1EG3A

Structure of a dystrophin ww domain fragment in complex with a beta-dystroglycan peptide
Total Genus 98
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
98
sequence length
260
structure length
260
Chain Sequence
PASQHFLSTSVQGPWERAISPNKVPYYINHETQTTCWDHPKMTELYQSLADLNNVRFSAYRTAMKLRRLQKALCLDLLSLSAACDALDQHNLKQNDQPMDILQIINCLTTIYDRLEQEHNNLVNVPLCVDMCLNWLLNVYDTGRTGRIRVLSFKTGIISLCKAHLEDKYRYLFKQVASSTGFCDQRRLGLLLHDSIQIPRQLGEVASFGGSNIEPSVRSCFQFANNKPEIEAALFLDWMRLEPQSMVWLPVLHRVAAAET
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Structural protein
molecule keywords DYSTROPHIN
publication title Structure of a WW domain containing fragment of dystrophin in complex with beta-dystroglycan.
pubmed doi rcsb
source organism Homo sapiens
total genus 98
structure length 260
sequence length 260
ec nomenclature
pdb deposition date 2000-02-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00397 WW WW domain
A PF09068 EF-hand_2 EF hand
A PF09069 EF-hand_3 EF-hand
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 1eg3A03
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 1eg3A04
2.20.70.10 Mainly Beta Single Sheet Ubiquitin Ligase Nedd4; Chain: W; Ubiquitin Ligase Nedd4; Chain: W; 1eg3A01
3TZ1A 2XPBA 2D8NA 2E45A 3KAIA 1UHKA 3PFVA 4UPGA 3FWBA 5AFPA 1BR1B 2ZQVA 3PN7B 3KF9A 1BJFA 2JOJA 1C7VA 1SL8A 2MRDA 2M29A 1DVIA 2MBXA 2NLNA 4C0JA 1MWNA 1N0YA 1XYDA 4I5NB 1MF8B 4YGCB 3BUNB 4U84A 2LM5A 1XO5A 4R1EA 4P2YB 3O6BA 3HCMA 3PATA 1EG4A 1FPWA 1IWQA 2PASA 1V1GA 1SL7A 2LVKA 3CLNA 2LMUA 2V53A 3SG5A 3EK4A 5CPVA 1NX2A 2K2AA 1WDCC 2L0PA 4PHNA 1DJIA 2JTTA 4FTGA 5BPJA 1NP8A 5HYDA 2L5XB 1IQ5A 1Y1AA 5I2LA 2M7NA 4PE4A 1QX5B 2KHNA 3VGOA 2K61A 2L51A 5TNCA 1DT7B 1DJGA 4I5JA 3BYAA 2XP9A 5ER4X 1YVHA 2M97A 1OSAA 1WLZA 1QIVA 2GGMA 4F0ZB 2AMIA 1S6JA 1WRKA 2HETA 4NQGA 1ALVA 1QV1A 2BKHB 1KK7Y 3EKHA 1QS7A 1LA3A 3WXAA 4HREE 1SCMB 2F21A 2K8MB 2PALA 2PSRA 2DOQA 1OZSA 1K96A 2EGDA 1DJWA 4NDBA 4I5LB 3NTPA 3HX4A 1NCXA 5CSIA 2BE6A 1BG1A 1NCZA 2OS8B 1WR7A 1JF0A 1MXEA 1Y6WA 3KABA 2KBMA 1BR4B 1S1EA 1ZUZA 1YUUA 1DF0B 3ZNIA 3MSEB 3CGAA 1B7TZ 3KAFA 1EJ3A 3BOWA 2LV7A 5KTYA 1IJ6A 3CR5X 4ETOA 1J7PA 5GQQC 3NSOA 1OMDA 1K90D 1BF5A 1BMOA 1ZOTB 1XFWO 3ICBA 4I5KA 4OV2A 5AEQA 1PSRA 1BODA 2AAOA 1JC2A 1GGWA 1LXFC 4YGDB 2JX8A 1SY9A 2LP3A 4YBHB 1PRWA 1B4CA 1I5HW 4CFQA 2LCPA 2WCFA 4QIBA 3SIAA 3TDIA 1OQPA 2NCOA 2K0JA 1TOPA 1C7WA 1CFDA 1SCMC 3NXAA 4MN0A 2LLUA 1Y1UA 1S5GZ 1PVBA 2JC2A 3IQQA 3OB2B 4YI8A 1J1EA 4QJ5B 1L7ZA 2BCXA 2KBIA 5B8IB 1XFXO 2BECA 2DWVA 2XP6A 4REXA 1NCYA 2BCBA 1WMVA 2KYFA 2ITKA 1LA0A 1M39A 1RROA 4ICBA 5PALA 2F2PA 1FF1A 2KI6D 4XJKB 3SG2A 1Y1XA 5I2OA 2XP7A 1M31A 1K9QA 2OS8C 1SL9A 3I5FB 2JT3A 2LVVA 2EC6B 4PHJA 2KOTA 1O6WA 1CM1A 3WH0A 1JWDA 1MUXA 2XP5A 3LK0A 3EK7A 2YSIA 1K8UA 1RTP1 1S26D 2LVJA 3BUMB 2BBMA 3O4YA 1S5GY 4PE0A 2HQ8A 4PDZA 1CLLA 3PLFB 1EG3A 3JVTC 1TNPA 5CSFA 4AQJA 3VRQA 2F3ZA 1Q80A 2LAJA 1TCFA 4DIRA 3O78A 2FJUB 2H61A 2ZRSA 2WNDA 4GAOA 4HRGA 4NDCA 1S36A 1DJXA 1TNXA 3TS5B 2XP4A 5ER5A 1F4QA 1QLSA 4U8DA 2Q4UA 1K95A 1PULA 4WQ3A 3KHEA 2I7AA 2L50A 1IKUA 5AANA 3BQ3A 1JBAA 2TN4A 1WLMA 4PHMA 1RECA 1F4OA 1B8RA 1MQ1A 2ZAJA 1JFJA 4C0LA 4MZJA 1CFPA 1JF2A 2KAVA 5KU1A 4OR9B 3I5FC 3RM1A 4MBEA 2LMTA 2EC6C 1K9RA 5IBWA 2L4IA 1EXRA 1KFUS 2F33A 3TUYB 2KQ6A 2XPAA 1A75A 2COLB 1JSAA 2PMYA 2K7CA 3CR4X 1MHOA 3BOWB 4MRYA 5HKYA 1F55A 3OOBA 1CLBA 1TRFA 2JXCA 1CFFA 2CTNA 1SK6D 1IGVA 2KI4B 1XFYO 3PM8A 2BA1A 3CZTX 1Y0VH 5DKNA 1CTRA 1SPYA 2CCMA 1PALA 3TS5C 2MA2A 3TC5A 2CT9A 3I5GB 2JULA 5I2QA 5JJGA 1J7RA 4C0KA 1BT6A 1IRJA 2LNKA 1DJYA 2YSBA 3I5HB 1UWOA 1QVIZ 2DK7A 3PSRA 1SBJA 4OVNF 1K2HA 2ZRTA 1XA5A 2KFGA 1KFUL 1AVSA 1F8HA 1D1OA 3GK2A 1TNQA 1KK8B 2FCEA 1M46A 2JMFA 4E5RA 2ZR4A 1QASA 1HQVA 2JU0A 4OKHA 5J3XA 2KSPA 2JWWA 2QPTA 3BXKA 4IL1A 5CSJA 3TUYC 1YX8A 1W7JB 2SASA 2LUCA 1CKKA 3OP0A 1QTXA 2ZR6A 3DVEA 4QJ4B 1AUIB 1WRZA 1UHNA 2CNPA 1UURA 2KI4C 4MZLA 3SG4A 3F45A 1S6CA 1CMFA 1DJZA 1F70A 3KAGA 3DVJA 2JT0A 1J1DA 1SKTA 3AAJA 3JVTB 1XK4A 1VRKA 3VROA 2M3OW 2IS9A 4Q04A 1FI6A 3I5GC 1MR8A 1SR6C 1YUTA 3OX6A 2I18A 1F8AB 4WRIA 4M2OA 3BUXB 3BUWB 3M85A 4YGAA 1ALWA 2FOTA 5K89A 1JUOA 1XFVO 1WRLA 3CS1A 1TN4A 2KQYA 1QXPA 1PK0D 3I5HC 2A4JA 1B7TY 1TNWA 2LLTA 2Y1MA 2AUCA 4QJ3B 1PVAA 2WORA 3A4UB 3KPXA 1NX3A 1GGZA 4ZCUA 2YSGA 1KK8C 3I5IB 4MZKA 2LE9B 4PCWA 2KFHA 3NSLA 2DK1A 1ODBA 2BL0C 2KAXA 3TDBA 1A29A 2JPTA 4N5XA 2NCPA 1KSMA 4E68A 1OZOA 2KAYA 5D7FA 3D10A 4MRXA 3TCZA 4PHKA 2ZR5A 2G9BA 2LUXA 1IJ5A 3KADA 1NYAA 1CDMA 1KQMB 1B1GA 2WC8A 2KGRA 3LK1A 1KQVA 2DMVA 1G8IA 1EH2A 1NX0A 2JTZA 2I2RE 2EHBA 1LINA 4YGEB 1CDNA 1UP5A 3GOFA 2ZN8A 3OX5A 5HKWA 1FW4A 4TNCA 2JNXA 2M8IA 1CDLA 1YTZC 1JFKA 2GGZA 3SG3A 3KO0A 1QLKA 3ZWHA 1PSBA 1ZMZA 2LVIA 1SW8A 3DF0A 3NSIA 4MSPA 2JV4A 2P6BB 1AHRA 1BLQA 1KFXS 3IQOA 4D1EA 3RLZA 3FWCA 3EVRA 5CSNA 2LHIA 5I8NA 2LLSA 4BY5A 5AXIA 1FBVA 1SCVA 1UHIA 1RFJA 1KCYA 1PINA 2B1UA 3I5IC 5HKZA 1NSHA 3E3RA 3GK1A 4AOMA 1K93D 3KAHA 2BKIB 1DF0A 4GUKA 2JXWA 1YRTB 2VRGA 4GGFA 3WHTB 3TDUA 3M0WA 3BUOB 2JQ6A 2MLFC 1IG5A 2LP2A 3NSKA 1BU3A 4A4CA 1CNPA 1IH0A 1S6IA 3C1VA 1NUBA 1QIWA 1WY9A 2NZ0A 4CIDA 1DJHA 2ZFDA 5AHTA 3L4HA 2YSFA 2Q91A 1YR5A 3LL8B 3WNXB 1GJYA 1KQMC 2RE3A 1KSOA 4BY4A 2L98A 2EZ5W 1U5IA 3K21A 2E6WA 1H8BA 3LE4A 2M0RA 2LANA 4JWQA 2ZQUA 2BBNA 1S3PA 3CTNA 3VRPA 3A8RA 1M63B 3QRXA 1IQ3A 4YI9A 1AP4A 2M8JA 1B8LA 1J7OA 2I94A 1QX2A 2PVBA 2OTGB 2FCDA 2M9GA 2WCEA 1MXLC 1A2XA 4GGNA 1SR6B 4CLNA 4NDDA 2JXLA 2ZNDA 2ZKMX 4XJKA 4CPVA 3GK4X 2ISDA 1ZACA 1NPQA 1TCOB 1K94A 2L4HA 3D0YA 2KXQA 4A4BA 2L4JA 2HF5A 2KYCA 4DUQA 2HQWA 2ZN9A 2GV5A 4ZCVA 3EVUA 4N1GA 1CB1A 1KK7Z 2CBLA 1ZFSA 2M1UA 1KWOB 3VRRA 2LAPA 2K7BA 2KI6C 4PALA 1YUSA 3EVVA 2BL0B 1XVJA 5DKQA 2R2IA 1TTXA 1QJTA 1HT9A 2KFFA 2ZNEA 5HLVA 1JMQA 3ODKA 1QVIY 2E30A 2CXJA 3JTDC 1N2DA 4DS7A 1UHJA 1YRUB 3AKAA 1XK4C 1F71A 3OB1B 2K7DA 2SCPA 1YURA 3IF7A 4HSZA 4ORCB 3VRNA 3WHUB 2QACA 3AKBA 1TIZA 1K9KA 4YRUA 2OTGC 3DF0B 3PN7C 1NIWA 1N65A 4MVFA 1AJ4A 1QATA 4GPLB 3LCPC 1LKJA 4DRWA 4FQOA 2K7OA 1UUSA 1K9UA 3CWGA 3SJSA 4PE7A 2LMVA 1B8CA 2F8PA 3LLEA 5G08A 3SG6A 2OPOA 1H4BA 1CMGA 1J55A 1X02A 1OOJA 5DKRA 1A03A 4HRHA 4M2QA 1A4PA 1RK9A 2M8UA 3FS7A 4MEWA 5D69A 1RWYA 3TDZA 1OE9B 3EK8A 3M7NA 1CM4A 1KWOC 2NXQA 4WQ2A 2LC5A 2Y4QA 1G4YR 1RJVA 1ZCNA 1DGUA 4GBAA 2F2OA 2ZQTA 2WOSA 4USLA 4U85A 1A75B 4L9MA 2O5GA 2MDIA 1U5IB 3CNGA 5CQ2A 2JZIA 4MLWA 3DVMA 3SIBA 2Y5IA 5F6TA 1L2OB 2BE4A 2Q5AA 2MAZA 2MHHA 3KCEA 1F54A 2XP8A 1YW5A 2H61C 2HPSA 2M7LA 1QV0A 2PRUA 3DVKA 1R6PA 1YX7A 3PALA 1TK7A 2H2KA 3CR2A 4U86A 1DTLA 5KSZA 4AQIA 4GNKB 3SG7A 1CLMA 1BOCA 2KDHA 1B47A 2KNEA 3DD4A 4DCKA 1NMVA 3O2PA 2M3WA 1OMVA 1EL4A 1CDPA 4ORBB 5HLOA 2XP3A 3KEVA 4P5OE 5JOLA 4CFRA 1AK8A 2M49B 3FIAA 3D0YB 1YVLA 2DJYA 4OCIA 3AAKA 1UHHA 2ZQSA 1GQMA 4GGFC 4N1FA 2MJWB 1C07A 3EKJA 1SMGA 1QX7A 1FI5A 1OMRA 1AJ5A 1W7IB 2JNFA 1CFCA 1K9PA 1NX1A 1SRAA 2K2FA 1SYMA 1XFZO 1WDCB 3OHMB 1DGVA 2BCAA 2LHLA 1R2UA 2L2EA 1G33A 1V1FA 4GFTA 5FYXA 5AERA 4PE1A 2JT8A 4XYNA 2JRFA 1E8AA 1L2OC 1LVCD 2O60A 2F3YA 3H4SE 2RGIA 1DMOA 2WCBA 2Y1NA 1KFXL 1B9AA 4JQ0D 4M2PA 4ORAB 3JTDB 1NWDA 4JPZB 4YGBB 1XFUO 2MLEC 1SNLA 2KGBC 2M1KB 2YSHA 2G2BA 1M45A 1J7QA
chains in the Genus database with same CATH superfamily
2QEBA 3TZ1A 2XPBA 3LKXB 2D8NA 2E45A 3BFHA 3KAIA 1UHKA 3PFVA 4UPGA 3FWBA 5AFPA 1BR1B 2ZQVA 3PN7B 3KF9A 5E5WA 1BJFA 2JOJA 1C7VA 1SL8A 2MRDA 2M29A 1DVIA 3O4XA 2NLNA 2MBXA 4C0JA 1MWNA 1N0YA 1XYDA 4I5NB 1MF8B 4YGCB 3BUNB 4U84A 2LM5A 1XO5A 4R1EA 4P2YB 5I94A 3O6BA 3HCMA 3PATA 1EG4A 1FPWA 1IWQA 2PASA 1V1GA 1SL7A 2LVKA 1DC1A 3CLNA 2LMUA 2V53A 3SG5A 3EK4A 5CPVA 3VB1A 1NX2A 2K2AA 1WDCC 2L0PA 4PHNA 1DJIA 2JTTA 2YAJB 1Z4HA 4FTGA 5BPJA 3SS3A 1NP8A 5HYDA 2L5XB 1IQ5A 4PT1A 1Y1AA 5I2LA 3BFAA 2M7NA 2PYQA 3B87A 1QX5B 2KHNA 4PE4A 3VGOA 2K61A 2L51A 5TNCA 1DT7B 1DJGA 4I5JA 3BYAA 2XP9A 5ER4X 1YVHA 2M97A 1OSAA 1WLZA 1QIVA 2GGMA 4F0ZB 4F7FA 2AMIA 1S6JA 1WRKA 2HETA 4NQGA 1ALVA 1QV1A 2BKHB 1KK7Y 3EKHA 1QS7A 1LA3A 3WXAA 4HREE 3FE6A 1SCMB 2F21A 3EG5B 2K8MB 2PALA 3PQHA 3NHTA 2PSRA 2DOQA 1OZSA 1K96A 2EGDA 1DJWA 4NDBA 4I5LB 3NTPA 3HX4A 1NCXA 5CSIA 2BE6A 5E65A 1BG1A 1NCZA 2OS8B 1WR7A 1JF0A 1MXEA 1Y6WA 3KABA 2KBMA 3PM2A 1BR4B 1S1EA 1ZUZA 1YUUA 2YGUA 3D78A 1DF0B 1SSEB 3IVTA 3ZNIA 3MSEB 3CGAA 1B7TZ 3KAFA 1EJ3A 3BOWA 2LV7A 1OW4A 3S0EA 5KTYA 1IJ6A 3CR5X 4ETOA 3NHIA 1J7PA 5GQQC 3NSOA 1OMDA 1K90D 1BF5A 2GTEA 1BMOA 1ZOTB 1XFWO 3ICBA 4I5KA 4OV2A 5AEQA 1PSRA 1BODA 2AAOA 1JC2A 1GGWA 1LXFC 4YGDB 2JX8A 1SY9A 2LP3A 3CZ0A 4YBHB 1PRWA 1B4CA 1I5HW 4CFQA 2LCPA 2WCFA 4QIBA 3SIAA 3TDIA 1OQPA 2NCOA 2K0JA 1TOPA 1C7WA 1DEKA 4A0UA 3FSCA 1CFDA 1SCMC 3NXAA 3MCBB 4MN0A 2LLUA 1Y1UA 1S5GZ 1PVBA 2JC2A 3IQQA 3OB2B 4YI8A 1J1EA 4QJ5B 1L7ZA 2BCXA 2KBIA 5B8IB 1XFXO 2BECA 2DWVA 2XP6A 4REXA 1NCYA 2BCBA 1WMVA 2KYFA 2ITKA 1LA0A 1M39A 1RROA 4ICBA 5PALA 2F2PA 1FF1A 2KI6D 4XJKB 3SG2A 1Y1XA 5I2OA 2XP7A 1M31A 1K9QA 2OS8C 1SL9A 3I5FB 3R72A 1FLCA 2JT3A 2LVVA 2FJYA 2EC6B 4PHJA 2KOTA 1O6WA 1CM1A 3WH0A 1JWDA 1MUXA 2XP5A 3LK0A 3EK7A 2YSIA 1K8UA 1RTP1 1S26D 2LVJA 3BUMB 2BBMA 3O4YA 1S5GY 4PE0A 2HQ8A 4PDZA 1CLLA 3PLFB 1EG3A 3JVTC 1P28A 1TNPA 5CSFA 5FI6A 3VRQA 4AQJA 2F3ZA 1Q80A 2LAJA 1TCFA 3R1VA 4DIRA 5HL1A 3O78A 2FJUB 2H61A 2ZRSA 3S0DA 2WNDA 2H8VA 4GAOA 4HRGA 4NDCA 1S36A 2WADA 1DJXA 3K1EA 3FSBA 2QEOA 3R1PA 1TNXA 3TS5B 2XP4A 5ER5A 1F4QA 1QLSA 2KLEA 2Q4UA 4U8DA 1OOHA 1K95A 1PULA 4WQ3A 3KHEA 2I7AA 3PJIA 5U47A 2L50A 1IKUA 5AANA 3BQ3A 1JBAA 4KYNA 3D76A 2TN4A 1WLMA 4PHMA 1RECA 3B6XA 1W9ZA 1F4OA 1B8RA 1MQ1A 2ZAJA 1JFJA 4C0LA 4MZJA 1CFPA 1JF2A 2KAVA 5KU1A 4OR9B 3I5FC 3RM1A 4MBEA 2LMTA 2EC6C 1K9RA 5IBWA 2L4IA 1EXRA 1KFUS 2L5YA 2F33A 3TUYB 1GM0A 5E64A 2KQ6A 2XPAA 1A75A 3Q8IA 2COLB 1JSAA 2PMYA 2K7CA 3CR4X 1MHOA 3BOWB 4MRYA 5HKYA 1F55A 3OOBA 1CLBA 1TRFA 2JXCA 1CFFA 4INXA 2CTNA 1SK6D 1IGVA 2KI4B 1XFYO 3PM8A 2BA1A 3CZTX 2OWOA 1Y0VH 5DKNA 1CTRA 1SPYA 2CCMA 2QEVA 2P70A 1PALA 3TS5C 2MA2A 3TC5A 2CT9A 3I5GB 2JULA 5I2QA 5JJGA 1J7RA 3FS8A 4C0KA 1BT6A 1IRJA 2LNKA 2WCLA 1DJYA 5I8NA 3S0GA 2YSBA 3I5HB 1UWOA 3D73A 1QVIZ 3DXLA 3PSRA 2DK7A 1SBJA 4OVNF 1K2HA 2ZRTA 1XA5A 2KFGA 1KFUL 1AVSA 1F8HA 1D1OA 3GK2A 1TNQA 1KK8B 2FCEA 1M46A 2JMFA 4E5RA 2ZR4A 1QASA 2KLDA 1HQVA 2JU0A 4OKHA 5J3XA 3B88A 1Z2CB 2KSPA 2JWWA 2QPTA 4A0TA 3BXKA 4IL1A 5CSJA 3TUYC 1OOIX 1YX8A 2WAEA 1W7JB 2SASA 2LUCA 3B7AA 1CKKA 3OP0A 5E66A 1QTXA 2ZR6A 5D3OA 5E62A 3DVEA 4QJ4B 2BAPA 1AUIB 1WRZA 1UHNA 2CNPA 1UURA 3RZSA 2KI4C 4MZLA 3SG4A 3F45A 1S6CA 1CMFA 1DJZA 4GLXA 1F70A 3KAGA 3DVJA 3SS4A 2JT0A 1J1DA 1SKTA 3AAJA 3JVTB 1XK4A 1VRKA 3VROA 2M3OW 2IS9A 4Q04A 1FI6A 3I5GC 1MR8A 1SR6C 1YUTA 2P71A 2I18A 3OX6A 4WRIA 4M2OA 1F8AB 3BUXB 1DQEA 3BUWB 3M85A 4YGAA 1ALWA 2FOTA 5K89A 1JUOA 1XFVO 1WRLA 3CS1A 1TN4A 2KQYA 1QXPA 1PK0D 3I5HC 2A4JA 1B7TY 1TNWA 2LLTA 2Y1MA 2AUCA 4QJ3B 1PVAA 2WORA 3A4UB 3KPXA 1NX3A 1GGZA 4ZCUA 1TR8A 2YSGA 1KK8C 3I5IB 4IJ7A 2LE9B 4MZKA 4PCWA 2KFHA 3NSLA 2DK1A 1ODBA 2BL0C 2KAXA 1TWOA 3TDBA 1A29A 2JPTA 4N5XA 2NCPA 1KSMA 4E68A 2WCMA 1OZOA 2KAYA 5D7FA 3D10A 4MRXA 3TCZA 4PHKA 2QRVA 1RP5A 2ZR5A 3SS5A 2G9BA 2LUXA 1IJ5A 3KADA 1NYAA 1CDMA 1KQMB 1B1GA 2WC8A 2KGRA 3LK1A 1KQVA 2DMVA 1G8IA 1EH2A 1NX0A 2JTZA 2I2RE 3QMEA 2EHBA 1LINA 4YGEB 1CDNA 1UP5A 3GOFA 2ZN8A 3OX5A 5HKWA 3N7HA 1FW4A 4TNCA 2JNXA 2M8IA 1CDLA 1YTZC 1JFKA 2GGZA 3SG3A 3KO0A 1QLKA 3ZWHA 1PSBA 1ZMZA 2LVIA 1SW8A 1TUZA 3DF0A 3NSIA 4MSPA 2P6BB 1AHRA 1BLQA 1KFXS 2WCHA 3IQOA 4D1EA 3RLZA 3FWCA 3EVRA 2ERBA 2LHIA 2K60A 2KPHA 2LLSA 5CSNA 1C3ZA 4BY5A 5AXIA 1FBVA 1SCVA 1UHIA 3NGVA 1RFJA 1KCYA 1PINA 2B1UA 3I5IC 5HKZA 1NSHA 3DY9A 3E3RA 3GK1A 4AOMA 1K93D 3KAHA 2BKIB 1DF0A 4GUKA 2JXWA 1YRTB 2VRGA 4GGFA 3WHTB 3TDUA 3M0WA 2JPOA 3BUOB 2JQ6A 2MLFC 1IG5A 1XFRA 2LP2A 1BU3A 3NSKA 4A4CA 1CNPA 1IH0A 1S6IA 3C1VA 1NUBA 1QIWA 1WY9A 2NZ0A 4CIDA 1DJHA 3DZTA 2ZFDA 5AHTA 2WC6A 2QDIA 3L4HA 2YSFA 2Q91A 1YR5A 3LL8B 1TUJA 3WNXB 1GJYA 1KQMC 4FQTA 2RE3A 3CYZA 1KSOA 4BY4A 2L98A 2EZ5W 1U5IA 3K21A 2E6WA 1H8BA 3LE4A 5CQ2A 2BNXA 2M0RA 2LANA 4JWQA 2ZQUA 2BBNA 1S3PA 3CTNA 3L4AA 3VRPA 3A8RA 1M63B 3QRXA 3L47A 4YI9A 1AP4A 1IQ3A 1B8LA 1J7OA 2M8JA 3MQHA 3MCBA 2I94A 3D74A 1QX2A 3UO9A 2PVBA 2OTGB 2FCDA 2M9GA 3D75A 2WCEA 1MXLC 1A2XA 4GGNA 1SR6B 4CLNA 4NDDA 2JXLA 1T14A 2ZNDA 2ZKMX 4XJKA 4CPVA 3GK4X 2ISDA 3S0BA 1ZACA 1NPQA 4INWA 1TCOB 1K94A 5EL2A 2L4HA 3D0YA 2JV4A 4A4BA 3OBVA 2KXQA 2HF5A 2L4JA 2KYCA 4DUQA 1ORGA 2HQWA 2ZN9A 2GV5A 4ZCVA 3EVUA 4N1GA 1CB1A 1KK7Z 2CBLA 1ZFSA 2M1UA 1KWOB 3VRRA 2LAPA 2K7BA 2KI6C 3FE8A 1YUSA 3EVVA 1XVJA 2BL0B 4PALA 5DKQA 2R2IA 1TTXA 1QJTA 3OGNA 1HT9A 2KFFA 2ZNEA 5HLVA 1JMQA 3ODKA 1QVIY 2E30A 2CXJA 2WCJA 3JTDC 1N2DA 4DS7A 1UHJA 1C3YA 1YRUB 3AKAA 1XK4C 4OZDA 1F71A 1OOFA 3OB1B 2K7DA 2SCPA 1YURA 3IF7A 4HSZA 4ORCB 3VRNA 3WHUB 2QACA 3AKBA 1TIZA 4JD9A 1K9KA 4YRUA 2OTGC 3DF0B 3PN7C 1NIWA 1N65A 4MVFA 1OOGA 1AJ4A 1QATA 4GPLB 3LCPC 1LKJA 4DRWA 3LKXA 4FQOA 2K7OA 1UUSA 1K9UA 3CWGA 3SJSA 4PE7A 2LMVA 1B8CA 2F8PA 3LLEA 5G08A 3SG6A 2OPOA 1H4BA 1CMGA 1J55A 1X02A 3CDNA 1OOJA 5DKRA 1A03A 3BJHA 5DICA 4HRHA 4M2QA 1A4PA 1RK9A 2M8UA 3FS7A 4MEWA 5D69A 1RWYA 3TDZA 1OE9B 2L2CA 2WCKA 3EK8A 3M7NA 1CM4A 1KWOC 3S0FA 2NXQA 4WQ2A 2LC5A 2Y4QA 1DELA 1G4YR 1RJVA 1ZCNA 1DGUA 4GBAA 3DYEA 4JKTA 2F2OA 2ZQTA 2WOSA 4USLA 4U85A 1A75B 4L9MA 2O5GA 2MDIA 1U5IB 3CZ2A 1QWVA 2JZIA 4MLWA 3CNGA 3DVMA 3SIBA 2Y5IA 5F6TA 3S0AA 1L2OB 2BE4A 2Q5AA 3V2LA 2MAZA 2MHHA 3KCEA 5FI7A 1F54A 3CABA 2XP8A 1YW5A 2H61C 2HPSA 2M7LA 1QV0A 2PRUA 3DVKA 1R6PA 1YX7A 3PALA 3FE9A 1TK7A 2H2KA 3CR2A 3MQGA 1DTLA 4U86A 5KSZA 4AQIA 4GNKB 3SG7A 1CLMA 3UNWA 1BOCA 2KDHA 1B47A 2KNEA 3DD4A 4DCKA 1NMVA 3O2PA 2M3WA 1OMVA 1EL4A 1CDPA 4ORBB 5HLOA 2XP3A 3KEVA 4P5OE 5JOLA 4CFRA 1AK8A 2M49B 3FIAA 3D0YB 1YVLA 2DJYA 4OCIA 3AAKA 1UHHA 3B86A 2ZQSA 1GQMA 4GGFC 4N1FA 2MJWB 1C07A 3EKJA 3L4LA 2QEHA 1SMGA 1QX7A 3BFBA 1FI5A 1IIOA 1OMRA 1AJ5A 1W7IB 2Y8NB 2JNFA 1CFCA 1K9PA 1NX1A 1SRAA 2K2FA 1SYMA 1XFZO 1WDCB 2PQLA 3D77A 3OHMB 3CZ1A 1DGVA 2BCAA 2LHLA 1R2UA 2L2EA 1G33A 1V1FA 4GFTA 2WC5A 5FYXA 5AERA 5FI2A 4PE1A 2JT8A 4XYNA 2JRFA 1E8AA 1L2OC 1LVCD 2O60A 2F3YA 3H4SE 2RGIA 1DMOA 2WCBA 2Y1NA 1KFXL 1B9AA 3R1OA 4JQ0D 4M2PA 4ORAB 3JTDB 1NWDA 4JPZB 4YGBB 1XFUO 2MLEC 1SNLA 2KGBC 2M1KB 2YSHA 1LS8A 2G2BA 1M45A 1J7QA
chains in the Genus database with same CATH topology
3TZ1A 2XPBA 3LKXB 2D8NA 2E45A 3KAIA 1UHKA 3PFVA 4UPGA 3FWBA 5AFPA 1BR1B 2ZQVA 3PN7B 3KF9A 5E5WA 1BJFA 2JOJA 1C7VA 1SL8A 2MRDA 2M29A 1DVIA 2MBXA 2NLNA 4C0JA 1MWNA 1N0YA 1XYDA 4I5NB 1MF8B 4YGCB 3BUNB 4U84A 2LM5A 1XO5A 4R1EA 4P2YB 3O6BA 3HCMA 3PATA 1EG4A 1FPWA 1IWQA 2PASA 1V1GA 1SL7A 2LVKA 3CLNA 2LMUA 2V53A 3SG5A 3EK4A 5CPVA 1NX2A 2K2AA 1WDCC 2L0PA 4PHNA 1DJIA 2JTTA 2YAJB 4FTGA 5BPJA 1NP8A 5HYDA 2L5XB 1IQ5A 1Y1AA 5I2LA 2M7NA 4PE4A 1QX5B 2KHNA 3VGOA 2K61A 2L51A 5TNCA 1DT7B 1DJGA 4I5JA 3BYAA 2XP9A 5ER4X 1YVHA 2M97A 1OSAA 1WLZA 1QIVA 2GGMA 4F0ZB 2AMIA 1S6JA 1WRKA 2HETA 4NQGA 1ALVA 1QV1A 2BKHB 1KK7Y 3EKHA 1QS7A 1LA3A 3WXAA 4HREE 1SCMB 2F21A 2K8MB 2PALA 3PQHA 2PSRA 2DOQA 1OZSA 1K96A 2EGDA 1DJWA 4NDBA 4I5LB 3NTPA 3HX4A 1NCXA 5CSIA 2BE6A 5E65A 1BG1A 1NCZA 2OS8B 1WR7A 1JF0A 1MXEA 1Y6WA 3KABA 2KBMA 1BR4B 1S1EA 1ZUZA 1YUUA 1DF0B 3ZNIA 3MSEB 3CGAA 1B7TZ 3KAFA 1EJ3A 3BOWA 2LV7A 5KTYA 1IJ6A 3CR5X 4ETOA 1J7PA 5GQQC 3NSOA 1OMDA 1K90D 1BF5A 1BMOA 1ZOTB 1XFWO 3ICBA 4I5KA 4OV2A 5AEQA 1PSRA 1BODA 2AAOA 1JC2A 1GGWA 1LXFC 4YGDB 2JX8A 1SY9A 2LP3A 4YBHB 1PRWA 1B4CA 1I5HW 4CFQA 2LCPA 2WCFA 4QIBA 3SIAA 3TDIA 1OQPA 2NCOA 2K0JA 1TOPA 1C7WA 4A0UA 3FSCA 1CFDA 1SCMC 3NXAA 3MCBB 4MN0A 2LLUA 1Y1UA 1S5GZ 1PVBA 2JC2A 3IQQA 3OB2B 4YI8A 1J1EA 4QJ5B 1L7ZA 2BCXA 2KBIA 5B8IB 1XFXO 2BECA 2DWVA 2XP6A 4REXA 1NCYA 2BCBA 1WMVA 2KYFA 2ITKA 1LA0A 1M39A 1RROA 4ICBA 5PALA 2F2PA 1FF1A 2KI6D 4XJKB 3SG2A 1Y1XA 5I2OA 2XP7A 1M31A 1K9QA 2OS8C 1SL9A 3I5FB 1FLCA 2JT3A 2LVVA 2EC6B 4PHJA 2KOTA 1O6WA 1CM1A 3WH0A 1JWDA 1MUXA 2XP5A 3LK0A 3EK7A 2YSIA 1K8UA 1RTP1 1S26D 2LVJA 3BUMB 2BBMA 3O4YA 1S5GY 4PE0A 2HQ8A 4PDZA 1CLLA 3PLFB 1EG3A 3JVTC 1TNPA 5CSFA 4AQJA 3VRQA 2F3ZA 1Q80A 2LAJA 1TCFA 4DIRA 3O78A 2FJUB 2H61A 2ZRSA 2WNDA 4GAOA 4HRGA 4NDCA 1S36A 2WADA 1DJXA 3FSBA 1TNXA 3TS5B 2XP4A 5ER5A 1F4QA 1QLSA 4U8DA 2Q4UA 1K95A 1PULA 4WQ3A 3KHEA 2I7AA 5U47A 2L50A 1IKUA 5AANA 3BQ3A 1JBAA 2TN4A 1WLMA 4PHMA 1RECA 1F4OA 1B8RA 1MQ1A 2ZAJA 1JFJA 4C0LA 4MZJA 1CFPA 1JF2A 2KAVA 5KU1A 4OR9B 3I5FC 3RM1A 4MBEA 2LMTA 2EC6C 1K9RA 5IBWA 2L4IA 1EXRA 1KFUS 2F33A 3TUYB 5E64A 2KQ6A 2XPAA 1A75A 2COLB 1JSAA 2PMYA 2K7CA 3CR4X 1MHOA 3BOWB 4MRYA 5HKYA 1F55A 3OOBA 1CLBA 1TRFA 2JXCA 1CFFA 2CTNA 1SK6D 1IGVA 2KI4B 1XFYO 3PM8A 2BA1A 3CZTX 2OWOA 1Y0VH 5DKNA 1CTRA 1SPYA 2CCMA 1PALA 3TS5C 2MA2A 3TC5A 2CT9A 3I5GB 2JULA 5I2QA 5JJGA 1J7RA 3FS8A 4C0KA 1BT6A 1IRJA 2LNKA 1DJYA 2YSBA 3I5HB 1UWOA 1QVIZ 2DK7A 3PSRA 1SBJA 4OVNF 1K2HA 2ZRTA 1XA5A 2KFGA 1KFUL 1AVSA 1F8HA 1D1OA 3GK2A 1TNQA 1KK8B 2FCEA 1M46A 2JMFA 4E5RA 2ZR4A 1QASA 1HQVA 2JU0A 4OKHA 5J3XA 2KSPA 4A0TA 2JWWA 2QPTA 3BXKA 4IL1A 5CSJA 3TUYC 1YX8A 2WAEA 1W7JB 2SASA 2LUCA 1CKKA 3OP0A 5E66A 1QTXA 2ZR6A 5E62A 3DVEA 4QJ4B 1AUIB 1WRZA 1UHNA 2CNPA 1UURA 2KI4C 4MZLA 3SG4A 3F45A 1S6CA 1CMFA 1DJZA 4GLXA 1F70A 3KAGA 3DVJA 2JT0A 1J1DA 1SKTA 3AAJA 3JVTB 1XK4A 1VRKA 3VROA 2M3OW 2IS9A 4Q04A 1FI6A 3I5GC 1MR8A 1SR6C 1YUTA 3OX6A 2I18A 1F8AB 4WRIA 4M2OA 3BUXB 3BUWB 3M85A 4YGAA 1ALWA 2FOTA 5K89A 1JUOA 1XFVO 1WRLA 3CS1A 1TN4A 2KQYA 1QXPA 1PK0D 3I5HC 2A4JA 1B7TY 1TNWA 2LLTA 2Y1MA 2AUCA 4QJ3B 1PVAA 2WORA 3A4UB 3KPXA 1NX3A 1GGZA 4ZCUA 1TR8A 2YSGA 1KK8C 3I5IB 4MZKA 2LE9B 4PCWA 2KFHA 3NSLA 2DK1A 1ODBA 2BL0C 2KAXA 3TDBA 1A29A 2JPTA 4N5XA 2NCPA 1KSMA 4E68A 1OZOA 2KAYA 5D7FA 3D10A 4MRXA 3TCZA 4PHKA 2QRVA 1RP5A 2ZR5A 2G9BA 2LUXA 1IJ5A 3KADA 1NYAA 1CDMA 1KQMB 1B1GA 2WC8A 2KGRA 3LK1A 1KQVA 2DMVA 1G8IA 1EH2A 1NX0A 2JTZA 2I2RE 2EHBA 1LINA 4YGEB 1CDNA 1UP5A 3GOFA 2ZN8A 3OX5A 5HKWA 1FW4A 4TNCA 2JNXA 2M8IA 1CDLA 1YTZC 1JFKA 2GGZA 3SG3A 3KO0A 1QLKA 3ZWHA 1PSBA 1ZMZA 2LVIA 1SW8A 3DF0A 3NSIA 4MSPA 2JV4A 2P6BB 1AHRA 1BLQA 1KFXS 3IQOA 4D1EA 3RLZA 3FWCA 3EVRA 5CSNA 2LHIA 5I8NA 2LLSA 4BY5A 5AXIA 1FBVA 1SCVA 1UHIA 1RFJA 1KCYA 1PINA 2B1UA 3I5IC 5HKZA 1NSHA 3E3RA 3GK1A 4AOMA 1K93D 3KAHA 2BKIB 1DF0A 4GUKA 2JXWA 1YRTB 2VRGA 4GGFA 3WHTB 3TDUA 3M0WA 3BUOB 2JQ6A 2MLFC 1IG5A 2LP2A 3NSKA 1BU3A 4A4CA 1CNPA 1IH0A 1S6IA 3C1VA 1NUBA 1QIWA 1WY9A 2NZ0A 4CIDA 1DJHA 2ZFDA 5AHTA 3L4HA 2YSFA 2Q91A 1YR5A 3LL8B 3WNXB 1GJYA 1KQMC 2RE3A 1KSOA 4BY4A 2L98A 2EZ5W 1U5IA 3K21A 2E6WA 1H8BA 3LE4A 2M0RA 2LANA 4JWQA 2ZQUA 2BBNA 1S3PA 3CTNA 3VRPA 3A8RA 1M63B 3QRXA 1IQ3A 4YI9A 1AP4A 2M8JA 1B8LA 1J7OA 3MQHA 3MCBA 2I94A 1QX2A 2PVBA 2OTGB 2FCDA 2M9GA 2WCEA 1MXLC 1A2XA 4GGNA 1SR6B 4CLNA 4NDDA 2JXLA 2ZNDA 2ZKMX 4XJKA 4CPVA 3GK4X 2ISDA 1ZACA 1NPQA 1TCOB 1K94A 2L4HA 3D0YA 2KXQA 4A4BA 2L4JA 2HF5A 2KYCA 4DUQA 2HQWA 2ZN9A 2GV5A 4ZCVA 3EVUA 4N1GA 1CB1A 1KK7Z 2CBLA 1ZFSA 2M1UA 1KWOB 3VRRA 2LAPA 2K7BA 2KI6C 4PALA 1YUSA 3EVVA 2BL0B 1XVJA 5DKQA 2R2IA 1TTXA 1QJTA 1HT9A 2KFFA 2ZNEA 5HLVA 1JMQA 3ODKA 1QVIY 2E30A 2CXJA 3JTDC 1N2DA 4DS7A 1UHJA 1YRUB 3AKAA 1XK4C 1F71A 3OB1B 2K7DA 2SCPA 1YURA 3IF7A 4HSZA 4ORCB 3VRNA 3WHUB 2QACA 3AKBA 1TIZA 1K9KA 4YRUA 2OTGC 3DF0B 3PN7C 1NIWA 1N65A 4MVFA 1AJ4A 1QATA 4GPLB 3LCPC 1LKJA 4DRWA 3LKXA 4FQOA 2K7OA 1UUSA 1K9UA 3CWGA 3SJSA 4PE7A 2LMVA 1B8CA 2F8PA 3LLEA 5G08A 3SG6A 2OPOA 1H4BA 1CMGA 1J55A 1X02A 1OOJA 5DKRA 1A03A 4HRHA 4M2QA 1A4PA 1RK9A 2M8UA 3FS7A 4MEWA 5D69A 1RWYA 3TDZA 1OE9B 3EK8A 3M7NA 1CM4A 1KWOC 2NXQA 4WQ2A 2LC5A 2Y4QA 1G4YR 1RJVA 1ZCNA 1DGUA 4GBAA 2F2OA 2ZQTA 2WOSA 4USLA 4U85A 1A75B 4L9MA 2O5GA 2MDIA 1U5IB 3CNGA 5CQ2A 2JZIA 4MLWA 3DVMA 3SIBA 2Y5IA 5F6TA 1L2OB 2BE4A 2Q5AA 2MAZA 2MHHA 3KCEA 1F54A 2XP8A 1YW5A 2H61C 2HPSA 2M7LA 1QV0A 2PRUA 3DVKA 1R6PA 1YX7A 3PALA 1TK7A 2H2KA 3CR2A 3MQGA 1DTLA 4U86A 5KSZA 4AQIA 4GNKB 3SG7A 1CLMA 1BOCA 2KDHA 1B47A 2KNEA 3DD4A 4DCKA 1NMVA 3O2PA 2M3WA 1OMVA 1EL4A 1CDPA 4ORBB 5HLOA 2XP3A 3KEVA 4P5OE 5JOLA 4CFRA 1AK8A 2M49B 3FIAA 3D0YB 1YVLA 2DJYA 4OCIA 3AAKA 1UHHA 2ZQSA 1GQMA 4GGFC 4N1FA 2MJWB 1C07A 3EKJA 1SMGA 1QX7A 1FI5A 1OMRA 1AJ5A 1W7IB 2Y8NB 2JNFA 1CFCA 1K9PA 1NX1A 1SRAA 2K2FA 1SYMA 1XFZO 1WDCB 3OHMB 1DGVA 2BCAA 2LHLA 1R2UA 2L2EA 1G33A 1V1FA 4GFTA 5FYXA 5AERA 4PE1A 2JT8A 4XYNA 2JRFA 1E8AA 1L2OC 1LVCD 2O60A 2F3YA 3H4SE 2RGIA 1DMOA 2WCBA 2Y1NA 1KFXL 1B9AA 4JQ0D 4M2PA 4ORAB 3JTDB 1NWDA 4JPZB 4YGBB 1XFUO 2MLEC 1SNLA 2KGBC 2M1KB 2YSHA 2G2BA 1M45A 1J7QA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3TZ1 A;  2XPB A;  2D8N A;  2E45 A;  3KAI A;  1UHK A;  3PFV A;  4UPG A;  3FWB A;  5AFP A;  1BR1 B;  2ZQV A;  3PN7 B;  3KF9 A;  1BJF A;  2JOJ A;  1C7V A;  1SL8 A;  2MRD A;  2M29 A;  1DVI A;  2MBX A;  2NLN A;  4C0J A;  1MWN A;  1N0Y A;  1XYD A;  4I5N B;  1MF8 B;  4YGC B;  3BUN B;  4U84 A;  2LM5 A;  1XO5 A;  4R1E A;  4P2Y B;  3O6B A;  3HCM A;  3PAT A;  1EG4 A;  1FPW A;  1IWQ A;  2PAS A;  1V1G A;  1SL7 A;  2LVK A;  3CLN A;  2LMU A;  2V53 A;  3SG5 A;  3EK4 A;  5CPV A;  1NX2 A;  2K2A A;  1WDC C;  2L0P A;  4PHN A;  1DJI A;  2JTT A;  4FTG A;  5BPJ A;  1NP8 A;  5HYD A;  2L5X B;  1IQ5 A;  1Y1A A;  5I2L A;  2M7N A;  4PE4 A;  1QX5 B;  2KHN A;  3VGO A;  2K61 A;  2L51 A;  5TNC A;  1DT7 B;  1DJG A;  4I5J A;  3BYA A;  2XP9 A;  5ER4 X;  1YVH A;  2M97 A;  1OSA A;  1WLZ A;  1QIV A;  2GGM A;  4F0Z B;  2AMI A;  1S6J A;  1WRK A;  2HET A;  4NQG A;  1ALV A;  1QV1 A;  2BKH B;  1KK7 Y;  3EKH A;  1QS7 A;  1LA3 A;  3WXA A;  4HRE E;  1SCM B;  2F21 A;  2K8M B;  2PAL A;  2PSR A;  2DOQ A;  1OZS A;  1K96 A;  2EGD A;  1DJW A;  4NDB A;  4I5L B;  3NTP A;  3HX4 A;  1NCX A;  5CSI A;  2BE6 A;  1BG1 A;  1NCZ A;  2OS8 B;  1WR7 A;  1JF0 A;  1MXE A;  1Y6W A;  3KAB A;  2KBM A;  1BR4 B;  1S1E A;  1ZUZ A;  1YUU A;  1DF0 B;  3ZNI A;  3MSE B;  3CGA A;  1B7T Z;  3KAF A;  1EJ3 A;  3BOW A;  2LV7 A;  5KTY A;  1IJ6 A;  3CR5 X;  4ETO A;  1J7P A;  5GQQ C;  3NSO A;  1OMD A;  1K90 D;  1BF5 A;  1BMO A;  1ZOT B;  1XFW O;  3ICB A;  4I5K A;  4OV2 A;  5AEQ A;  1PSR A;  1BOD A;  2AAO A;  1JC2 A;  1GGW A;  1LXF C;  4YGD B;  2JX8 A;  1SY9 A;  2LP3 A;  4YBH B;  1PRW A;  1B4C A;  1I5H W;  4CFQ A;  2LCP A;  2WCF A;  4QIB A;  3SIA A;  3TDI A;  1OQP A;  2NCO A;  2K0J A;  1TOP A;  1C7W A;  1CFD A;  1SCM C;  3NXA A;  4MN0 A;  2LLU A;  1Y1U A;  1S5G Z;  1PVB A;  2JC2 A;  3IQQ A;  3OB2 B;  4YI8 A;  1J1E A;  4QJ5 B;  1L7Z A;  2BCX A;  2KBI A;  5B8I B;  1XFX O;  2BEC A;  2DWV A;  2XP6 A;  4REX A;  1NCY A;  2BCB A;  1WMV A;  2KYF A;  2ITK A;  1LA0 A;  1M39 A;  1RRO A;  4ICB A;  5PAL A;  2F2P A;  1FF1 A;  2KI6 D;  4XJK B;  3SG2 A;  1Y1X A;  5I2O A;  2XP7 A;  1M31 A;  1K9Q A;  2OS8 C;  1SL9 A;  3I5F B;  2JT3 A;  2LVV A;  2EC6 B;  4PHJ A;  2KOT A;  1O6W A;  1CM1 A;  3WH0 A;  1JWD A;  1MUX A;  2XP5 A;  3LK0 A;  3EK7 A;  2YSI A;  1K8U A;  1RTP 1;  1S26 D;  2LVJ A;  3BUM B;  2BBM A;  3O4Y A;  1S5G Y;  4PE0 A;  2HQ8 A;  4PDZ A;  1CLL A;  3PLF B;  1EG3 A;  3JVT C;  1TNP A;  5CSF A;  4AQJ A;  3VRQ A;  2F3Z A;  1Q80 A;  2LAJ A;  1TCF A;  4DIR A;  3O78 A;  2FJU B;  2H61 A;  2ZRS A;  2WND A;  4GAO A;  4HRG A;  4NDC A;  1S36 A;  1DJX A;  1TNX A;  3TS5 B;  2XP4 A;  5ER5 A;  1F4Q A;  1QLS A;  4U8D A;  2Q4U A;  1K95 A;  1PUL A;  4WQ3 A;  3KHE A;  2I7A A;  2L50 A;  1IKU A;  5AAN A;  3BQ3 A;  1JBA A;  2TN4 A;  1WLM A;  4PHM A;  1REC A;  1F4O A;  1B8R A;  1MQ1 A;  2ZAJ A;  1JFJ A;  4C0L A;  4MZJ A;  1CFP A;  1JF2 A;  2KAV A;  5KU1 A;  4OR9 B;  3I5F C;  3RM1 A;  4MBE A;  2LMT A;  2EC6 C;  1K9R A;  5IBW A;  2L4I A;  1EXR A;  1KFU S;  2F33 A;  3TUY B;  2KQ6 A;  2XPA A;  1A75 A;  2COL B;  1JSA A;  2PMY A;  2K7C A;  3CR4 X;  1MHO A;  3BOW B;  4MRY A;  5HKY A;  1F55 A;  3OOB A;  1CLB A;  1TRF A;  2JXC A;  1CFF A;  2CTN A;  1SK6 D;  1IGV A;  2KI4 B;  1XFY O;  3PM8 A;  2BA1 A;  3CZT X;  1Y0V H;  5DKN A;  1CTR A;  1SPY A;  2CCM A;  1PAL A;  3TS5 C;  2MA2 A;  3TC5 A;  2CT9 A;  3I5G B;  2JUL A;  5I2Q A;  5JJG A;  1J7R A;  4C0K A;  1BT6 A;  1IRJ A;  2LNK A;  1DJY A;  2YSB A;  3I5H B;  1UWO A;  1QVI Z;  2DK7 A;  3PSR A;  1SBJ A;  4OVN F;  1K2H A;  2ZRT A;  1XA5 A;  2KFG A;  1KFU L;  1AVS A;  1F8H A;  1D1O A;  3GK2 A;  1TNQ A;  1KK8 B;  2FCE A;  1M46 A;  2JMF A;  4E5R A;  2ZR4 A;  1QAS A;  1HQV A;  2JU0 A;  4OKH A;  5J3X A;  2KSP A;  2JWW A;  2QPT A;  3BXK A;  4IL1 A;  5CSJ A;  3TUY C;  1YX8 A;  1W7J B;  2SAS A;  2LUC A;  1CKK A;  3OP0 A;  1QTX A;  2ZR6 A;  3DVE A;  4QJ4 B;  1AUI B;  1WRZ A;  1UHN A;  2CNP A;  1UUR A;  2KI4 C;  4MZL A;  3SG4 A;  3F45 A;  1S6C A;  1CMF A;  1DJZ A;  1F70 A;  3KAG A;  3DVJ A;  2JT0 A;  1J1D A;  1SKT A;  3AAJ A;  3JVT B;  1XK4 A;  1VRK A;  3VRO A;  2M3O W;  2IS9 A;  4Q04 A;  1FI6 A;  3I5G C;  1MR8 A;  1SR6 C;  1YUT A;  3OX6 A;  2I18 A;  1F8A B;  4WRI A;  4M2O A;  3BUX B;  3BUW B;  3M85 A;  4YGA A;  1ALW A;  2FOT A;  5K89 A;  1JUO A;  1XFV O;  1WRL A;  3CS1 A;  1TN4 A;  2KQY A;  1QXP A;  1PK0 D;  3I5H C;  2A4J A;  1B7T Y;  1TNW A;  2LLT A;  2Y1M A;  2AUC A;  4QJ3 B;  1PVA A;  2WOR A;  3A4U B;  3KPX A;  1NX3 A;  1GGZ A;  4ZCU A;  2YSG A;  1KK8 C;  3I5I B;  4MZK A;  2LE9 B;  4PCW A;  2KFH A;  3NSL A;  2DK1 A;  1ODB A;  2BL0 C;  2KAX A;  3TDB A;  1A29 A;  2JPT A;  4N5X A;  2NCP A;  1KSM A;  4E68 A;  1OZO A;  2KAY A;  5D7F A;  3D10 A;  4MRX A;  3TCZ A;  4PHK A;  2ZR5 A;  2G9B A;  2LUX A;  1IJ5 A;  3KAD A;  1NYA A;  1CDM A;  1KQM B;  1B1G A;  2WC8 A;  2KGR A;  3LK1 A;  1KQV A;  2DMV A;  1G8I A;  1EH2 A;  1NX0 A;  2JTZ A;  2I2R E;  2EHB A;  1LIN A;  4YGE B;  1CDN A;  1UP5 A;  3GOF A;  2ZN8 A;  3OX5 A;  5HKW A;  1FW4 A;  4TNC A;  2JNX A;  2M8I A;  1CDL A;  1YTZ C;  1JFK A;  2GGZ A;  3SG3 A;  3KO0 A;  1QLK A;  3ZWH A;  1PSB A;  1ZMZ A;  2LVI A;  1SW8 A;  3DF0 A;  3NSI A;  4MSP A;  2JV4 A;  2P6B B;  1AHR A;  1BLQ A;  1KFX S;  3IQO A;  4D1E A;  3RLZ A;  3FWC A;  3EVR A;  5CSN A;  2LHI A;  5I8N A;  2LLS A;  4BY5 A;  5AXI A;  1FBV A;  1SCV A;  1UHI A;  1RFJ A;  1KCY A;  1PIN A;  2B1U A;  3I5I C;  5HKZ A;  1NSH A;  3E3R A;  3GK1 A;  4AOM A;  1K93 D;  3KAH A;  2BKI B;  1DF0 A;  4GUK A;  2JXW A;  1YRT B;  2VRG A;  4GGF A;  3WHT B;  3TDU A;  3M0W A;  3BUO B;  2JQ6 A;  2MLF C;  1IG5 A;  2LP2 A;  3NSK A;  1BU3 A;  4A4C A;  1CNP A;  1IH0 A;  1S6I A;  3C1V A;  1NUB A;  1QIW A;  1WY9 A;  2NZ0 A;  4CID A;  1DJH A;  2ZFD A;  5AHT A;  3L4H A;  2YSF A;  2Q91 A;  1YR5 A;  3LL8 B;  3WNX B;  1GJY A;  1KQM C;  2RE3 A;  1KSO A;  4BY4 A;  2L98 A;  2EZ5 W;  1U5I A;  3K21 A;  2E6W A;  1H8B A;  3LE4 A;  2M0R A;  2LAN A;  4JWQ A;  2ZQU A;  2BBN A;  1S3P A;  3CTN A;  3VRP A;  3A8R A;  1M63 B;  3QRX A;  1IQ3 A;  4YI9 A;  1AP4 A;  2M8J A;  1B8L A;  1J7O A;  2I94 A;  1QX2 A;  2PVB A;  2OTG B;  2FCD A;  2M9G A;  2WCE A;  1MXL C;  1A2X A;  4GGN A;  1SR6 B;  4CLN A;  4NDD A;  2JXL A;  2ZND A;  2ZKM X;  4XJK A;  4CPV A;  3GK4 X;  2ISD A;  1ZAC A;  1NPQ A;  1TCO B;  1K94 A;  2L4H A;  3D0Y A;  2KXQ A;  4A4B A;  2L4J A;  2HF5 A;  2KYC A;  4DUQ A;  2HQW A;  2ZN9 A;  2GV5 A;  4ZCV A;  3EVU A;  4N1G A;  1CB1 A;  1KK7 Z;  2CBL A;  1ZFS A;  2M1U A;  1KWO B;  3VRR A;  2LAP A;  2K7B A;  2KI6 C;  4PAL A;  1YUS A;  3EVV A;  2BL0 B;  1XVJ A;  5DKQ A;  2R2I A;  1TTX A;  1QJT A;  1HT9 A;  2KFF A;  2ZNE A;  5HLV A;  1JMQ A;  3ODK A;  1QVI Y;  2E30 A;  2CXJ A;  3JTD C;  1N2D A;  4DS7 A;  1UHJ A;  1YRU B;  3AKA A;  1XK4 C;  1F71 A;  3OB1 B;  2K7D A;  2SCP A;  1YUR A;  3IF7 A;  4HSZ A;  4ORC B;  3VRN A;  3WHU B;  2QAC A;  3AKB A;  1TIZ A;  1K9K A;  4YRU A;  2OTG C;  3DF0 B;  3PN7 C;  1NIW A;  1N65 A;  4MVF A;  1AJ4 A;  1QAT A;  4GPL B;  3LCP C;  1LKJ A;  4DRW A;  4FQO A;  2K7O A;  1UUS A;  1K9U A;  3CWG A;  3SJS A;  4PE7 A;  2LMV A;  1B8C A;  2F8P A;  3LLE A;  5G08 A;  3SG6 A;  2OPO A;  1H4B A;  1CMG A;  1J55 A;  1X02 A;  1OOJ A;  5DKR A;  1A03 A;  4HRH A;  4M2Q A;  1A4P A;  1RK9 A;  2M8U A;  3FS7 A;  4MEW A;  5D69 A;  1RWY A;  3TDZ A;  1OE9 B;  3EK8 A;  3M7N A;  1CM4 A;  1KWO C;  2NXQ A;  4WQ2 A;  2LC5 A;  2Y4Q A;  1G4Y R;  1RJV A;  1ZCN A;  1DGU A;  4GBA A;  2F2O A;  2ZQT A;  2WOS A;  4USL A;  4U85 A;  1A75 B;  4L9M A;  2O5G A;  2MDI A;  1U5I B;  3CNG A;  5CQ2 A;  2JZI A;  4MLW A;  3DVM A;  3SIB A;  2Y5I A;  5F6T A;  1L2O B;  2BE4 A;  2Q5A A;  2MAZ A;  2MHH A;  3KCE A;  1F54 A;  2XP8 A;  1YW5 A;  2H61 C;  2HPS A;  2M7L A;  1QV0 A;  2PRU A;  3DVK A;  1R6P A;  1YX7 A;  3PAL A;  1TK7 A;  2H2K A;  3CR2 A;  4U86 A;  1DTL A;  5KSZ A;  4AQI A;  4GNK B;  3SG7 A;  1CLM A;  1BOC A;  2KDH A;  1B47 A;  2KNE A;  3DD4 A;  4DCK A;  1NMV A;  3O2P A;  2M3W A;  1OMV A;  1EL4 A;  1CDP A;  4ORB B;  5HLO A;  2XP3 A;  3KEV A;  4P5O E;  5JOL A;  4CFR A;  1AK8 A;  2M49 B;  3FIA A;  3D0Y B;  1YVL A;  2DJY A;  4OCI A;  3AAK A;  1UHH A;  2ZQS A;  1GQM A;  4GGF C;  4N1F A;  2MJW B;  1C07 A;  3EKJ A;  1SMG A;  1QX7 A;  1FI5 A;  1OMR A;  1AJ5 A;  1W7I B;  2JNF A;  1CFC A;  1K9P A;  1NX1 A;  1SRA A;  2K2F A;  1SYM A;  1XFZ O;  1WDC B;  3OHM B;  1DGV A;  2BCA A;  2LHL A;  1R2U A;  2L2E A;  1G33 A;  1V1F A;  4GFT A;  5FYX A;  5AER A;  4PE1 A;  2JT8 A;  4XYN A;  2JRF A;  1E8A A;  1L2O C;  1LVC D;  2O60 A;  2F3Y A;  3H4S E;  2RGI A;  1DMO A;  2WCB A;  2Y1N A;  1KFX L;  1B9A A;  4JQ0 D;  4M2P A;  4ORA B;  3JTD B;  1NWD A;  4JPZ B;  4YGB B;  1XFU O;  2MLE C;  1SNL A;  2KGB C;  2M1K B;  2YSH A;  2G2B A;  1M45 A;  1J7Q A; 
#chains in the Genus database with same CATH topology
 2QEB A;  3TZ1 A;  2XPB A;  3LKX B;  2D8N A;  2E45 A;  3BFH A;  3KAI A;  1UHK A;  3PFV A;  4UPG A;  3FWB A;  5AFP A;  1BR1 B;  2ZQV A;  3PN7 B;  3KF9 A;  5E5W A;  1BJF A;  2JOJ A;  1C7V A;  1SL8 A;  2MRD A;  2M29 A;  1DVI A;  3O4X A;  2NLN A;  2MBX A;  4C0J A;  1MWN A;  1N0Y A;  1XYD A;  4I5N B;  1MF8 B;  4YGC B;  3BUN B;  4U84 A;  2LM5 A;  1XO5 A;  4R1E A;  4P2Y B;  5I94 A;  3O6B A;  3HCM A;  3PAT A;  1EG4 A;  1FPW A;  1IWQ A;  2PAS A;  1V1G A;  1SL7 A;  2LVK A;  1DC1 A;  3CLN A;  2LMU A;  2V53 A;  3SG5 A;  3EK4 A;  5CPV A;  3VB1 A;  1NX2 A;  2K2A A;  1WDC C;  2L0P A;  4PHN A;  1DJI A;  2JTT A;  2YAJ B;  1Z4H A;  4FTG A;  5BPJ A;  3SS3 A;  1NP8 A;  5HYD A;  2L5X B;  1IQ5 A;  4PT1 A;  1Y1A A;  5I2L A;  3BFA A;  2M7N A;  2PYQ A;  3B87 A;  1QX5 B;  2KHN A;  4PE4 A;  3VGO A;  2K61 A;  2L51 A;  5TNC A;  1DT7 B;  1DJG A;  4I5J A;  3BYA A;  2XP9 A;  5ER4 X;  1YVH A;  2M97 A;  1OSA A;  1WLZ A;  1QIV A;  2GGM A;  4F0Z B;  4F7F A;  2AMI A;  1S6J A;  1WRK A;  2HET A;  4NQG A;  1ALV A;  1QV1 A;  2BKH B;  1KK7 Y;  3EKH A;  1QS7 A;  1LA3 A;  3WXA A;  4HRE E;  3FE6 A;  1SCM B;  2F21 A;  3EG5 B;  2K8M B;  2PAL A;  3PQH A;  3NHT A;  2PSR A;  2DOQ A;  1OZS A;  1K96 A;  2EGD A;  1DJW A;  4NDB A;  4I5L B;  3NTP A;  3HX4 A;  1NCX A;  5CSI A;  2BE6 A;  5E65 A;  1BG1 A;  1NCZ A;  2OS8 B;  1WR7 A;  1JF0 A;  1MXE A;  1Y6W A;  3KAB A;  2KBM A;  3PM2 A;  1BR4 B;  1S1E A;  1ZUZ A;  1YUU A;  2YGU A;  3D78 A;  1DF0 B;  1SSE B;  3IVT A;  3ZNI A;  3MSE B;  3CGA A;  1B7T Z;  3KAF A;  1EJ3 A;  3BOW A;  2LV7 A;  1OW4 A;  3S0E A;  5KTY A;  1IJ6 A;  3CR5 X;  4ETO A;  3NHI A;  1J7P A;  5GQQ C;  3NSO A;  1OMD A;  1K90 D;  1BF5 A;  2GTE A;  1BMO A;  1ZOT B;  1XFW O;  3ICB A;  4I5K A;  4OV2 A;  5AEQ A;  1PSR A;  1BOD A;  2AAO A;  1JC2 A;  1GGW A;  1LXF C;  4YGD B;  2JX8 A;  1SY9 A;  2LP3 A;  3CZ0 A;  4YBH B;  1PRW A;  1B4C A;  1I5H W;  4CFQ A;  2LCP A;  2WCF A;  4QIB A;  3SIA A;  3TDI A;  1OQP A;  2NCO A;  2K0J A;  1TOP A;  1C7W A;  1DEK A;  4A0U A;  3FSC A;  1CFD A;  1SCM C;  3NXA A;  3MCB B;  4MN0 A;  2LLU A;  1Y1U A;  1S5G Z;  1PVB A;  2JC2 A;  3IQQ A;  3OB2 B;  4YI8 A;  1J1E A;  4QJ5 B;  1L7Z A;  2BCX A;  2KBI A;  5B8I B;  1XFX O;  2BEC A;  2DWV A;  2XP6 A;  4REX A;  1NCY A;  2BCB A;  1WMV A;  2KYF A;  2ITK A;  1LA0 A;  1M39 A;  1RRO A;  4ICB A;  5PAL A;  2F2P A;  1FF1 A;  2KI6 D;  4XJK B;  3SG2 A;  1Y1X A;  5I2O A;  2XP7 A;  1M31 A;  1K9Q A;  2OS8 C;  1SL9 A;  3I5F B;  3R72 A;  1FLC A;  2JT3 A;  2LVV A;  2FJY A;  2EC6 B;  4PHJ A;  2KOT A;  1O6W A;  1CM1 A;  3WH0 A;  1JWD A;  1MUX A;  2XP5 A;  3LK0 A;  3EK7 A;  2YSI A;  1K8U A;  1RTP 1;  1S26 D;  2LVJ A;  3BUM B;  2BBM A;  3O4Y A;  1S5G Y;  4PE0 A;  2HQ8 A;  4PDZ A;  1CLL A;  3PLF B;  1EG3 A;  3JVT C;  1P28 A;  1TNP A;  5CSF A;  5FI6 A;  3VRQ A;  4AQJ A;  2F3Z A;  1Q80 A;  2LAJ A;  1TCF A;  3R1V A;  4DIR A;  5HL1 A;  3O78 A;  2FJU B;  2H61 A;  2ZRS A;  3S0D A;  2WND A;  2H8V A;  4GAO A;  4HRG A;  4NDC A;  1S36 A;  2WAD A;  1DJX A;  3K1E A;  3FSB A;  2QEO A;  3R1P A;  1TNX A;  3TS5 B;  2XP4 A;  5ER5 A;  1F4Q A;  1QLS A;  2KLE A;  2Q4U A;  4U8D A;  1OOH A;  1K95 A;  1PUL A;  4WQ3 A;  3KHE A;  2I7A A;  3PJI A;  5U47 A;  2L50 A;  1IKU A;  5AAN A;  3BQ3 A;  1JBA A;  4KYN A;  3D76 A;  2TN4 A;  1WLM A;  4PHM A;  1REC A;  3B6X A;  1W9Z A;  1F4O A;  1B8R A;  1MQ1 A;  2ZAJ A;  1JFJ A;  4C0L A;  4MZJ A;  1CFP A;  1JF2 A;  2KAV A;  5KU1 A;  4OR9 B;  3I5F C;  3RM1 A;  4MBE A;  2LMT A;  2EC6 C;  1K9R A;  5IBW A;  2L4I A;  1EXR A;  1KFU S;  2L5Y A;  2F33 A;  3TUY B;  1GM0 A;  5E64 A;  2KQ6 A;  2XPA A;  1A75 A;  3Q8I A;  2COL B;  1JSA A;  2PMY A;  2K7C A;  3CR4 X;  1MHO A;  3BOW B;  4MRY A;  5HKY A;  1F55 A;  3OOB A;  1CLB A;  1TRF A;  2JXC A;  1CFF A;  4INX A;  2CTN A;  1SK6 D;  1IGV A;  2KI4 B;  1XFY O;  3PM8 A;  2BA1 A;  3CZT X;  2OWO A;  1Y0V H;  5DKN A;  1CTR A;  1SPY A;  2CCM A;  2QEV A;  2P70 A;  1PAL A;  3TS5 C;  2MA2 A;  3TC5 A;  2CT9 A;  3I5G B;  2JUL A;  5I2Q A;  5JJG A;  1J7R A;  3FS8 A;  4C0K A;  1BT6 A;  1IRJ A;  2LNK A;  2WCL A;  1DJY A;  5I8N A;  3S0G A;  2YSB A;  3I5H B;  1UWO A;  3D73 A;  1QVI Z;  3DXL A;  3PSR A;  2DK7 A;  1SBJ A;  4OVN F;  1K2H A;  2ZRT A;  1XA5 A;  2KFG A;  1KFU L;  1AVS A;  1F8H A;  1D1O A;  3GK2 A;  1TNQ A;  1KK8 B;  2FCE A;  1M46 A;  2JMF A;  4E5R A;  2ZR4 A;  1QAS A;  2KLD A;  1HQV A;  2JU0 A;  4OKH A;  5J3X A;  3B88 A;  1Z2C B;  2KSP A;  2JWW A;  2QPT A;  4A0T A;  3BXK A;  4IL1 A;  5CSJ A;  3TUY C;  1OOI X;  1YX8 A;  2WAE A;  1W7J B;  2SAS A;  2LUC A;  3B7A A;  1CKK A;  3OP0 A;  5E66 A;  1QTX A;  2ZR6 A;  5D3O A;  5E62 A;  3DVE A;  4QJ4 B;  2BAP A;  1AUI B;  1WRZ A;  1UHN A;  2CNP A;  1UUR A;  3RZS A;  2KI4 C;  4MZL A;  3SG4 A;  3F45 A;  1S6C A;  1CMF A;  1DJZ A;  4GLX A;  1F70 A;  3KAG A;  3DVJ A;  3SS4 A;  2JT0 A;  1J1D A;  1SKT A;  3AAJ A;  3JVT B;  1XK4 A;  1VRK A;  3VRO A;  2M3O W;  2IS9 A;  4Q04 A;  1FI6 A;  3I5G C;  1MR8 A;  1SR6 C;  1YUT A;  2P71 A;  2I18 A;  3OX6 A;  4WRI A;  4M2O A;  1F8A B;  3BUX B;  1DQE A;  3BUW B;  3M85 A;  4YGA A;  1ALW A;  2FOT A;  5K89 A;  1JUO A;  1XFV O;  1WRL A;  3CS1 A;  1TN4 A;  2KQY A;  1QXP A;  1PK0 D;  3I5H C;  2A4J A;  1B7T Y;  1TNW A;  2LLT A;  2Y1M A;  2AUC A;  4QJ3 B;  1PVA A;  2WOR A;  3A4U B;  3KPX A;  1NX3 A;  1GGZ A;  4ZCU A;  1TR8 A;  2YSG A;  1KK8 C;  3I5I B;  4IJ7 A;  2LE9 B;  4MZK A;  4PCW A;  2KFH A;  3NSL A;  2DK1 A;  1ODB A;  2BL0 C;  2KAX A;  1TWO A;  3TDB A;  1A29 A;  2JPT A;  4N5X A;  2NCP A;  1KSM A;  4E68 A;  2WCM A;  1OZO A;  2KAY A;  5D7F A;  3D10 A;  4MRX A;  3TCZ A;  4PHK A;  2QRV A;  1RP5 A;  2ZR5 A;  3SS5 A;  2G9B A;  2LUX A;  1IJ5 A;  3KAD A;  1NYA A;  1CDM A;  1KQM B;  1B1G A;  2WC8 A;  2KGR A;  3LK1 A;  1KQV A;  2DMV A;  1G8I A;  1EH2 A;  1NX0 A;  2JTZ A;  2I2R E;  3QME A;  2EHB A;  1LIN A;  4YGE B;  1CDN A;  1UP5 A;  3GOF A;  2ZN8 A;  3OX5 A;  5HKW A;  3N7H A;  1FW4 A;  4TNC A;  2JNX A;  2M8I A;  1CDL A;  1YTZ C;  1JFK A;  2GGZ A;  3SG3 A;  3KO0 A;  1QLK A;  3ZWH A;  1PSB A;  1ZMZ A;  2LVI A;  1SW8 A;  1TUZ A;  3DF0 A;  3NSI A;  4MSP A;  2P6B B;  1AHR A;  1BLQ A;  1KFX S;  2WCH A;  3IQO A;  4D1E A;  3RLZ A;  3FWC A;  3EVR A;  2ERB A;  2LHI A;  2K60 A;  2KPH A;  2LLS A;  5CSN A;  1C3Z A;  4BY5 A;  5AXI A;  1FBV A;  1SCV A;  1UHI A;  3NGV A;  1RFJ A;  1KCY A;  1PIN A;  2B1U A;  3I5I C;  5HKZ A;  1NSH A;  3DY9 A;  3E3R A;  3GK1 A;  4AOM A;  1K93 D;  3KAH A;  2BKI B;  1DF0 A;  4GUK A;  2JXW A;  1YRT B;  2VRG A;  4GGF A;  3WHT B;  3TDU A;  3M0W A;  2JPO A;  3BUO B;  2JQ6 A;  2MLF C;  1IG5 A;  1XFR A;  2LP2 A;  1BU3 A;  3NSK A;  4A4C A;  1CNP A;  1IH0 A;  1S6I A;  3C1V A;  1NUB A;  1QIW A;  1WY9 A;  2NZ0 A;  4CID A;  1DJH A;  3DZT A;  2ZFD A;  5AHT A;  2WC6 A;  2QDI A;  3L4H A;  2YSF A;  2Q91 A;  1YR5 A;  3LL8 B;  1TUJ A;  3WNX B;  1GJY A;  1KQM C;  4FQT A;  2RE3 A;  3CYZ A;  1KSO A;  4BY4 A;  2L98 A;  2EZ5 W;  1U5I A;  3K21 A;  2E6W A;  1H8B A;  3LE4 A;  5CQ2 A;  2BNX A;  2M0R A;  2LAN A;  4JWQ A;  2ZQU A;  2BBN A;  1S3P A;  3CTN A;  3L4A A;  3VRP A;  3A8R A;  1M63 B;  3QRX A;  3L47 A;  4YI9 A;  1AP4 A;  1IQ3 A;  1B8L A;  1J7O A;  2M8J A;  3MQH A;  3MCB A;  2I94 A;  3D74 A;  1QX2 A;  3UO9 A;  2PVB A;  2OTG B;  2FCD A;  2M9G A;  3D75 A;  2WCE A;  1MXL C;  1A2X A;  4GGN A;  1SR6 B;  4CLN A;  4NDD A;  2JXL A;  1T14 A;  2ZND A;  2ZKM X;  4XJK A;  4CPV A;  3GK4 X;  2ISD A;  3S0B A;  1ZAC A;  1NPQ A;  4INW A;  1TCO B;  1K94 A;  5EL2 A;  2L4H A;  3D0Y A;  2JV4 A;  4A4B A;  3OBV A;  2KXQ A;  2HF5 A;  2L4J A;  2KYC A;  4DUQ A;  1ORG A;  2HQW A;  2ZN9 A;  2GV5 A;  4ZCV A;  3EVU A;  4N1G A;  1CB1 A;  1KK7 Z;  2CBL A;  1ZFS A;  2M1U A;  1KWO B;  3VRR A;  2LAP A;  2K7B A;  2KI6 C;  3FE8 A;  1YUS A;  3EVV A;  1XVJ A;  2BL0 B;  4PAL A;  5DKQ A;  2R2I A;  1TTX A;  1QJT A;  3OGN A;  1HT9 A;  2KFF A;  2ZNE A;  5HLV A;  1JMQ A;  3ODK A;  1QVI Y;  2E30 A;  2CXJ A;  2WCJ A;  3JTD C;  1N2D A;  4DS7 A;  1UHJ A;  1C3Y A;  1YRU B;  3AKA A;  1XK4 C;  4OZD A;  1F71 A;  1OOF A;  3OB1 B;  2K7D A;  2SCP A;  1YUR A;  3IF7 A;  4HSZ A;  4ORC B;  3VRN A;  3WHU B;  2QAC A;  3AKB A;  1TIZ A;  4JD9 A;  1K9K A;  4YRU A;  2OTG C;  3DF0 B;  3PN7 C;  1NIW A;  1N65 A;  4MVF A;  1OOG A;  1AJ4 A;  1QAT A;  4GPL B;  3LCP C;  1LKJ A;  4DRW A;  3LKX A;  4FQO A;  2K7O A;  1UUS A;  1K9U A;  3CWG A;  3SJS A;  4PE7 A;  2LMV A;  1B8C A;  2F8P A;  3LLE A;  5G08 A;  3SG6 A;  2OPO A;  1H4B A;  1CMG A;  1J55 A;  1X02 A;  3CDN A;  1OOJ A;  5DKR A;  1A03 A;  3BJH A;  5DIC A;  4HRH A;  4M2Q A;  1A4P A;  1RK9 A;  2M8U A;  3FS7 A;  4MEW A;  5D69 A;  1RWY A;  3TDZ A;  1OE9 B;  2L2C A;  2WCK A;  3EK8 A;  3M7N A;  1CM4 A;  1KWO C;  3S0F A;  2NXQ A;  4WQ2 A;  2LC5 A;  2Y4Q A;  1DEL A;  1G4Y R;  1RJV A;  1ZCN A;  1DGU A;  4GBA A;  3DYE A;  4JKT A;  2F2O A;  2ZQT A;  2WOS A;  4USL A;  4U85 A;  1A75 B;  4L9M A;  2O5G A;  2MDI A;  1U5I B;  3CZ2 A;  1QWV A;  2JZI A;  4MLW A;  3CNG A;  3DVM A;  3SIB A;  2Y5I A;  5F6T A;  3S0A A;  1L2O B;  2BE4 A;  2Q5A A;  3V2L A;  2MAZ A;  2MHH A;  3KCE A;  5FI7 A;  1F54 A;  3CAB A;  2XP8 A;  1YW5 A;  2H61 C;  2HPS A;  2M7L A;  1QV0 A;  2PRU A;  3DVK A;  1R6P A;  1YX7 A;  3PAL A;  3FE9 A;  1TK7 A;  2H2K A;  3CR2 A;  3MQG A;  1DTL A;  4U86 A;  5KSZ A;  4AQI A;  4GNK B;  3SG7 A;  1CLM A;  3UNW A;  1BOC A;  2KDH A;  1B47 A;  2KNE A;  3DD4 A;  4DCK A;  1NMV A;  3O2P A;  2M3W A;  1OMV A;  1EL4 A;  1CDP A;  4ORB B;  5HLO A;  2XP3 A;  3KEV A;  4P5O E;  5JOL A;  4CFR A;  1AK8 A;  2M49 B;  3FIA A;  3D0Y B;  1YVL A;  2DJY A;  4OCI A;  3AAK A;  1UHH A;  3B86 A;  2ZQS A;  1GQM A;  4GGF C;  4N1F A;  2MJW B;  1C07 A;  3EKJ A;  3L4L A;  2QEH A;  1SMG A;  1QX7 A;  3BFB A;  1FI5 A;  1IIO A;  1OMR A;  1AJ5 A;  1W7I B;  2Y8N B;  2JNF A;  1CFC A;  1K9P A;  1NX1 A;  1SRA A;  2K2F A;  1SYM A;  1XFZ O;  1WDC B;  2PQL A;  3D77 A;  3OHM B;  3CZ1 A;  1DGV A;  2BCA A;  2LHL A;  1R2U A;  2L2E A;  1G33 A;  1V1F A;  4GFT A;  2WC5 A;  5FYX A;  5AER A;  5FI2 A;  4PE1 A;  2JT8 A;  4XYN A;  2JRF A;  1E8A A;  1L2O C;  1LVC D;  2O60 A;  2F3Y A;  3H4S E;  2RGI A;  1DMO A;  2WCB A;  2Y1N A;  1KFX L;  1B9A A;  3R1O A;  4JQ0 D;  4M2P A;  4ORA B;  3JTD B;  1NWD A;  4JPZ B;  4YGB B;  1XFU O;  2MLE C;  1SNL A;  2KGB C;  2M1K B;  2YSH A;  1LS8 A;  2G2B A;  1M45 A;  1J7Q A; 
#chains in the Genus database with same CATH homology
 3TZ1 A;  2XPB A;  3LKX B;  2D8N A;  2E45 A;  3KAI A;  1UHK A;  3PFV A;  4UPG A;  3FWB A;  5AFP A;  1BR1 B;  2ZQV A;  3PN7 B;  3KF9 A;  5E5W A;  1BJF A;  2JOJ A;  1C7V A;  1SL8 A;  2MRD A;  2M29 A;  1DVI A;  2MBX A;  2NLN A;  4C0J A;  1MWN A;  1N0Y A;  1XYD A;  4I5N B;  1MF8 B;  4YGC B;  3BUN B;  4U84 A;  2LM5 A;  1XO5 A;  4R1E A;  4P2Y B;  3O6B A;  3HCM A;  3PAT A;  1EG4 A;  1FPW A;  1IWQ A;  2PAS A;  1V1G A;  1SL7 A;  2LVK A;  3CLN A;  2LMU A;  2V53 A;  3SG5 A;  3EK4 A;  5CPV A;  1NX2 A;  2K2A A;  1WDC C;  2L0P A;  4PHN A;  1DJI A;  2JTT A;  2YAJ B;  4FTG A;  5BPJ A;  1NP8 A;  5HYD A;  2L5X B;  1IQ5 A;  1Y1A A;  5I2L A;  2M7N A;  4PE4 A;  1QX5 B;  2KHN A;  3VGO A;  2K61 A;  2L51 A;  5TNC A;  1DT7 B;  1DJG A;  4I5J A;  3BYA A;  2XP9 A;  5ER4 X;  1YVH A;  2M97 A;  1OSA A;  1WLZ A;  1QIV A;  2GGM A;  4F0Z B;  2AMI A;  1S6J A;  1WRK A;  2HET A;  4NQG A;  1ALV A;  1QV1 A;  2BKH B;  1KK7 Y;  3EKH A;  1QS7 A;  1LA3 A;  3WXA A;  4HRE E;  1SCM B;  2F21 A;  2K8M B;  2PAL A;  3PQH A;  2PSR A;  2DOQ A;  1OZS A;  1K96 A;  2EGD A;  1DJW A;  4NDB A;  4I5L B;  3NTP A;  3HX4 A;  1NCX A;  5CSI A;  2BE6 A;  5E65 A;  1BG1 A;  1NCZ A;  2OS8 B;  1WR7 A;  1JF0 A;  1MXE A;  1Y6W A;  3KAB A;  2KBM A;  1BR4 B;  1S1E A;  1ZUZ A;  1YUU A;  1DF0 B;  3ZNI A;  3MSE B;  3CGA A;  1B7T Z;  3KAF A;  1EJ3 A;  3BOW A;  2LV7 A;  5KTY A;  1IJ6 A;  3CR5 X;  4ETO A;  1J7P A;  5GQQ C;  3NSO A;  1OMD A;  1K90 D;  1BF5 A;  1BMO A;  1ZOT B;  1XFW O;  3ICB A;  4I5K A;  4OV2 A;  5AEQ A;  1PSR A;  1BOD A;  2AAO A;  1JC2 A;  1GGW A;  1LXF C;  4YGD B;  2JX8 A;  1SY9 A;  2LP3 A;  4YBH B;  1PRW A;  1B4C A;  1I5H W;  4CFQ A;  2LCP A;  2WCF A;  4QIB A;  3SIA A;  3TDI A;  1OQP A;  2NCO A;  2K0J A;  1TOP A;  1C7W A;  4A0U A;  3FSC A;  1CFD A;  1SCM C;  3NXA A;  3MCB B;  4MN0 A;  2LLU A;  1Y1U A;  1S5G Z;  1PVB A;  2JC2 A;  3IQQ A;  3OB2 B;  4YI8 A;  1J1E A;  4QJ5 B;  1L7Z A;  2BCX A;  2KBI A;  5B8I B;  1XFX O;  2BEC A;  2DWV A;  2XP6 A;  4REX A;  1NCY A;  2BCB A;  1WMV A;  2KYF A;  2ITK A;  1LA0 A;  1M39 A;  1RRO A;  4ICB A;  5PAL A;  2F2P A;  1FF1 A;  2KI6 D;  4XJK B;  3SG2 A;  1Y1X A;  5I2O A;  2XP7 A;  1M31 A;  1K9Q A;  2OS8 C;  1SL9 A;  3I5F B;  1FLC A;  2JT3 A;  2LVV A;  2EC6 B;  4PHJ A;  2KOT A;  1O6W A;  1CM1 A;  3WH0 A;  1JWD A;  1MUX A;  2XP5 A;  3LK0 A;  3EK7 A;  2YSI A;  1K8U A;  1RTP 1;  1S26 D;  2LVJ A;  3BUM B;  2BBM A;  3O4Y A;  1S5G Y;  4PE0 A;  2HQ8 A;  4PDZ A;  1CLL A;  3PLF B;  1EG3 A;  3JVT C;  1TNP A;  5CSF A;  4AQJ A;  3VRQ A;  2F3Z A;  1Q80 A;  2LAJ A;  1TCF A;  4DIR A;  3O78 A;  2FJU B;  2H61 A;  2ZRS A;  2WND A;  4GAO A;  4HRG A;  4NDC A;  1S36 A;  2WAD A;  1DJX A;  3FSB A;  1TNX A;  3TS5 B;  2XP4 A;  5ER5 A;  1F4Q A;  1QLS A;  4U8D A;  2Q4U A;  1K95 A;  1PUL A;  4WQ3 A;  3KHE A;  2I7A A;  5U47 A;  2L50 A;  1IKU A;  5AAN A;  3BQ3 A;  1JBA A;  2TN4 A;  1WLM A;  4PHM A;  1REC A;  1F4O A;  1B8R A;  1MQ1 A;  2ZAJ A;  1JFJ A;  4C0L A;  4MZJ A;  1CFP A;  1JF2 A;  2KAV A;  5KU1 A;  4OR9 B;  3I5F C;  3RM1 A;  4MBE A;  2LMT A;  2EC6 C;  1K9R A;  5IBW A;  2L4I A;  1EXR A;  1KFU S;  2F33 A;  3TUY B;  5E64 A;  2KQ6 A;  2XPA A;  1A75 A;  2COL B;  1JSA A;  2PMY A;  2K7C A;  3CR4 X;  1MHO A;  3BOW B;  4MRY A;  5HKY A;  1F55 A;  3OOB A;  1CLB A;  1TRF A;  2JXC A;  1CFF A;  2CTN A;  1SK6 D;  1IGV A;  2KI4 B;  1XFY O;  3PM8 A;  2BA1 A;  3CZT X;  2OWO A;  1Y0V H;  5DKN A;  1CTR A;  1SPY A;  2CCM A;  1PAL A;  3TS5 C;  2MA2 A;  3TC5 A;  2CT9 A;  3I5G B;  2JUL A;  5I2Q A;  5JJG A;  1J7R A;  3FS8 A;  4C0K A;  1BT6 A;  1IRJ A;  2LNK A;  1DJY A;  2YSB A;  3I5H B;  1UWO A;  1QVI Z;  2DK7 A;  3PSR A;  1SBJ A;  4OVN F;  1K2H A;  2ZRT A;  1XA5 A;  2KFG A;  1KFU L;  1AVS A;  1F8H A;  1D1O A;  3GK2 A;  1TNQ A;  1KK8 B;  2FCE A;  1M46 A;  2JMF A;  4E5R A;  2ZR4 A;  1QAS A;  1HQV A;  2JU0 A;  4OKH A;  5J3X A;  2KSP A;  4A0T A;  2JWW A;  2QPT A;  3BXK A;  4IL1 A;  5CSJ A;  3TUY C;  1YX8 A;  2WAE A;  1W7J B;  2SAS A;  2LUC A;  1CKK A;  3OP0 A;  5E66 A;  1QTX A;  2ZR6 A;  5E62 A;  3DVE A;  4QJ4 B;  1AUI B;  1WRZ A;  1UHN A;  2CNP A;  1UUR A;  2KI4 C;  4MZL A;  3SG4 A;  3F45 A;  1S6C A;  1CMF A;  1DJZ A;  4GLX A;  1F70 A;  3KAG A;  3DVJ A;  2JT0 A;  1J1D A;  1SKT A;  3AAJ A;  3JVT B;  1XK4 A;  1VRK A;  3VRO A;  2M3O W;  2IS9 A;  4Q04 A;  1FI6 A;  3I5G C;  1MR8 A;  1SR6 C;  1YUT A;  3OX6 A;  2I18 A;  1F8A B;  4WRI A;  4M2O A;  3BUX B;  3BUW B;  3M85 A;  4YGA A;  1ALW A;  2FOT A;  5K89 A;  1JUO A;  1XFV O;  1WRL A;  3CS1 A;  1TN4 A;  2KQY A;  1QXP A;  1PK0 D;  3I5H C;  2A4J A;  1B7T Y;  1TNW A;  2LLT A;  2Y1M A;  2AUC A;  4QJ3 B;  1PVA A;  2WOR A;  3A4U B;  3KPX A;  1NX3 A;  1GGZ A;  4ZCU A;  1TR8 A;  2YSG A;  1KK8 C;  3I5I B;  4MZK A;  2LE9 B;  4PCW A;  2KFH A;  3NSL A;  2DK1 A;  1ODB A;  2BL0 C;  2KAX A;  3TDB A;  1A29 A;  2JPT A;  4N5X A;  2NCP A;  1KSM A;  4E68 A;  1OZO A;  2KAY A;  5D7F A;  3D10 A;  4MRX A;  3TCZ A;  4PHK A;  2QRV A;  1RP5 A;  2ZR5 A;  2G9B A;  2LUX A;  1IJ5 A;  3KAD A;  1NYA A;  1CDM A;  1KQM B;  1B1G A;  2WC8 A;  2KGR A;  3LK1 A;  1KQV A;  2DMV A;  1G8I A;  1EH2 A;  1NX0 A;  2JTZ A;  2I2R E;  2EHB A;  1LIN A;  4YGE B;  1CDN A;  1UP5 A;  3GOF A;  2ZN8 A;  3OX5 A;  5HKW A;  1FW4 A;  4TNC A;  2JNX A;  2M8I A;  1CDL A;  1YTZ C;  1JFK A;  2GGZ A;  3SG3 A;  3KO0 A;  1QLK A;  3ZWH A;  1PSB A;  1ZMZ A;  2LVI A;  1SW8 A;  3DF0 A;  3NSI A;  4MSP A;  2JV4 A;  2P6B B;  1AHR A;  1BLQ A;  1KFX S;  3IQO A;  4D1E A;  3RLZ A;  3FWC A;  3EVR A;  5CSN A;  2LHI A;  5I8N A;  2LLS A;  4BY5 A;  5AXI A;  1FBV A;  1SCV A;  1UHI A;  1RFJ A;  1KCY A;  1PIN A;  2B1U A;  3I5I C;  5HKZ A;  1NSH A;  3E3R A;  3GK1 A;  4AOM A;  1K93 D;  3KAH A;  2BKI B;  1DF0 A;  4GUK A;  2JXW A;  1YRT B;  2VRG A;  4GGF A;  3WHT B;  3TDU A;  3M0W A;  3BUO B;  2JQ6 A;  2MLF C;  1IG5 A;  2LP2 A;  3NSK A;  1BU3 A;  4A4C A;  1CNP A;  1IH0 A;  1S6I A;  3C1V A;  1NUB A;  1QIW A;  1WY9 A;  2NZ0 A;  4CID A;  1DJH A;  2ZFD A;  5AHT A;  3L4H A;  2YSF A;  2Q91 A;  1YR5 A;  3LL8 B;  3WNX B;  1GJY A;  1KQM C;  2RE3 A;  1KSO A;  4BY4 A;  2L98 A;  2EZ5 W;  1U5I A;  3K21 A;  2E6W A;  1H8B A;  3LE4 A;  2M0R A;  2LAN A;  4JWQ A;  2ZQU A;  2BBN A;  1S3P A;  3CTN A;  3VRP A;  3A8R A;  1M63 B;  3QRX A;  1IQ3 A;  4YI9 A;  1AP4 A;  2M8J A;  1B8L A;  1J7O A;  3MQH A;  3MCB A;  2I94 A;  1QX2 A;  2PVB A;  2OTG B;  2FCD A;  2M9G A;  2WCE A;  1MXL C;  1A2X A;  4GGN A;  1SR6 B;  4CLN A;  4NDD A;  2JXL A;  2ZND A;  2ZKM X;  4XJK A;  4CPV A;  3GK4 X;  2ISD A;  1ZAC A;  1NPQ A;  1TCO B;  1K94 A;  2L4H A;  3D0Y A;  2KXQ A;  4A4B A;  2L4J A;  2HF5 A;  2KYC A;  4DUQ A;  2HQW A;  2ZN9 A;  2GV5 A;  4ZCV A;  3EVU A;  4N1G A;  1CB1 A;  1KK7 Z;  2CBL A;  1ZFS A;  2M1U A;  1KWO B;  3VRR A;  2LAP A;  2K7B A;  2KI6 C;  4PAL A;  1YUS A;  3EVV A;  2BL0 B;  1XVJ A;  5DKQ A;  2R2I A;  1TTX A;  1QJT A;  1HT9 A;  2KFF A;  2ZNE A;  5HLV A;  1JMQ A;  3ODK A;  1QVI Y;  2E30 A;  2CXJ A;  3JTD C;  1N2D A;  4DS7 A;  1UHJ A;  1YRU B;  3AKA A;  1XK4 C;  1F71 A;  3OB1 B;  2K7D A;  2SCP A;  1YUR A;  3IF7 A;  4HSZ A;  4ORC B;  3VRN A;  3WHU B;  2QAC A;  3AKB A;  1TIZ A;  1K9K A;  4YRU A;  2OTG C;  3DF0 B;  3PN7 C;  1NIW A;  1N65 A;  4MVF A;  1AJ4 A;  1QAT A;  4GPL B;  3LCP C;  1LKJ A;  4DRW A;  3LKX A;  4FQO A;  2K7O A;  1UUS A;  1K9U A;  3CWG A;  3SJS A;  4PE7 A;  2LMV A;  1B8C A;  2F8P A;  3LLE A;  5G08 A;  3SG6 A;  2OPO A;  1H4B A;  1CMG A;  1J55 A;  1X02 A;  1OOJ A;  5DKR A;  1A03 A;  4HRH A;  4M2Q A;  1A4P A;  1RK9 A;  2M8U A;  3FS7 A;  4MEW A;  5D69 A;  1RWY A;  3TDZ A;  1OE9 B;  3EK8 A;  3M7N A;  1CM4 A;  1KWO C;  2NXQ A;  4WQ2 A;  2LC5 A;  2Y4Q A;  1G4Y R;  1RJV A;  1ZCN A;  1DGU A;  4GBA A;  2F2O A;  2ZQT A;  2WOS A;  4USL A;  4U85 A;  1A75 B;  4L9M A;  2O5G A;  2MDI A;  1U5I B;  3CNG A;  5CQ2 A;  2JZI A;  4MLW A;  3DVM A;  3SIB A;  2Y5I A;  5F6T A;  1L2O B;  2BE4 A;  2Q5A A;  2MAZ A;  2MHH A;  3KCE A;  1F54 A;  2XP8 A;  1YW5 A;  2H61 C;  2HPS A;  2M7L A;  1QV0 A;  2PRU A;  3DVK A;  1R6P A;  1YX7 A;  3PAL A;  1TK7 A;  2H2K A;  3CR2 A;  3MQG A;  1DTL A;  4U86 A;  5KSZ A;  4AQI A;  4GNK B;  3SG7 A;  1CLM A;  1BOC A;  2KDH A;  1B47 A;  2KNE A;  3DD4 A;  4DCK A;  1NMV A;  3O2P A;  2M3W A;  1OMV A;  1EL4 A;  1CDP A;  4ORB B;  5HLO A;  2XP3 A;  3KEV A;  4P5O E;  5JOL A;  4CFR A;  1AK8 A;  2M49 B;  3FIA A;  3D0Y B;  1YVL A;  2DJY A;  4OCI A;  3AAK A;  1UHH A;  2ZQS A;  1GQM A;  4GGF C;  4N1F A;  2MJW B;  1C07 A;  3EKJ A;  1SMG A;  1QX7 A;  1FI5 A;  1OMR A;  1AJ5 A;  1W7I B;  2Y8N B;  2JNF A;  1CFC A;  1K9P A;  1NX1 A;  1SRA A;  2K2F A;  1SYM A;  1XFZ O;  1WDC B;  3OHM B;  1DGV A;  2BCA A;  2LHL A;  1R2U A;  2L2E A;  1G33 A;  1V1F A;  4GFT A;  5FYX A;  5AER A;  4PE1 A;  2JT8 A;  4XYN A;  2JRF A;  1E8A A;  1L2O C;  1LVC D;  2O60 A;  2F3Y A;  3H4S E;  2RGI A;  1DMO A;  2WCB A;  2Y1N A;  1KFX L;  1B9A A;  4JQ0 D;  4M2P A;  4ORA B;  3JTD B;  1NWD A;  4JPZ B;  4YGB B;  1XFU O;  2MLE C;  1SNL A;  2KGB C;  2M1K B;  2YSH A;  2G2B A;  1M45 A;  1J7Q A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...