3K21 A;  1K93 D;  3JVT C;  2KHN A;  1TWO A;  2JWW A;  2KI4 C;  5DKN A;  4GBA A;  1SL7 A;  2L5Y A;  2COL B;  1S6J A;  2JXL A;  4DUQ A;  1K8U A;  5E62 A;  1EJ3 A;  1X02 A;  1FPW A;  4FQT A;  4WRI A;  1UHJ A;  1DJG A;  2B1U A;  3NSO A;  5CSN A;  2YSB A;  2WCB A;  1A29 A;  2ZRS A;  5FI2 A;  4NDB A;  3I5G B;  1KWO B;  3SG4 A;  1IQ3 A;  1TCF A;  3D77 A;  4M2P A;  5FYX A;  1TCO B;  1KSM A;  2JPT A;  4DCK A;  4HRE E;  4MEW A;  1K9P A;  2MRD A;  2M7L A;  2BCB A;  3KPX A;  3O6B A;  1KQM C;  1C3Z A;  1SCM C;  1WRZ A;  1Y6W A;  4AQJ A;  2QEH A;  2HQ8 A;  1DQE A;  4PCW A;  1TR8 A;  1KFX S;  3EK8 A;  5I94 A;  1XVJ A;  2AAO A;  1SKT A;  2KFG A;  1S6I A;  1WLZ A;  2QEO A;  2ZRT A;  4GAO A;  1Y1A A;  1XFR A;  2EC6 B;  1WDC C;  1QIW A;  2CXJ A;  2WOS A;  2KAY A;  3I5F B;  3LL8 B;  1TRF A;  1XFV O;  3SS5 A;  2FOT A;  1L2O B;  1DC1 A;  4OVN F;  2NXQ A;  1BLQ A;  2ZN8 A;  3WXA A;  1UUR A;  1IKU A;  1B47 A;  1ZFS A;  1IJ5 A;  4PE4 A;  1UP5 A;  1YX8 A;  1N0Y A;  3CZ0 A;  2ZKM X;  5JJG A;  3D76 A;  4HRG A;  1A2X A;  2KFF A;  1NX0 A;  1CTR A;  4C0J A;  3PQH A;  3MQH A;  3M85 A;  3JTD C;  3CYZ A;  5J3X A;  2DJY A;  2KSP A;  3BFB A;  1EG4 A;  2M0R A;  5I2O A;  1XYD A;  4ICB A;  1KFU L;  1JUO A;  2FJY A;  5FI6 A;  1C07 A;  1ZUZ A;  2LP3 A;  4Q04 A;  5EL2 A;  1IGV A;  2TN4 A;  1LS8 A;  3L4L A;  1WRL A;  1BR4 B;  1YVL A;  3CZ2 A;  1CDN A;  2PAL A;  2NLN A;  1E8A A;  2K8M B;  2QPT A;  3OB1 B;  1SNL A;  4U84 A;  2LHI A;  2GGZ A;  2HF5 A;  4NDC A;  3Q8I A;  4INX A;  1V1G A;  1TIZ A;  2JXW A;  2JUL A;  1QIV A;  5D69 A;  2M9G A;  3B6X A;  2KQY A;  4CLN A;  1B1G A;  1BOC A;  2KBM A;  2JOJ A;  1M46 A;  4PHM A;  1I5H W;  4NDD A;  1QAS A;  1ORG A;  2LM5 A;  3B87 A;  3MSE B;  2KAV A;  1DMO A;  3MQG A;  3TDI A;  2I7A A;  3D78 A;  3EK7 A;  2K0J A;  3VRO A;  4MN0 A;  3BQ3 A;  3O78 A;  1PSB A;  1M39 A;  3PAL A;  2LLT A;  4AQI A;  1BJF A;  1DJZ A;  1GM0 A;  1KFU S;  3MCB A;  3C1V A;  1WRK A;  2Y5I A;  1M31 A;  1IRJ A;  2BCX A;  1HT9 A;  1UUS A;  2BAP A;  2DOQ A;  2JRF A;  2JU0 A;  3EKJ A;  1QV1 A;  2O5G A;  1QWV A;  4IJ7 A;  3WH0 A;  2OTG C;  2F3Y A;  2Y1M A;  3DD4 A;  3SIB A;  1CNP A;  4I5K A;  1K95 A;  1MXL C;  1P28 A;  1DJI A;  3BOW A;  2DK7 A;  1XFW O;  3GOF A;  3TCZ A;  1S6C A;  2KGB C;  3TDB A;  4YGB B;  3CTN A;  4GFT A;  4CPV A;  5G08 A;  2BL0 C;  4PHN A;  2PRU A;  2LLU A;  1OZO A;  4MLW A;  2ZQT A;  3BXK A;  2XP6 A;  2YSH A;  1DGU A;  1WDC B;  3I5F C;  4GGF C;  3DVE A;  3RZS A;  1CMF A;  1XK4 C;  2KYF A;  2LMV A;  4JQ0 D;  1Z2C B;  1GJY A;  2ZQU A;  4IL1 A;  1BU3 A;  2M7N A;  2K2A A;  3LKX A;  1K9R A;  1FBV A;  1S36 A;  1XFU O;  2D8N A;  2LVV A;  1FLC A;  3LK0 A;  2F2P A;  1KQV A;  3ODK A;  1ZOT B;  4FTG A;  2M97 A;  2JMF A;  1OOG A;  3NSK A;  2LC5 A;  1DJY A;  1C7W A;  4ZCU A;  2ISD A;  4GLX A;  3I5G C;  1NCX A;  4OKH A;  1OOJ A;  1ZMZ A;  1QX7 A;  1OOH A;  2KLE A;  2DWV A;  1QLK A;  3BUM B;  1B4C A;  2KFH A;  3DF0 A;  3BUX B;  2RGI A;  4ORC B;  2KDH A;  4PAL A;  1DEL A;  1N65 A;  2I94 A;  1JF2 A;  4PT1 A;  1W7I B;  1D1O A;  2FCE A;  2XP3 A;  3EKH A;  5U47 A;  2XP8 A;  3R1O A;  1G33 A;  2FJU B;  3BOW B;  3NHI A;  1EG3 A;  2JT8 A;  4HRH A;  1H8B A;  1WY9 A;  1OMV A;  4F0Z B;  2CNP A;  1XA5 A;  3R1V A;  2JNX A;  2LE9 B;  3SIA A;  1LIN A;  4C0K A;  2JNF A;  2E45 A;  3S0B A;  1TNP A;  1SK6 D;  2BCA A;  3GK2 A;  4R1E A;  3EVV A;  4MZJ A;  1DT7 B;  2M8I A;  4N5X A;  1REC A;  3CAB A;  1K9K A;  1S1E A;  2KNE A;  3IVT A;  4I5L B;  2WAD A;  1J7R A;  2WOR A;  5E65 A;  3TS5 B;  3AKB A;  1WLM A;  3OP0 A;  1AJ4 A;  3KAD A;  3FWB A;  3SG6 A;  3CR2 A;  4YI9 A;  1NYA A;  2VRG A;  1SR6 B;  4YGD B;  1K2H A;  1MWN A;  1KFX L;  1UHN A;  4PE1 A;  2I18 A;  3SG3 A;  4YRU A;  3I5H B;  4E5R A;  4MVF A;  1R2U A;  3I5I B;  5E5W A;  5E64 A;  2JV4 A;  3D10 A;  1QJT A;  5CSJ A;  1SY9 A;  1F70 A;  2ERB A;  3LK1 A;  1ALV A;  1DGV A;  3KO0 A;  1BOD A;  5ER4 X;  2IS9 A;  2M3W A;  1JBA A;  1OQP A;  1YTZ C;  2L0P A;  2LAN A;  1IG5 A;  2WCJ A;  3B7A A;  3FE9 A;  5KTY A;  3TUY B;  5KU1 A;  5CSF A;  2MAZ A;  4AOM A;  1K94 A;  2BL0 B;  1Y1X A;  2H61 A;  1MQ1 A;  1TNQ A;  4YI8 A;  3ZNI A;  1KQM B;  3CS1 A;  1CLB A;  1Z4H A;  2ZR4 A;  1XK4 A;  4YGE B;  3K1E A;  2DK1 A;  2R2I A;  3B88 A;  2ZN9 A;  2GV5 A;  2MJW B;  3JVT B;  3S0A A;  1IIO A;  2A4J A;  1AJ5 A;  1F4O A;  3BUW B;  4XYN A;  2HPS A;  3BUO B;  2KI6 D;  4F7F A;  1B7T Y;  4A0U A;  2PYQ A;  3SG7 A;  3M7N A;  3I5I C;  1L7Z A;  5I2L A;  1RK9 A;  2PMY A;  2QAC A;  1YX7 A;  4XJK A;  2K61 A;  1JC2 A;  5CPV A;  2E30 A;  1KCY A;  1DJX A;  5AAN A;  1G4Y R;  1UWO A;  4MSP A;  1CFF A;  1RRO A;  3GK4 X;  2PSR A;  4PE7 A;  2ZNE A;  1WR7 A;  5F6T A;  1UHK A;  3SG5 A;  4KYN A;  5I8N A;  4D1E A;  3DVM A;  2DMV A;  1MHO A;  2MA2 A;  1B7T Z;  1YR5 A;  3M0W A;  1JFK A;  4JD9 A;  5HKW A;  2WC5 A;  3NGV A;  1J7Q A;  4WQ2 A;  1OE9 B;  1PAL A;  1XFY O;  3DY9 A;  1OW4 A;  1KK7 Z;  1IH0 A;  2F8P A;  1EL4 A;  2WCF A;  5FI7 A;  5AXI A;  2WCL A;  1PIN A;  2JPO A;  3VRR A;  3VGO A;  2ZR6 A;  1OMR A;  1K96 A;  1N2D A;  1GGZ A;  1ALW A;  3KEV A;  3UNW A;  3GK1 A;  1QXP A;  4GUK A;  1K90 D;  2WND A;  4U86 A;  1DF0 B;  3UO9 A;  4DS7 A;  3S0G A;  4I5N B;  1QVI Z;  1PSR A;  3ICB A;  3IQQ A;  2YSI A;  1A75 A;  1F71 A;  5KSZ A;  1NCZ A;  2PVB A;  3PAT A;  1TNX A;  3HX4 A;  1CFP A;  3I5H C;  3SS3 A;  1A4P A;  1B8R A;  2QDI A;  5ER5 A;  2JZI A;  1LKJ A;  3CR4 X;  2BKH B;  3E3R A;  3PN7 B;  4JKT A;  5GQQ C;  1TUZ A;  3TS5 C;  1Q80 A;  1NMV A;  3DVJ A;  3OX6 A;  4DIR A;  5D7F A;  3NTP A;  1U5I A;  1TOP A;  1Y0V H;  2JXC A;  2L4I A;  2M1K B;  1J1E A;  1A03 A;  2JX8 A;  2WAE A;  3A8R A;  1UHH A;  5IBW A;  1KSO A;  1LA3 A;  2LVJ A;  3DVK A;  1H4B A;  2G2B A;  1CLM A;  4GGF A;  5AEQ A;  2KI6 C;  1AVS A;  3JTD B;  1SYM A;  1DTL A;  3OHM B;  3SG2 A;  5HYD A;  3AAK A;  5HL1 A;  5E66 A;  3VRQ A;  1K9Q A;  1NP8 A;  3BJH A;  1CKK A;  3S0F A;  2H8V A;  3WHU B;  3FE6 A;  4QJ4 B;  2F3Z A;  4NQG A;  2LUX A;  2ZQV A;  5HLO A;  2CBL A;  2LVI A;  3FWC A;  2WCE A;  1NUB A;  2Q5A A;  1JF0 A;  1W7J B;  1TK7 A;  4N1G A;  1DJH A;  4P2Y B;  3FS7 A;  1SPY A;  1M45 A;  2H61 C;  3L4H A; 
#chains in the Genus database with same CATH homology
 2AMI A;  5HKY A;  2KXQ A;  2BA1 A;  2LMU A;  1CB1 A;  2L5X B;  2OS8 C;  2P6B B;  2Y1N A;  1MXE A;  4GNK B;  1AP4 A;  3FS8 A;  3VRP A;  1YRT B;  4CID A;  1MR8 A;  4PE0 A;  1SCV A;  1U5I B;  1F8A B;  2LUC A;  1FI5 A;  4MZL A;  3KCE A;  2M1U A;  4PHJ A;  2XP9 A;  2LAJ A;  2EGD A;  2Y4Q A;  2Y8N B;  3OB2 B;  2KQ6 A;  3KAH A;  2YSG A;  2KAX A;  1OZS A;  1TN4 A;  2MLF C;  4BY4 A;  1XFX O;  1IQ5 A;  1CDM A;  3CLN A;  2ZQS A;  2ZND A;  2H2K A;  3NXA A;  2LV7 A;  2EZ5 W;  3BUN B;  1NX2 A;  3IQO A;  1A75 B;  1PK0 D;  3KAB A;  1SMG A;  2OWO A;  1YUR A;  1LXF C;  5I2Q A;  2E6W A;  1AK8 A;  2RE3 A;  2F2O A;  2M49 B;  2PAS A;  3TZ1 A;  1CMG A;  4REX A;  1KWO C;  1S5G Y;  2JT0 A;  1SRA A;  2JTZ A;  4QJ3 B;  1YUT A;  2M29 A;  5DKR A;  2YAJ B;  3KAG A;  4XJK B;  2JC2 A;  2K7D A;  2BKI B;  5CQ2 A;  1YW5 A;  3D0Y A;  5B8I B;  3KAI A;  1B8L A;  1S5G Z;  1ZAC A;  2L2E A;  3AAJ A;  3IF7 A;  2BE4 A;  2M8J A;  4HSZ A;  3SJS A;  3ZWH A;  4TNC A;  1YRU B;  3AKA A;  4YBH B;  2G9B A;  1BMO A;  2OS8 B;  2Q91 A;  5PAL A;  3PM8 A;  1AUI B;  1KK8 B;  2BBM A;  3FSC A;  1YVH A;  5DKQ A;  2K7C A;  1WMV A;  2NZ0 A;  3CWG A;  1NWD A;  2BBN A;  2I2R E;  2L98 A;  4MZK A;  3BYA A;  2HQW A;  1S26 D;  1QS7 A;  1NIW A;  1OSA A;  1LA0 A;  1QVI Y;  1QX5 B;  4DRW A;  1JFJ A;  4OR9 B;  3PSR A;  2ITK A;  3LE4 A;  3TDZ A;  3OOB A;  1PRW A;  1JMQ A;  1AHR A;  4CFQ A;  2XPB A;  3KF9 A;  3TUY C;  1FI6 A;  2SAS A;  2LLS A;  3FSB A;  4UPG A;  4U85 A;  1NSH A;  5TNC A;  1TTX A;  1PVA A;  1TNW A;  1OMD A;  2L4H A;  3WHT B;  1CM4 A;  4MRY A;  4ORB B;  3CR5 X;  2L4J A;  1KK7 Y;  1BR1 B;  1F55 A;  2LP2 A;  5CSI A;  5HLV A;  1RTP 1;  1J1D A;  1S3P A;  2XP4 A;  4JWQ A;  2F33 A;  1V1F A;  4M2O A;  1B8C A;  2CCM A;  2LNK A;  3PN7 C;  4P5O E;  3TDU A;  1CFD A;  3A4U B;  1DF0 A;  2EC6 C;  1FW4 A;  4YGC B;  1NCY A;  3VRN A;  1J55 A;  5K89 A;  2QRV A;  3TC5 A;  3NSL A;  1L2O C;  1XFZ O;  2KI4 B;  3FIA A;  4GGN A;  4L9M A;  1M63 B;  3O4Y A;  4JPZ B;  4CFR A;  1SL9 A;  3CGA A;  2BE6 A;  3EVR A;  4BY5 A;  1GGW A;  1SBJ A;  1IWQ A;  4ETO A;  2Q4U A;  1G8I A;  2XP7 A;  4GPL B;  1F8H A;  1K9U A;  1YUS A;  3LLE A;  2L50 A;  4PHK A;  1O6W A;  1QX2 A;  2SCP A;  1IJ6 A;  2MDI A;  1CM1 A;  2K2F A;  2YSF A;  1RP5 A;  3DF0 B;  3OX5 A;  3WNX B;  3H4S E;  1CDL A;  1QV0 A;  2LVK A;  1CFC A;  1RWY A;  1QAT A;  4ZCV A;  1Y1U A;  2K7O A;  1JSA A;  1GQM A;  1J7P A;  3NSI A;  2CTN A;  1CDP A;  3EK4 A;  1PUL A;  1YUU A;  2EHB A;  2ZFD A;  1SCM B;  2LHL A;  3EVU A;  3KHE A;  3HCM A;  3LCP C;  2MBX A;  2BEC A;  4A4C A;  2XPA A;  2LMT A;  4I5J A;  1ODB A;  1EXR A;  1QTX A;  2L51 A;  2LCP A;  4N1F A;  2KYC A;  1VRK A;  2M8U A;  2MHH A;  1NPQ A;  2NCO A;  2GGM A;  2O60 A;  2OPO A;  4U8D A;  4USL A;  1SW8 A;  1KK8 C;  5BPJ A;  4A4B A;  1UHI A;  2JTT A;  2F21 A;  1BF5 A;  3O2P A;  1LVC D;  1HQV A;  3D0Y B;  4WQ3 A;  2XP5 A;  2KOT A;  1NX3 A;  2JT3 A;  1MF8 B;  3RLZ A;  2MLE C;  1PVB A;  2V53 A;  3KAF A;  2K7B A;  2NCP A;  1J7O A;  1EH2 A;  5AER A;  3F45 A;  2AUC A;  4OCI A;  1DJW A;  1RFJ A;  2KBI A;  4MBE A;  3LKX B;  5AHT A;  3PLF B;  1SL8 A;  4OV2 A;  1F4Q A;  3RM1 A;  3PFV A;  4PDZ A;  1ZCN A;  1CLL A;  4YGA A;  2CT9 A;  2JQ6 A;  2FCD A;  2OTG B;  2LAP A;  2ZAJ A;  5HKZ A;  4A0T A;  1MUX A;  1NX1 A;  3CZT X;  4E68 A;  1RJV A;  2WC8 A;  5AFP A;  4C0L A;  1R6P A;  1QLS A;  3MCB B;  4QIB A;  1B9A A;  1F54 A;  1XO5 A;  1C7V A;  4MRX A;  1FF1 A;  1BG1 A;  4QJ5 B;  3CNG A;  4FQO A;  3QRX A;  5JOL A;  1SR6 C;  2HET A;  1DVI A;  4ORA B;  2ZR5 A;  4M2Q A;  2M3O W;  1BT6 A;  2KGR A;  1JWD A;  3K21 A;  1K93 D;  3JVT C;  2KHN A;  2JWW A;  2KI4 C;  5DKN A;  4GBA A;  1SL7 A;  2COL B;  1S6J A;  2JXL A;  4DUQ A;  1K8U A;  5E62 A;  1EJ3 A;  1X02 A;  1FPW A;  4WRI A;  1UHJ A;  1DJG A;  2B1U A;  3NSO A;  5CSN A;  2YSB A;  2WCB A;  1A29 A;  2ZRS A;  4NDB A;  3I5G B;  1KWO B;  3SG4 A;  1IQ3 A;  1TCF A;  5FYX A;  4M2P A;  1TCO B;  1KSM A;  2JPT A;  4DCK A;  4HRE E;  4MEW A;  1K9P A;  2MRD A;  2M7L A;  2BCB A;  3KPX A;  3O6B A;  1KQM C;  1WRZ A;  1SCM C;  1Y6W A;  4AQJ A;  2HQ8 A;  4PCW A;  1TR8 A;  1KFX S;  3EK8 A;  1XVJ A;  2AAO A;  1SKT A;  2KFG A;  1S6I A;  1WLZ A;  2ZRT A;  4GAO A;  2DK7 A;  1Y1A A;  2EC6 B;  1WDC C;  1QIW A;  2CXJ A;  2WOS A;  2KAY A;  3I5F B;  3LL8 B;  1TRF A;  1XFV O;  2FOT A;  1L2O B;  4OVN F;  2NXQ A;  1BLQ A;  2ZN8 A;  3WXA A;  1UUR A;  1IKU A;  1B47 A;  1ZFS A;  1IJ5 A;  4PE4 A;  1UP5 A;  1YX8 A;  1N0Y A;  5JJG A;  2ZKM X;  4HRG A;  1A2X A;  2KFF A;  1NX0 A;  1CTR A;  4C0J A;  3PQH A;  3MQH A;  3M85 A;  3JTD C;  5J3X A;  2DJY A;  2KSP A;  1EG4 A;  2M0R A;  5I2O A;  1XYD A;  4ICB A;  1KFU L;  1JUO A;  1C07 A;  1ZUZ A;  2LP3 A;  4Q04 A;  1IGV A;  2TN4 A;  1WRL A;  1BR4 B;  1YVL A;  1CDN A;  2PAL A;  2NLN A;  1E8A A;  2K8M B;  2QPT A;  3OB1 B;  1SNL A;  4U84 A;  2LHI A;  2GGZ A;  2HF5 A;  4NDC A;  1V1G A;  1TIZ A;  2JXW A;  2JUL A;  1QIV A;  5D69 A;  2M9G A;  4CLN A;  2KQY A;  1B1G A;  1BOC A;  2KBM A;  2JOJ A;  1M46 A;  4PHM A;  1I5H W;  4NDD A;  1QAS A;  2LM5 A;  3MSE B;  2KAV A;  1DMO A;  3MQG A;  3TDI A;  2I7A A;  3EK7 A;  2K0J A;  3VRO A;  4MN0 A;  3BQ3 A;  3O78 A;  1PSB A;  1M39 A;  3PAL A;  2LLT A;  4AQI A;  1BJF A;  1DJZ A;  1KFU S;  3MCB A;  3C1V A;  1WRK A;  2Y5I A;  1M31 A;  1IRJ A;  2BCX A;  1HT9 A;  1UUS A;  2DOQ A;  2JRF A;  2JU0 A;  3EKJ A;  1QV1 A;  2O5G A;  3WH0 A;  2OTG C;  2F3Y A;  2Y1M A;  3DD4 A;  3SIB A;  1CNP A;  4I5K A;  1K95 A;  1MXL C;  1DJI A;  3BOW A;  1XFW O;  3GOF A;  3TCZ A;  1S6C A;  2KGB C;  3TDB A;  4YGB B;  3CTN A;  4GFT A;  4CPV A;  5G08 A;  2BL0 C;  4PHN A;  2PRU A;  2LLU A;  1OZO A;  4MLW A;  2ZQT A;  3BXK A;  2XP6 A;  2YSH A;  1DGU A;  1WDC B;  3I5F C;  4GGF C;  3DVE A;  1CMF A;  1XK4 C;  2KYF A;  2LMV A;  4JQ0 D;  1GJY A;  2ZQU A;  4IL1 A;  1BU3 A;  2M7N A;  2K2A A;  3LKX A;  1K9R A;  1FBV A;  1S36 A;  1XFU O;  2D8N A;  2LVV A;  1FLC A;  3LK0 A;  2F2P A;  1KQV A;  3ODK A;  1ZOT B;  4FTG A;  2M97 A;  2JMF A;  3NSK A;  2ISD A;  2LC5 A;  1DJY A;  1C7W A;  4ZCU A;  4GLX A;  3I5G C;  1NCX A;  4OKH A;  1OOJ A;  1ZMZ A;  1QX7 A;  2DWV A;  1QLK A;  3BUM B;  1B4C A;  2KFH A;  3DF0 A;  3BUX B;  2RGI A;  4ORC B;  2KDH A;  4PAL A;  1N65 A;  1D1O A;  2I94 A;  1JF2 A;  2XP3 A;  1W7I B;  2FCE A;  3EKH A;  5U47 A;  2XP8 A;  1G33 A;  2FJU B;  3BOW B;  4HRH A;  1EG3 A;  2JT8 A;  1H8B A;  1WY9 A;  1OMV A;  4F0Z B;  2CNP A;  1XA5 A;  2JNX A;  2LE9 B;  3SIA A;  1LIN A;  4C0K A;  2JNF A;  2E45 A;  1TNP A;  1SK6 D;  2BCA A;  3GK2 A;  4R1E A;  3EVV A;  4MZJ A;  1DT7 B;  2M8I A;  4N5X A;  1REC A;  1K9K A;  1S1E A;  2KNE A;  4I5L B;  2WAD A;  1J7R A;  2WOR A;  5E65 A;  3TS5 B;  3AKB A;  1WLM A;  3OP0 A;  1AJ4 A;  3KAD A;  3FWB A;  3SG6 A;  3CR2 A;  4YI9 A;  1NYA A;  2VRG A;  1SR6 B;  4YGD B;  1K2H A;  1MWN A;  1KFX L;  1UHN A;  4PE1 A;  2I18 A;  3SG3 A;  4YRU A;  3I5H B;  4E5R A;  4MVF A;  1R2U A;  3I5I B;  5E5W A;  5E64 A;  2JV4 A;  3D10 A;  1QJT A;  5CSJ A;  1SY9 A;  1F70 A;  3LK1 A;  1ALV A;  1DGV A;  3KO0 A;  1BOD A;  5ER4 X;  2IS9 A;  2M3W A;  1JBA A;  1OQP A;  1YTZ C;  2L0P A;  2LAN A;  1IG5 A;  5KTY A;  3TUY B;  5KU1 A;  5CSF A;  2MAZ A;  4AOM A;  1K94 A;  2BL0 B;  1Y1X A;  2H61 A;  1MQ1 A;  1TNQ A;  4YI8 A;  3ZNI A;  1KQM B;  3CS1 A;  1CLB A;  2ZR4 A;  1XK4 A;  4YGE B;  2DK1 A;  2R2I A;  2ZN9 A;  2GV5 A;  2MJW B;  3JVT B;  2A4J A;  1AJ5 A;  1F4O A;  3BUW B;  4XYN A;  2HPS A;  3BUO B;  2KI6 D;  1B7T Y;  4A0U A;  3M7N A;  3SG7 A;  3I5I C;  1L7Z A;  5I2L A;  1RK9 A;  2PMY A;  2QAC A;  1YX7 A;  4XJK A;  2K61 A;  1JC2 A;  5CPV A;  2E30 A;  1KCY A;  1DJX A;  5AAN A;  1G4Y R;  1UWO A;  4MSP A;  1CFF A;  1RRO A;  3GK4 X;  2PSR A;  4PE7 A;  2ZNE A;  1WR7 A;  5F6T A;  1UHK A;  3SG5 A;  5I8N A;  2DMV A;  4D1E A;  3DVM A;  1MHO A;  2MA2 A;  1B7T Z;  1YR5 A;  3M0W A;  1JFK A;  5HKW A;  1J7Q A;  4WQ2 A;  1OE9 B;  1PAL A;  1XFY O;  1KK7 Z;  1IH0 A;  2F8P A;  1EL4 A;  2WCF A;  5AXI A;  1PIN A;  3VRR A;  2ZR6 A;  3VGO A;  1OMR A;  1K96 A;  1N2D A;  1GGZ A;  1ALW A;  3KEV A;  3GK1 A;  1QXP A;  4GUK A;  1K90 D;  2WND A;  4U86 A;  1DF0 B;  4DS7 A;  4I5N B;  1QVI Z;  1PSR A;  3ICB A;  3IQQ A;  2YSI A;  1A75 A;  1F71 A;  5KSZ A;  1NCZ A;  2PVB A;  3PAT A;  1TNX A;  3HX4 A;  1CFP A;  3I5H C;  1A4P A;  1B8R A;  5ER5 A;  2JZI A;  1LKJ A;  3CR4 X;  2BKH B;  3E3R A;  3PN7 B;  5GQQ C;  3TS5 C;  1Q80 A;  1NMV A;  3DVJ A;  3OX6 A;  4DIR A;  5D7F A;  3NTP A;  1U5I A;  1TOP A;  1Y0V H;  2JXC A;  2L4I A;  2M1K B;  1J1E A;  1A03 A;  2JX8 A;  2WAE A;  3A8R A;  1UHH A;  5IBW A;  1KSO A;  1LA3 A;  2LVJ A;  3DVK A;  1H4B A;  2G2B A;  1CLM A;  4GGF A;  5AEQ A;  2KI6 C;  1AVS A;  3JTD B;  1SYM A;  1DTL A;  3OHM B;  3SG2 A;  5HYD A;  3AAK A;  5E66 A;  3VRQ A;  1K9Q A;  1NP8 A;  1CKK A;  3WHU B;  4QJ4 B;  2F3Z A;  4NQG A;  2LUX A;  2ZQV A;  5HLO A;  2CBL A;  2LVI A;  3FWC A;  2WCE A;  1NUB A;  2Q5A A;  1JF0 A;  1W7J B;  1TK7 A;  4N1G A;  1DJH A;  4P2Y B;  3FS7 A;  1SPY A;  1M45 A;  2H61 C;  3L4H A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...