1EG3A

Structure of a dystrophin ww domain fragment in complex with a beta-dystroglycan peptide
Total Genus 98
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
98
sequence length
260
structure length
260
Chain Sequence
PASQHFLSTSVQGPWERAISPNKVPYYINHETQTTCWDHPKMTELYQSLADLNNVRFSAYRTAMKLRRLQKALCLDLLSLSAACDALDQHNLKQNDQPMDILQIINCLTTIYDRLEQEHNNLVNVPLCVDMCLNWLLNVYDTGRTGRIRVLSFKTGIISLCKAHLEDKYRYLFKQVASSTGFCDQRRLGLLLHDSIQIPRQLGEVASFGGSNIEPSVRSCFQFANNKPEIEAALFLDWMRLEPQSMVWLPVLHRVAAAET
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DYSTROPHIN
publication title Structure of a WW domain containing fragment of dystrophin in complex with beta-dystroglycan.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Structural protein
total genus 98
structure length 260
sequence length 260
ec nomenclature
pdb deposition date 2000-02-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00397 WW WW domain
A PF09068 EF-hand_2 EF hand
A PF09069 EF-hand_3 EF-hand
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 1eg3A03
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 1eg3A04
2.20.70.10 Mainly Beta Single Sheet Ubiquitin Ligase Nedd4; Chain: W; Ubiquitin Ligase Nedd4; Chain: W; 1eg3A01
1RWYA 2LAPA 2H61C 5ER4X 1AUIB 2KFFA 1ALVA 2JULA 4I5JA 1XK4A 2LHLA 3I5HC 4ZCUA 2CT9A 1IH0A 1KCYA 2JZIA 1AJ4A 4NQGA 2LCPA 1H4BA 2LVVA 4F0ZB 1BJFA 1CMGA 2LAJA 2QACA 2PRUA 4A4BA 4P5OE 3OB2B 2M8JA 4JPZB 3CR2A 2JX8A 1QATA 2XP5A 4MZJA 1U5IB 2M7LA 1CM1A 5JOLA 1X02A 2MDIA 1NIWA 1A4PA 1J7OA 1CM4A 2BE4A 2WORA 2QPTA 3EVRA 2JU0A 2OS8C 3LK0A 1B8CA 2GV5A 1G33A 1PSRA 4ZCVA 2RE3A 5I2LA 1S6JA 1WMVA 3HCMA 1SRAA 1S6IA 1F55A 2HPSA 1QTXA 2M9GA 4P2YB 1TTXA 2ZRSA 3DVEA 2MHHA 2JWWA 4DS7A 1K96A 1SPYA 2XP9A 2BCXA 1NCZA 5DKNA 5I2OA 2HQ8A 1D1OA 2EC6B 3GK2A 3M7NA 2JMFA 3TS5B 1PVBA 2PALA 1DJZA 4YI8A 1SL9A 3OP0A 1J1EA 5DKRA 4GGFC 3KHEA 3JVTB 1W7JB 1TNPA 3PN7C 1B1GA 1K9KA 2DK1A 3JTDB 1F8AB 2CXJA 3VRRA 5HKZA 2PMYA 3A8RA 4QJ3B 1NPQA 1JFKA 2LVKA 2WCBA 1ZCNA 2XPAA 3DD4A 1YUTA 1C07A 3SG6A 4OKHA 1YUUA 4AOMA 1XFVO 1KFXS 1F71A 2JT3A 4WQ2A 1AJ5A 4YGDB 1GQMA 2KAYA 3AAJA 2LP2A 2JT8A 1CFFA 1DGUA 3TDBA 4PE4A 5DKQA 2LP3A 2Y1MA 1UUSA 1J7RA 1TCFA 4I5LB 1IRJA 1YX8A 2M0RA 1RROA 4YI9A 4MVFA 1O6WA 1KK7Y 1QS7A 4FQOA 1EG4A 1L2OC 1DJHA 2KXQA 1EXRA 2KAXA 2MAZA 3TS5C 1R6PA 1YX7A 5B8IB 2F2PA 3OHMB 3TZ1A 1UURA 3JVTC 1AK8A 1SMGA 1DF0B 4NDCA 1YURA 3EKJA 4GAOA 4U86A 2K7OA 1UHJA 3JTDC 4XJKA 5BPJA 3TCZA 5CSIA 4IL1A 5HYDA 1QLKA 2KBIA 4ICBA 1ALWA 1KWOB 2MRDA 1B47A 3SIAA 2MA2A 3C1VA 3O4YA 2LHIA 1CB1A 1LVCD 1DVIA 4YRUA 2LV7A 3IF7A 1IJ6A 1KSMA 1KSOA 3AKBA 3NSKA 1M45A 5K89A 2ZR4A 1NX3A 1J7QA 4TNCA 1ZFSA 1XYDA 1W7IB 5PALA 2NCPA 3KAFA 3OB1B 1IGVA 1RFJA 2KI6D 1YUSA 2VRGA 3NTPA 2CNPA 2KI4B 1M31A 3PALA 2KI6C 1DGVA 4MZLA 1YVLA 3DVJA 5G08A 1TCOB 1B9AA 1E8AA 1UHHA 1WLMA 5CSNA 1B4CA 2M8IA 2ZAJA 4YGEB 1Q80A 1MXLC 2XP8A 4WQ3A 3SG7A 2NLNA 2NXQA 3EK4A 1MXEA 3EKHA 1TOPA 4OVNF 1CNPA 2NZ0A 1DMOA 3WHUB 1RTP1 1ZOTB 1KWOC 1FBVA 1TRFA 3BUWB 5HKYA 1SKTA 2WC8A 2JOJA 2Y4QA 4MLWA 4CIDA 1QX7A 3EK7A 1CDPA 2E30A 1AP4A 2L4IA 3I5FC 3I5IB 3VGOA 1S5GZ 2DJYA 2ZQUA 1PRWA 3EVVA 2CTNA 2EZ5W 3KCEA 1Y0VH 1IG5A 1J7PA 1CDLA 1F70A 2M1UA 1CFDA 2JRFA 2JV4A 2XP6A 2KI4C 4DRWA 1Y1UA 1XVJA 3CS1A 4DIRA 3E3RA 1FI5A 3BUNB 1LA0A 1SYMA 2KBMA 4MN0A 1EG3A 1XFZO 3AAKA 2I7AA 1JWDA 4PHNA 2G9BA 2FOTA 1G4YR 4HRHA 1SNLA 1XK4C 3KPXA 2P6BB 1K9UA 1PALA 2Y5IA 3NXAA 1S5GY 2F33A 2KOTA 3FIAA 4AQIA 5ER5A 1OZOA 3WXAA 1F8HA 3PN7B 4M2OA 4MEWA 3KABA 1RJVA 2Q5AA 2JTTA 4QJ5B 1S6CA 3IQQA 4E5RA 1S3PA 1QV1A 1PINA 2DK7A 4HSZA 1GGWA 2DWVA 4DUQA 2ZQSA 1BG1A 2L2EA 4YBHB 3I5IC 2M7NA 1NMVA 1NSHA 1SW8A 4PHKA 3BOWB 1CTRA 4ORCB 5HKWA 2OTGB 3BXKA 4C0LA 1CMFA 2M97A 4MBEA 3PLFB 4GPLB 2K7BA 4GGNA 2YSHA 1UP5A 1CFPA 1KQVA 4NDBA 2AMIA 3D10A 1L2OB 1DJIA 3EVUA 4QIBA 3D0YA 5AHTA 1B8LA 4PHJA 3SG3A 4BY4A 2YSBA 2JT0A 2JTZA 3LK1A 4PALA 1NX2A 5AEQA 1RK9A 3GK1A 2JXLA 3CZTX 3CR4X 1BR4B 1WLZA 1AVSA 2MLFC 1IJ5A 1KK7Z 5CSFA 2KHNA 3K21A 4GUKA 4MSPA 1K8UA 1XA5A 2JPTA 1FF1A 2LLTA 3BUOB 1U5IA 4CPVA 2XP4A 2O5GA 1B7TZ 1OMVA 1IQ3A 1SY9A 2BKIB 2L98A 2OTGC 2BA1A 3GOFA 1QXPA 4YGCB 4PCWA 1BF5A 2JNFA 2ZNDA 5D7FA 1LKJA 3WHTB 1JBAA 2OPOA 1S26D 1XFUO 1ZUZA 2JXCA 2RGIA 1N65A 4OR9B 1DJWA 1C7VA 1K2HA 4N1FA 5I8NA 1NX0A 1IWQA 4N1GA 1B7TY 2ZNEA 3SIBA 2LUCA 5CSJA 2L50A 1NCXA 2JQ6A 2O60A 1MF8B 3IQOA 2D8NA 3ODKA 1CLLA 3PSRA 4Q04A 1KQMC 1QIWA 2KYFA 3CR5X 1N2DA 2ZRTA 2KFGA 2LLSA 1BOCA 3FWBA 1XFWO 3PFVA 3SG2A 2LNKA 2ZR5A 2ZN8A 1K93D 2K7DA 2PSRA 2EHBA 3BYAA 1HT9A 3I5FB 1BLQA 4N5XA 1YW5A 3TC5A 4L9MA 2TN4A 2HQWA 4PDZA 5FYXA 2JC2A 4PE1A 4QJ4B 1MQ1A 2E45A 2ZQTA 1MR8A 2KFHA 2EGDA 3OOBA 2ZKMX 2WCEA 4OCIA 3OX6A 1YVHA 4BY5A 2YSIA 1KFUS 1OMRA 3LE4A 1DJGA 1BU3A 1SL7A 2FJUB 4M2PA 1K9QA 1TK7A 5KTYA 1TN4A 1GJYA 2ZQVA 3KAIA 1ZMZA 2B1UA 2MJWB 1CDMA 4HRGA 4ORAB 3CNGA 2XPBA 1Y1XA 1YRTB 4MZKA 1F4QA 2F8PA 2ZFDA 3HX4A 5TNCA 2KDHA 5KSZA 4CFQA 3BQ3A 2KNEA 3M0WA 3KADA 1OQPA 1EH2A 1A03A 3SG4A 1PVAA 1YR5A 2BECA 1A75A 3DVMA 1ODBA 4UPGA 1OOJA 4GNKB 5F6TA 3KAGA 1J1DA 5KU1A 1BT6A 3BUMB 1R2UA 2PVBA 3CWGA 1K9RA 1JUOA 1JC2A 1A29A 1G8IA 3NSLA 4NDDA 4AQJA 1NX1A 3O2PA 1FW4A 2R2IA 3DF0A 1M39A 4DCKA 2BL0B 1WR7A 3KF9A 2Q91A 3L4HA 1AHRA 1OZSA 5CQ2A 2H61A 2L5XB 3D0YB 2LM5A 4U84A 3VROA 2M8UA 2JNXA 2CBLA 2COLB 3MSEB 3WH0A 2F2OA 1NWDA 1Y1AA 4C0JA 1UHIA 1KK8B 1SR6C 2K61A 1YRUB 5GQQC 2SCPA 3TDZA 1KFUL 2M29A 3CLNA 3GK4X 1MWNA 1SCMB 3AKAA 1MUXA 2KQ6A 3ZNIA 1OMDA 2KGBC 4I5NB 2ZN9A 2WNDA 2I94A 3TUYC 4A4CA 1WDCB 2M1KB 1Y6WA 1MHOA 3RM1A 1SCVA 1TNWA 2BL0C 3VRNA 1LINA 1PULA 3I5GC 1QJTA 2E6WA 2KSPA 5IBWA 2XP3A 1WY9A 1QASA 1B8RA 2K2FA 3BUXB 2DMVA 2HF5A 5J3XA 5I2QA 4PE7A 2ZR6A 2JXWA 2F3YA 1WRLA 5AANA 4PE0A 1BMOA 2WOSA 2LANA 4E68A 1K95A 2I18A 4ETOA 1KQMB 4C0KA 5AXIA 1SL8A 4CLNA 4XJKB 1H8BA 2MLEC 3VRQA 1KK8C 3CGAA 4GGFA 4I5KA 1FI6A 2AUCA 2HETA 1SK6D 1OSAA 3RLZA 1QV0A 1IKUA 1SCMC 2ISDA 1DTLA 2BBMA 3WNXB 2LVIA 2GGZA 1VRKA 1I5HW 2A4JA 1WDCC 3ZWHA 1A2XA 4GBAA 3KAHA 4D1EA 1WRZA 1BODA 1NUBA 1QX2A 2L51A 1K94A 2FCEA 2LMTA 3BOWA 3FS7A 1XFYO 1S1EA 1UHNA 5AERA 4JQ0D 1TNXA 2KAVA 2LC5A 4HREE 2Y1NA 1TIZA 2CCMA 4MRXA 1QIVA 2BKHB 1JFJA 1PSBA 1BR1B 2KGRA 3CTNA 2H2KA 3LCPC 2LUXA 1JMQA 2M49B 3NSIA 1DT7B 1IQ5A 1SBJA 2L4HA 3DVKA 4WRIA 5CPVA 1FPWA 2K0JA 3LLEA 2ITKA 3LL8B 3A4UB 2EC6C 5D69A 1NCYA 5HLOA 2GGMA 1QLSA 2FCDA 1CDNA 1JSAA 2YSFA 1CKKA 2YSGA 2IS9A 3PM8A 3H4SE 2PASA 4OV2A 2BCAA 2V53A 3PATA 2K2AA 3KEVA 1UWOA 1LA3A 1XO5A 1JF2A 4U85A 1DJYA 1ZACA 2DOQA 2AAOA 1A75B 1CLBA 3SG5A 2LE9B 1V1FA 3F45A 2LMUA 4FTGA 4M2QA 2L4JA 3M85A 4XYNA 1XFXO 3FWCA 1QVIZ 1DJXA 2LLUA 2MBXA 2LMVA 2BE6A 1K90D 2K8MB 1NP8A 3EK8A 1TNQA 3VRPA 2XP7A 1YTZC 2SASA 1HQVA 1CLMA 3DF0B 1OE9B 1L7ZA 4MRYA 5HLVA 2BBNA 2KYCA 2NCOA 5JJGA 1CFCA 1C7WA 1F54A 3TDUA 1DF0A 2F3ZA 1LXFC 3I5HB 1GGZA 2LVJA 2Q4UA 1QVIY 1NYAA 3QRXA 1SR6B 4JWQA 1UHKA 1V1GA 1EJ3A 4USLA 4YGAA 1S36A 1M46A 1RECA 4U8DA 2KQYA 2K7CA 1K9PA 1KFXL 3TUYB 4REXA 3O6BA 5AFPA 1J55A 3O78A 3OX5A 4ORBB 4R1EA 2M3OW 2WCFA 1EL4A 1N0YA 2M3WA 2I2RE 4PHMA 3I5GB 2BCBA 4YGBB 2F21A 4GFTA 2L0PA 1M63B 2OS8B 1PK0D 3NSOA 3TDIA 3ICBA 3SJSA 4CFRA 1F4OA 1WRKA 3KO0A 2G2BA 1JF0A 1QX5B
chains in the Genus database with same CATH superfamily
1RWYA 2LAPA 3S0BA 2H61C 5ER4X 1AUIB 2KFFA 1ALVA 2JULA 4I5JA 1XK4A 5FI7A 2LHLA 3I5HC 4ZCUA 2CT9A 1IH0A 1FLCA 1KCYA 2JZIA 1AJ4A 4NQGA 2LCPA 3PJIA 1H4BA 2LVVA 5EL2A 4F0ZB 1BJFA 1CMGA 2LAJA 2QACA 2PRUA 4A4BA 4P5OE 3OB2B 2M8JA 3DZTA 3CR2A 4JPZB 1QATA 2JX8A 2XP5A 4MZJA 1U5IB 3BFAA 2M7LA 1CM1A 5JOLA 1X02A 2MDIA 1NIWA 1A4PA 1J7OA 3UO9A 3O4XA 1CM4A 2BE4A 2BNXA 2WORA 3R1OA 2QPTA 3EVRA 2JU0A 3BJHA 1T14A 2OS8C 3LK0A 4PT1A 1B8CA 2GV5A 2WAEA 1G33A 1PSRA 4ZCVA 4F7FA 2RE3A 3OGNA 5I2LA 1S6JA 1WMVA 3HCMA 1SRAA 1S6IA 1F55A 2HPSA 1QTXA 2OWOA 2M9GA 4P2YB 4A0UA 1DQEA 1TTXA 2ZRSA 3DVEA 2MHHA 2JWWA 4DS7A 1K96A 1SPYA 2XP9A 1DELA 2BCXA 1NCZA 5DKNA 5I2OA 2HQ8A 1D1OA 5U47A 2EC6B 3GK2A 5E62A 3M7NA 2JMFA 3FSBA 3TS5B 1PVBA 2PALA 1DJZA 4YI8A 1SL9A 3OP0A 5DICA 1J1EA 5DKRA 4GGFC 5E5WA 3KHEA 3JVTB 3UNWA 1W7JB 1TNPA 3PN7C 1B1GA 1W9ZA 1K9KA 2DK1A 3JTDB 1F8AB 1OOHA 2CXJA 3VRRA 5HKZA 2PMYA 3A8RA 3D78A 4QJ3B 1NPQA 1JFKA 2LVKA 2WCBA 1ZCNA 2XPAA 3DD4A 1YUTA 3D74A 3L4LA 3SG6A 1C07A 4OKHA 1YUUA 4AOMA 1XFVO 1KFXS 1F71A 2JT3A 4WQ2A 1AJ5A 2WADA 4YGDB 1GQMA 2KAYA 3AAJA 2LP2A 3FE9A 2JT8A 4JKTA 1CFFA 1DGUA 3TDBA 4PE4A 5DKQA 2LP3A 2QEOA 1UUSA 2Y1MA 1J7RA 1TCFA 4I5LB 1GM0A 1IRJA 1YX8A 2YAJB 2M0RA 1RROA 4YI9A 3K1EA 3SS5A 4MVFA 2GTEA 1KK7Y 2QEVA 1O6WA 1QS7A 4FQOA 1EG4A 1L2OC 1DJHA 3CZ1A 1EXRA 2KAXA 2MAZA 2KXQA 3TS5C 1R6PA 1YX7A 5B8IB 2F2PA 3OHMB 3TZ1A 1QWVA 1UURA 3JVTC 1AK8A 1SMGA 1DF0B 4NDCA 1YURA 3EKJA 5FI2A 4GAOA 4U86A 2K7OA 1UHJA 3JTDC 4XJKA 3SS3A 5BPJA 3TCZA 5CSIA 4IL1A 3BFBA 5HYDA 3NHIA 1QLKA 2KBIA 4ICBA 1ALWA 1KWOB 2MRDA 1B47A 3SIAA 2MA2A 3C1VA 3O4YA 2LHIA 1CB1A 1LVCD 1DVIA 4YRUA 2LV7A 3IF7A 1IJ6A 1KSMA 1KSOA 2WCKA 3AKBA 1M45A 3NSKA 5K89A 1NX3A 2ZR4A 1J7QA 1Z4HA 3DXLA 4TNCA 1ZFSA 1XYDA 1DEKA 1OOIX 1W7IB 2NCPA 3OB1B 5PALA 3KAFA 1IGVA 1RFJA 2KI6D 1YUSA 2VRGA 3QMEA 3NTPA 2CNPA 2KI4B 1M31A 3PALA 2KI6C 1DGVA 4MZLA 1YVLA 3DVJA 5G08A 1TCOB 1B9AA 1E8AA 1UHHA 1WLMA 5CSNA 1B4CA 2M8IA 2ZAJA 4YGEB 3IVTA 3MQHA 1Q80A 1MXLC 2XP8A 4WQ3A 3SG7A 2NLNA 2NXQA 3EK4A 1MXEA 3EKHA 1TOPA 4OVNF 1CNPA 2NZ0A 1DMOA 3WHUB 1RTP1 1ZOTB 1KWOC 3S0GA 1FBVA 1TRFA 4KYNA 3BUWB 5HKYA 1SKTA 2WC8A 1OW4A 2JOJA 2Y4QA 3S0FA 4MLWA 4CIDA 1QX7A 3EK7A 1CDPA 2E30A 1AP4A 2L4IA 3I5FC 3I5IB 3VGOA 1S5GZ 2DJYA 2ZQUA 1PRWA 3B7AA 3EVVA 2CTNA 2EZ5W 3KCEA 1Y0VH 1IG5A 1J7PA 1CDLA 1F70A 2M1UA 1CFDA 2JRFA 2JV4A 2XP6A 2KI4C 3RZSA 4DRWA 1Y1UA 1XVJA 3CS1A 4DIRA 3E3RA 1FI5A 3BUNB 1LA0A 1SYMA 2KBMA 3L47A 1EG3A 1XFZO 4MN0A 3AAKA 2I7AA 1JWDA 4PHNA 2G9BA 2FOTA 1G4YR 4HRHA 1SNLA 1XK4C 3KPXA 2P6BB 1K9UA 1PALA 2K60A 2Y5IA 3NGVA 1S5GY 2F33A 2KOTA 3FIAA 3NXAA 5ER5A 1OZOA 4AQIA 3WXAA 1F8HA 2QDIA 3PN7B 1XFRA 2KLEA 4M2OA 4MEWA 3KABA 2WCLA 1RJVA 2Q5AA 2JTTA 4QJ5B 1S6CA 3IQQA 4E5RA 1S3PA 1QV1A 1PINA 2DK7A 2QEHA 4HSZA 1GGWA 2DWVA 4DUQA 2ZQSA 2WC6A 2L2EA 4YBHB 1BG1A 3I5IC 2M7NA 1NMVA 1NSHA 1SW8A 4PHKA 3BOWB 1CTRA 4ORCB 5HKWA 2OTGB 3BXKA 4C0LA 1CMFA 2M97A 4MBEA 3PLFB 4GPLB 2K7BA 4GGNA 2YSHA 1UP5A 1TWOA 2YGUA 4NDBA 1CFPA 2AMIA 1KQVA 3D10A 3EG5B 1L2OB 1DJIA 2L5YA 3EVUA 3D0YA 4QIBA 5AHTA 1B8LA 4PHJA 3SG3A 4BY4A 2YSBA 2JT0A 2JTZA 3LK1A 3R1PA 4PALA 5HL1A 1NX2A 5AEQA 1RK9A 3GK1A 2JXLA 3CZTX 3CR4X 1BR4B 1WLZA 1AVSA 2MLFC 1IJ5A 1KK7Z 5CSFA 3FS8A 2KHNA 3K21A 4GUKA 4MSPA 1K8UA 1XA5A 2JPTA 3L4AA 1C3ZA 1FF1A 2LLTA 3BUOB 1U5IA 1SSEB 4CPVA 3B87A 2XP4A 2O5GA 1B7TZ 1OMVA 3CZ0A 3D76A 1SY9A 2BKIB 2L98A 2OTGC 1IQ3A 2BA1A 3GOFA 1QXPA 4YGCB 4PCWA 1BF5A 3B86A 2JNFA 2ZNDA 5D7FA 1LKJA 3WHTB 1JBAA 2OPOA 3D73A 3FSCA 1S26D 1XFUO 1ZUZA 2JXCA 2RGIA 1N65A 4OR9B 1DJWA 1C7VA 1K2HA 4N1FA 5I8NA 1NX0A 1IWQA 4N1GA 1B7TY 1RP5A 2ZNEA 3SIBA 2LUCA 5CSJA 2L50A 2WC5A 1NCXA 2JQ6A 2O60A 3D77A 1MF8B 3IQOA 3S0AA 2D8NA 3ODKA 1CLLA 1TUJA 2KPHA 3R72A 2WCHA 3PSRA 4Q04A 1KQMC 1QIWA 2KYFA 3CR5X 1N2DA 2ZRTA 4JD9A 2KFGA 2LLSA 1BOCA 3FWBA 1XFWO 3PFVA 3SG2A 2LNKA 2ZR5A 2ZN8A 1K93D 2K7DA 2PSRA 2EHBA 3BFHA 1HT9A 3BYAA 3I5FB 4N5XA 1BLQA 1YW5A 3TC5A 4L9MA 3MCBA 5E65A 2TN4A 2HQWA 4PDZA 5FYXA 2JC2A 4OZDA 4PE1A 1MQ1A 3D75A 4QJ4B 2E45A 2ZQTA 1MR8A 2KFHA 2EGDA 2ERBA 2ZKMX 2WCEA 4OCIA 3OOBA 2L2CA 1YVHA 3OX6A 4BY5A 2YSIA 1KFUS 1OMRA 3LE4A 1DJGA 1BU3A 1SL7A 2FJUB 4M2PA 1K9QA 1TK7A 5KTYA 1TN4A 1OOFA 1GJYA 2FJYA 2ZQVA 2QEBA 3KAIA 3LKXA 1ZMZA 2B1UA 2MJWB 1CDMA 4HRGA 3DYEA 4ORAB 3CNGA 3CZ2A 3R1VA 2XPBA 3NHTA 1Y1XA 1YRTB 2BAPA 4MZKA 1F4QA 2F8PA 2PQLA 2ZFDA 3HX4A 5TNCA 3CDNA 2KDHA 5KSZA 4CFQA 3BQ3A 2KNEA 3M0WA 3KADA 1OQPA 1EH2A 4A0TA 1A03A 5I94A 3SG4A 1PVAA 1YR5A 2BECA 1A75A 3DVMA 1ODBA 4UPGA 1OOJA 4GNKB 5F6TA 3KAGA 4INWA 1J1DA 5KU1A 1BT6A 3BUMB 1R2UA 2PVBA 3CWGA 1K9RA 1JUOA 1JC2A 1A29A 1G8IA 3NSLA 4NDDA 4AQJA 1NX1A 3O2PA 1FW4A 2R2IA 3DF0A 1M39A 4DCKA 2BL0B 1WR7A 3KF9A 3V2LA 2Q91A 1ORGA 3L4HA 1AHRA 3SS4A 1OZSA 5CQ2A 2H61A 3DY9A 2L5XB 3D0YB 2LM5A 4U84A 3VROA 2M8UA 2JNXA 2CBLA 2COLB 3MSEB 3WH0A 2F2OA 1NWDA 1Y1AA 4C0JA 1UHIA 1KK8B 1SR6C 2K61A 1YRUB 5GQQC 2SCPA 3TDZA 3S0EA 1KFUL 2M29A 3CLNA 3GK4X 1MWNA 1SCMB 3AKAA 1MUXA 3FE8A 2KQ6A 3ZNIA 1OMDA 2KGBC 4I5NB 2ZN9A 2WNDA 2I94A 3TUYC 4A4CA 1WDCB 2M1KB 4IJ7A 1Y6WA 1MHOA 3RM1A 2WCJA 1IIOA 1SCVA 1TNWA 2BL0C 3VRNA 1LINA 1PULA 3I5GC 1QJTA 2E6WA 2KSPA 5IBWA 2XP3A 3N7HA 1WY9A 1QASA 1B8RA 2K2FA 3BUXB 5FI6A 1TR8A 2HF5A 5J3XA 5I2QA 2DMVA 4PE7A 2ZR6A 2JXWA 2F3YA 1WRLA 5AANA 4PE0A 1BMOA 2WOSA 2LANA 5D3OA 2QRVA 4E68A 1K95A 2I18A 4ETOA 1KQMB 4C0KA 5AXIA 1SL8A 4CLNA 4XJKB 1H8BA 2MLEC 3VRQA 1KK8C 3CGAA 4GGFA 4I5KA 2JPOA 2AUCA 1FI6A 1DC1A 2HETA 1SK6D 1OSAA 3RLZA 1QV0A 1IKUA 1SCMC 3PM2A 2ISDA 1DTLA 2BBMA 3WNXB 2LVIA 2GGZA 1VRKA 2WCMA 5E66A 1I5HW 2A4JA 1WDCC 3ZWHA 1A2XA 4GBAA 3KAHA 4D1EA 1WRZA 1BODA 3FE6A 4FQTA 3MCBB 1NUBA 1QX2A 2L51A 1K94A 2FCEA 2LMTA 3BOWA 3FS7A 1XFYO 3VB1A 1S1EA 4GLXA 1UHNA 5AERA 4JQ0D 1TNXA 2KAVA 2LC5A 4HREE 2Y1NA 1TIZA 2CCMA 4MRXA 1LS8A 1QIVA 2BKHB 1JFJA 1PSBA 3S0DA 1BR1B 2KGRA 3CTNA 1C3YA 3B88A 2H2KA 3LCPC 2LUXA 1JMQA 2M49B 3NSIA 3CYZA 1DT7B 3LKXB 1IQ5A 1SBJA 2L4HA 3CABA 3DVKA 4WRIA 5CPVA 1FPWA 2K0JA 3LLEA 2ITKA 3LL8B 3A4UB 2EC6C 5D69A 1NCYA 5HLOA 2GGMA 1QLSA 2FCDA 1P28A 1CDNA 1JSAA 2YSFA 1CKKA 2YSGA 2IS9A 3PQHA 3PM8A 3H4SE 2PASA 4OV2A 2BCAA 2V53A 2PYQA 3PATA 4INXA 2K2AA 3KEVA 1UWOA 1LA3A 1XO5A 2H8VA 1JF2A 4U85A 1DJYA 1ZACA 2DOQA 2AAOA 1A75B 1CLBA 3SG5A 2LE9B 1V1FA 3F45A 2LMUA 4FTGA 4M2QA 2L4JA 3M85A 4XYNA 1XFXO 3FWCA 1QVIZ 1DJXA 2LLUA 2MBXA 2LMVA 2BE6A 1K90D 2K8MB 1NP8A 3EK8A 1TNQA 3VRPA 1Z2CB 2XP7A 1YTZC 2SASA 1HQVA 1CLMA 3DF0B 1OE9B 5E64A 3Q8IA 2KLDA 1L7ZA 4MRYA 5HLVA 2BBNA 2KYCA 2NCOA 2P71A 5JJGA 1CFCA 2Y8NB 1C7WA 1F54A 3TDUA 1DF0A 2F3ZA 1LXFC 3I5HB 1GGZA 2LVJA 2Q4UA 1QVIY 1NYAA 3QRXA 1SR6B 4JWQA 1UHKA 1V1GA 3MQGA 1EJ3A 4USLA 4YGAA 1S36A 1M46A 1RECA 4U8DA 2KQYA 3OBVA 2K7CA 1K9PA 1KFXL 3TUYB 4REXA 2P70A 3O6BA 1J55A 5AFPA 3O78A 3OX5A 4ORBB 3B6XA 4R1EA 2M3OW 2WCFA 1EL4A 1N0YA 2M3WA 2I2RE 4PHMA 3I5GB 2BCBA 1OOGA 4YGBB 2F21A 4GFTA 2L0PA 1M63B 2OS8B 1PK0D 3NSOA 3TDIA 3ICBA 3SJSA 4CFRA 1F4OA 1WRKA 3KO0A 2G2BA 1JF0A 1TUZA 1QX5B
chains in the Genus database with same CATH topology
1RWYA 2LAPA 2H61C 5ER4X 1AUIB 2KFFA 1ALVA 2JULA 4I5JA 1XK4A 2LHLA 3I5HC 4ZCUA 2CT9A 1IH0A 1FLCA 1KCYA 2JZIA 1AJ4A 4NQGA 2LCPA 1H4BA 2LVVA 4F0ZB 1BJFA 1CMGA 2LAJA 2QACA 2PRUA 4A4BA 4P5OE 3OB2B 2M8JA 4JPZB 3CR2A 2JX8A 1QATA 2XP5A 4MZJA 1U5IB 2M7LA 1CM1A 5JOLA 1X02A 2MDIA 1NIWA 1A4PA 1J7OA 1CM4A 2BE4A 2WORA 2QPTA 3EVRA 2JU0A 2OS8C 3LK0A 1B8CA 2GV5A 2WAEA 1G33A 1PSRA 4ZCVA 2RE3A 5I2LA 1S6JA 1WMVA 3HCMA 1SRAA 1S6IA 1F55A 2HPSA 1QTXA 2OWOA 2M9GA 4P2YB 4A0UA 1TTXA 2ZRSA 3DVEA 2MHHA 2JWWA 4DS7A 1K96A 1SPYA 2XP9A 2BCXA 1NCZA 5DKNA 5I2OA 2HQ8A 1D1OA 5U47A 2EC6B 3GK2A 5E62A 3M7NA 2JMFA 3FSBA 3TS5B 1PVBA 2PALA 1DJZA 4YI8A 1SL9A 3OP0A 1J1EA 5DKRA 4GGFC 5E5WA 3KHEA 3JVTB 1W7JB 1TNPA 3PN7C 1B1GA 1K9KA 2DK1A 3JTDB 1F8AB 2CXJA 3VRRA 5HKZA 2PMYA 3A8RA 4QJ3B 1NPQA 1JFKA 2LVKA 2WCBA 1ZCNA 2XPAA 3DD4A 1YUTA 1C07A 3SG6A 4OKHA 1YUUA 4AOMA 1XFVO 1KFXS 1F71A 2JT3A 4WQ2A 1AJ5A 2WADA 4YGDB 1GQMA 2KAYA 3AAJA 2LP2A 2JT8A 1CFFA 1DGUA 3TDBA 4PE4A 5DKQA 2LP3A 2Y1MA 1UUSA 1J7RA 1TCFA 4I5LB 1IRJA 1YX8A 2YAJB 2M0RA 1RROA 4YI9A 4MVFA 1O6WA 1KK7Y 1QS7A 4FQOA 1EG4A 1L2OC 1DJHA 2KXQA 1EXRA 2KAXA 2MAZA 3TS5C 1R6PA 1YX7A 5B8IB 2F2PA 3OHMB 3TZ1A 1UURA 3JVTC 1AK8A 1SMGA 1DF0B 4NDCA 1YURA 3EKJA 4GAOA 4U86A 2K7OA 1UHJA 3JTDC 4XJKA 5BPJA 3TCZA 5CSIA 4IL1A 5HYDA 1QLKA 2KBIA 4ICBA 1ALWA 1KWOB 2MRDA 1B47A 3SIAA 2MA2A 3C1VA 3O4YA 2LHIA 1CB1A 1LVCD 1DVIA 4YRUA 2LV7A 3IF7A 1IJ6A 1KSMA 1KSOA 3AKBA 3NSKA 1M45A 5K89A 2ZR4A 1NX3A 1J7QA 4TNCA 1ZFSA 1XYDA 1W7IB 5PALA 2NCPA 3KAFA 3OB1B 1IGVA 1RFJA 2KI6D 1YUSA 2VRGA 3NTPA 2CNPA 2KI4B 1M31A 3PALA 2KI6C 1DGVA 4MZLA 1YVLA 3DVJA 5G08A 1TCOB 1B9AA 1E8AA 1UHHA 1WLMA 5CSNA 1B4CA 2M8IA 2ZAJA 4YGEB 3MQHA 1Q80A 1MXLC 2XP8A 4WQ3A 3SG7A 2NLNA 2NXQA 3EK4A 1MXEA 3EKHA 1TOPA 4OVNF 1CNPA 2NZ0A 1DMOA 3WHUB 1RTP1 1ZOTB 1KWOC 1FBVA 1TRFA 3BUWB 5HKYA 1SKTA 2WC8A 2JOJA 2Y4QA 4MLWA 4CIDA 1QX7A 3EK7A 1CDPA 2E30A 1AP4A 2L4IA 3I5FC 3I5IB 3VGOA 1S5GZ 2DJYA 2ZQUA 1PRWA 3EVVA 2CTNA 2EZ5W 3KCEA 1Y0VH 1IG5A 1J7PA 1CDLA 1F70A 2M1UA 1CFDA 2JRFA 2JV4A 2XP6A 2KI4C 4DRWA 1Y1UA 1XVJA 3CS1A 4DIRA 3E3RA 1FI5A 3BUNB 1LA0A 1SYMA 2KBMA 4MN0A 1EG3A 1XFZO 3AAKA 2I7AA 1JWDA 4PHNA 2G9BA 2FOTA 1G4YR 4HRHA 1SNLA 1XK4C 3KPXA 2P6BB 1K9UA 1PALA 2Y5IA 3NXAA 1S5GY 2F33A 2KOTA 3FIAA 4AQIA 5ER5A 1OZOA 3WXAA 1F8HA 3PN7B 4M2OA 4MEWA 3KABA 1RJVA 2Q5AA 2JTTA 4QJ5B 1S6CA 3IQQA 4E5RA 1S3PA 1QV1A 1PINA 2DK7A 4HSZA 1GGWA 2DWVA 4DUQA 2ZQSA 1BG1A 2L2EA 4YBHB 3I5IC 2M7NA 1NMVA 1NSHA 1SW8A 4PHKA 3BOWB 1CTRA 4ORCB 5HKWA 2OTGB 3BXKA 4C0LA 1CMFA 2M97A 4MBEA 3PLFB 4GPLB 2K7BA 4GGNA 2YSHA 1UP5A 1CFPA 1KQVA 4NDBA 2AMIA 3D10A 1L2OB 1DJIA 3EVUA 4QIBA 3D0YA 5AHTA 1B8LA 4PHJA 3SG3A 4BY4A 2YSBA 2JT0A 2JTZA 3LK1A 4PALA 1NX2A 5AEQA 1RK9A 3GK1A 2JXLA 3CZTX 3CR4X 1BR4B 1WLZA 1AVSA 2MLFC 1IJ5A 1KK7Z 5CSFA 3FS8A 2KHNA 3K21A 4GUKA 4MSPA 1K8UA 1XA5A 2JPTA 1FF1A 2LLTA 3BUOB 1U5IA 4CPVA 2XP4A 2O5GA 1B7TZ 1OMVA 1IQ3A 1SY9A 2BKIB 2L98A 2OTGC 2BA1A 3GOFA 1QXPA 4YGCB 4PCWA 1BF5A 2JNFA 2ZNDA 5D7FA 1LKJA 3WHTB 1JBAA 2OPOA 3FSCA 1S26D 1XFUO 1ZUZA 2JXCA 2RGIA 1N65A 4OR9B 1DJWA 1C7VA 1K2HA 4N1FA 5I8NA 1NX0A 1IWQA 4N1GA 1B7TY 1RP5A 2ZNEA 3SIBA 2LUCA 5CSJA 2L50A 1NCXA 2JQ6A 2O60A 1MF8B 3IQOA 2D8NA 3ODKA 1CLLA 3PSRA 4Q04A 1KQMC 1QIWA 2KYFA 3CR5X 1N2DA 2ZRTA 2KFGA 2LLSA 1BOCA 3FWBA 1XFWO 3PFVA 3SG2A 2LNKA 2ZR5A 2ZN8A 1K93D 2K7DA 2PSRA 2EHBA 3BYAA 1HT9A 3I5FB 1BLQA 4N5XA 1YW5A 3TC5A 4L9MA 3MCBA 5E65A 2TN4A 2HQWA 4PDZA 5FYXA 2JC2A 4PE1A 4QJ4B 1MQ1A 2E45A 2ZQTA 1MR8A 2KFHA 2EGDA 3OOBA 2ZKMX 2WCEA 4OCIA 3OX6A 1YVHA 4BY5A 2YSIA 1KFUS 1OMRA 3LE4A 1DJGA 1BU3A 1SL7A 2FJUB 4M2PA 1K9QA 1TK7A 5KTYA 1TN4A 3LKXA 1GJYA 2ZQVA 3KAIA 1ZMZA 2B1UA 2MJWB 1CDMA 4HRGA 4ORAB 3CNGA 2XPBA 1Y1XA 1YRTB 4MZKA 1F4QA 2F8PA 2ZFDA 3HX4A 5TNCA 2KDHA 5KSZA 4CFQA 3BQ3A 2KNEA 3M0WA 3KADA 1OQPA 1EH2A 4A0TA 1A03A 3SG4A 1PVAA 1YR5A 2BECA 1A75A 3DVMA 1ODBA 4UPGA 1OOJA 4GNKB 5F6TA 3KAGA 1J1DA 5KU1A 1BT6A 3BUMB 1R2UA 2PVBA 3CWGA 1K9RA 1JUOA 1JC2A 1A29A 1G8IA 3NSLA 4NDDA 4AQJA 1NX1A 3O2PA 1FW4A 2R2IA 3DF0A 1M39A 4DCKA 2BL0B 1WR7A 3KF9A 2Q91A 3L4HA 1AHRA 1OZSA 5CQ2A 2H61A 2L5XB 3D0YB 2LM5A 4U84A 3VROA 2M8UA 2JNXA 2CBLA 2COLB 3MSEB 3WH0A 2F2OA 1NWDA 1Y1AA 4C0JA 1UHIA 1KK8B 1SR6C 2K61A 1YRUB 5GQQC 2SCPA 3TDZA 1KFUL 2M29A 3CLNA 3GK4X 1MWNA 1SCMB 3AKAA 1MUXA 2KQ6A 3ZNIA 1OMDA 2KGBC 4I5NB 2ZN9A 2WNDA 2I94A 3TUYC 4A4CA 1WDCB 2M1KB 1Y6WA 1MHOA 3RM1A 1SCVA 1TNWA 2BL0C 3VRNA 1LINA 1PULA 3I5GC 1QJTA 2E6WA 2KSPA 5IBWA 2XP3A 1WY9A 1QASA 1B8RA 2K2FA 3BUXB 1TR8A 2DMVA 2HF5A 5J3XA 5I2QA 4PE7A 2ZR6A 2JXWA 2F3YA 1WRLA 5AANA 4PE0A 1BMOA 2WOSA 2LANA 2QRVA 4E68A 1K95A 2I18A 4ETOA 1KQMB 4C0KA 5AXIA 1SL8A 4CLNA 4XJKB 1H8BA 2MLEC 3VRQA 1KK8C 3CGAA 4GGFA 4I5KA 1FI6A 2AUCA 2HETA 1SK6D 1OSAA 3RLZA 1QV0A 1IKUA 1SCMC 2ISDA 1DTLA 2BBMA 3WNXB 2LVIA 2GGZA 1VRKA 5E66A 1I5HW 2A4JA 1WDCC 3ZWHA 1A2XA 4GBAA 3KAHA 4D1EA 1WRZA 1BODA 3MCBB 1NUBA 1QX2A 2L51A 1K94A 2FCEA 2LMTA 3BOWA 3FS7A 1XFYO 4GLXA 1S1EA 1UHNA 5AERA 4JQ0D 1TNXA 2KAVA 2LC5A 4HREE 2Y1NA 1TIZA 2CCMA 4MRXA 1QIVA 2BKHB 1JFJA 1PSBA 1BR1B 2KGRA 3CTNA 2H2KA 3LCPC 2LUXA 1JMQA 2M49B 3NSIA 1DT7B 3LKXB 1IQ5A 1SBJA 2L4HA 3DVKA 4WRIA 5CPVA 1FPWA 2K0JA 3LLEA 2ITKA 3LL8B 3A4UB 2EC6C 5D69A 1NCYA 5HLOA 2GGMA 1QLSA 2FCDA 1CDNA 1JSAA 2YSFA 1CKKA 2YSGA 2IS9A 3PQHA 3PM8A 3H4SE 2PASA 4OV2A 2BCAA 2V53A 3PATA 2K2AA 3KEVA 1UWOA 1LA3A 1XO5A 1JF2A 4U85A 1DJYA 1ZACA 2DOQA 2AAOA 1A75B 1CLBA 3SG5A 2LE9B 1V1FA 3F45A 2LMUA 4FTGA 4M2QA 2L4JA 3M85A 4XYNA 1XFXO 3FWCA 1QVIZ 1DJXA 2LLUA 2MBXA 2LMVA 2BE6A 1K90D 2K8MB 1NP8A 3EK8A 1TNQA 3VRPA 2XP7A 1YTZC 2SASA 1HQVA 1CLMA 3DF0B 1OE9B 5E64A 1L7ZA 4MRYA 5HLVA 2BBNA 2KYCA 2NCOA 5JJGA 1CFCA 2Y8NB 1C7WA 1F54A 3TDUA 1DF0A 2F3ZA 1LXFC 3I5HB 1GGZA 2LVJA 2Q4UA 1QVIY 1NYAA 3QRXA 1SR6B 4JWQA 1UHKA 1V1GA 3MQGA 1EJ3A 4USLA 4YGAA 1S36A 1M46A 1RECA 4U8DA 2KQYA 2K7CA 1K9PA 1KFXL 3TUYB 4REXA 3O6BA 5AFPA 1J55A 3O78A 3OX5A 4ORBB 4R1EA 2M3OW 2WCFA 1EL4A 1N0YA 2M3WA 2I2RE 4PHMA 3I5GB 2BCBA 4YGBB 2F21A 4GFTA 2L0PA 1M63B 2OS8B 1PK0D 3NSOA 3TDIA 3ICBA 3SJSA 4CFRA 1F4OA 1WRKA 3KO0A 2G2BA 1JF0A 1QX5B
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1RWY A;  2LAP A;  2H61 C;  5ER4 X;  1AUI B;  2KFF A;  1ALV A;  2JUL A;  4I5J A;  1XK4 A;  2LHL A;  3I5H C;  4ZCU A;  2CT9 A;  1IH0 A;  1KCY A;  2JZI A;  1AJ4 A;  4NQG A;  2LCP A;  1H4B A;  2LVV A;  4F0Z B;  1BJF A;  1CMG A;  2LAJ A;  2QAC A;  2PRU A;  4A4B A;  4P5O E;  3OB2 B;  2M8J A;  4JPZ B;  3CR2 A;  2JX8 A;  1QAT A;  2XP5 A;  4MZJ A;  1U5I B;  2M7L A;  1CM1 A;  5JOL A;  1X02 A;  2MDI A;  1NIW A;  1A4P A;  1J7O A;  1CM4 A;  2BE4 A;  2WOR A;  2QPT A;  3EVR A;  2JU0 A;  2OS8 C;  3LK0 A;  1B8C A;  2GV5 A;  1G33 A;  1PSR A;  4ZCV A;  2RE3 A;  5I2L A;  1S6J A;  1WMV A;  3HCM A;  1SRA A;  1S6I A;  1F55 A;  2HPS A;  1QTX A;  2M9G A;  4P2Y B;  1TTX A;  2ZRS A;  3DVE A;  2MHH A;  2JWW A;  4DS7 A;  1K96 A;  1SPY A;  2XP9 A;  2BCX A;  1NCZ A;  5DKN A;  5I2O A;  2HQ8 A;  1D1O A;  2EC6 B;  3GK2 A;  3M7N A;  2JMF A;  3TS5 B;  1PVB A;  2PAL A;  1DJZ A;  4YI8 A;  1SL9 A;  3OP0 A;  1J1E A;  5DKR A;  4GGF C;  3KHE A;  3JVT B;  1W7J B;  1TNP A;  3PN7 C;  1B1G A;  1K9K A;  2DK1 A;  3JTD B;  1F8A B;  2CXJ A;  3VRR A;  5HKZ A;  2PMY A;  3A8R A;  4QJ3 B;  1NPQ A;  1JFK A;  2LVK A;  2WCB A;  1ZCN A;  2XPA A;  3DD4 A;  1YUT A;  1C07 A;  3SG6 A;  4OKH A;  1YUU A;  4AOM A;  1XFV O;  1KFX S;  1F71 A;  2JT3 A;  4WQ2 A;  1AJ5 A;  4YGD B;  1GQM A;  2KAY A;  3AAJ A;  2LP2 A;  2JT8 A;  1CFF A;  1DGU A;  3TDB A;  4PE4 A;  5DKQ A;  2LP3 A;  2Y1M A;  1UUS A;  1J7R A;  1TCF A;  4I5L B;  1IRJ A;  1YX8 A;  2M0R A;  1RRO A;  4YI9 A;  4MVF A;  1O6W A;  1KK7 Y;  1QS7 A;  4FQO A;  1EG4 A;  1L2O C;  1DJH A;  2KXQ A;  1EXR A;  2KAX A;  2MAZ A;  3TS5 C;  1R6P A;  1YX7 A;  5B8I B;  2F2P A;  3OHM B;  3TZ1 A;  1UUR A;  3JVT C;  1AK8 A;  1SMG A;  1DF0 B;  4NDC A;  1YUR A;  3EKJ A;  4GAO A;  4U86 A;  2K7O A;  1UHJ A;  3JTD C;  4XJK A;  5BPJ A;  3TCZ A;  5CSI A;  4IL1 A;  5HYD A;  1QLK A;  2KBI A;  4ICB A;  1ALW A;  1KWO B;  2MRD A;  1B47 A;  3SIA A;  2MA2 A;  3C1V A;  3O4Y A;  2LHI A;  1CB1 A;  1LVC D;  1DVI A;  4YRU A;  2LV7 A;  3IF7 A;  1IJ6 A;  1KSM A;  1KSO A;  3AKB A;  3NSK A;  1M45 A;  5K89 A;  2ZR4 A;  1NX3 A;  1J7Q A;  4TNC A;  1ZFS A;  1XYD A;  1W7I B;  5PAL A;  2NCP A;  3KAF A;  3OB1 B;  1IGV A;  1RFJ A;  2KI6 D;  1YUS A;  2VRG A;  3NTP A;  2CNP A;  2KI4 B;  1M31 A;  3PAL A;  2KI6 C;  1DGV A;  4MZL A;  1YVL A;  3DVJ A;  5G08 A;  1TCO B;  1B9A A;  1E8A A;  1UHH A;  1WLM A;  5CSN A;  1B4C A;  2M8I A;  2ZAJ A;  4YGE B;  1Q80 A;  1MXL C;  2XP8 A;  4WQ3 A;  3SG7 A;  2NLN A;  2NXQ A;  3EK4 A;  1MXE A;  3EKH A;  1TOP A;  4OVN F;  1CNP A;  2NZ0 A;  1DMO A;  3WHU B;  1RTP 1;  1ZOT B;  1KWO C;  1FBV A;  1TRF A;  3BUW B;  5HKY A;  1SKT A;  2WC8 A;  2JOJ A;  2Y4Q A;  4MLW A;  4CID A;  1QX7 A;  3EK7 A;  1CDP A;  2E30 A;  1AP4 A;  2L4I A;  3I5F C;  3I5I B;  3VGO A;  1S5G Z;  2DJY A;  2ZQU A;  1PRW A;  3EVV A;  2CTN A;  2EZ5 W;  3KCE A;  1Y0V H;  1IG5 A;  1J7P A;  1CDL A;  1F70 A;  2M1U A;  1CFD A;  2JRF A;  2JV4 A;  2XP6 A;  2KI4 C;  4DRW A;  1Y1U A;  1XVJ A;  3CS1 A;  4DIR A;  3E3R A;  1FI5 A;  3BUN B;  1LA0 A;  1SYM A;  2KBM A;  4MN0 A;  1EG3 A;  1XFZ O;  3AAK A;  2I7A A;  1JWD A;  4PHN A;  2G9B A;  2FOT A;  1G4Y R;  4HRH A;  1SNL A;  1XK4 C;  3KPX A;  2P6B B;  1K9U A;  1PAL A;  2Y5I A;  3NXA A;  1S5G Y;  2F33 A;  2KOT A;  3FIA A;  4AQI A;  5ER5 A;  1OZO A;  3WXA A;  1F8H A;  3PN7 B;  4M2O A;  4MEW A;  3KAB A;  1RJV A;  2Q5A A;  2JTT A;  4QJ5 B;  1S6C A;  3IQQ A;  4E5R A;  1S3P A;  1QV1 A;  1PIN A;  2DK7 A;  4HSZ A;  1GGW A;  2DWV A;  4DUQ A;  2ZQS A;  1BG1 A;  2L2E A;  4YBH B;  3I5I C;  2M7N A;  1NMV A;  1NSH A;  1SW8 A;  4PHK A;  3BOW B;  1CTR A;  4ORC B;  5HKW A;  2OTG B;  3BXK A;  4C0L A;  1CMF A;  2M97 A;  4MBE A;  3PLF B;  4GPL B;  2K7B A;  4GGN A;  2YSH A;  1UP5 A;  1CFP A;  1KQV A;  4NDB A;  2AMI A;  3D10 A;  1L2O B;  1DJI A;  3EVU A;  4QIB A;  3D0Y A;  5AHT A;  1B8L A;  4PHJ A;  3SG3 A;  4BY4 A;  2YSB A;  2JT0 A;  2JTZ A;  3LK1 A;  4PAL A;  1NX2 A;  5AEQ A;  1RK9 A;  3GK1 A;  2JXL A;  3CZT X;  3CR4 X;  1BR4 B;  1WLZ A;  1AVS A;  2MLF C;  1IJ5 A;  1KK7 Z;  5CSF A;  2KHN A;  3K21 A;  4GUK A;  4MSP A;  1K8U A;  1XA5 A;  2JPT A;  1FF1 A;  2LLT A;  3BUO B;  1U5I A;  4CPV A;  2XP4 A;  2O5G A;  1B7T Z;  1OMV A;  1IQ3 A;  1SY9 A;  2BKI B;  2L98 A;  2OTG C;  2BA1 A;  3GOF A;  1QXP A;  4YGC B;  4PCW A;  1BF5 A;  2JNF A;  2ZND A;  5D7F A;  1LKJ A;  3WHT B;  1JBA A;  2OPO A;  1S26 D;  1XFU O;  1ZUZ A;  2JXC A;  2RGI A;  1N65 A;  4OR9 B;  1DJW A;  1C7V A;  1K2H A;  4N1F A;  5I8N A;  1NX0 A;  1IWQ A;  4N1G A;  1B7T Y;  2ZNE A;  3SIB A;  2LUC A;  5CSJ A;  2L50 A;  1NCX A;  2JQ6 A;  2O60 A;  1MF8 B;  3IQO A;  2D8N A;  3ODK A;  1CLL A;  3PSR A;  4Q04 A;  1KQM C;  1QIW A;  2KYF A;  3CR5 X;  1N2D A;  2ZRT A;  2KFG A;  2LLS A;  1BOC A;  3FWB A;  1XFW O;  3PFV A;  3SG2 A;  2LNK A;  2ZR5 A;  2ZN8 A;  1K93 D;  2K7D A;  2PSR A;  2EHB A;  3BYA A;  1HT9 A;  3I5F B;  1BLQ A;  4N5X A;  1YW5 A;  3TC5 A;  4L9M A;  2TN4 A;  2HQW A;  4PDZ A;  5FYX A;  2JC2 A;  4PE1 A;  4QJ4 B;  1MQ1 A;  2E45 A;  2ZQT A;  1MR8 A;  2KFH A;  2EGD A;  3OOB A;  2ZKM X;  2WCE A;  4OCI A;  3OX6 A;  1YVH A;  4BY5 A;  2YSI A;  1KFU S;  1OMR A;  3LE4 A;  1DJG A;  1BU3 A;  1SL7 A;  2FJU B;  4M2P A;  1K9Q A;  1TK7 A;  5KTY A;  1TN4 A;  1GJY A;  2ZQV A;  3KAI A;  1ZMZ A;  2B1U A;  2MJW B;  1CDM A;  4HRG A;  4ORA B;  3CNG A;  2XPB A;  1Y1X A;  1YRT B;  4MZK A;  1F4Q A;  2F8P A;  2ZFD A;  3HX4 A;  5TNC A;  2KDH A;  5KSZ A;  4CFQ A;  3BQ3 A;  2KNE A;  3M0W A;  3KAD A;  1OQP A;  1EH2 A;  1A03 A;  3SG4 A;  1PVA A;  1YR5 A;  2BEC A;  1A75 A;  3DVM A;  1ODB A;  4UPG A;  1OOJ A;  4GNK B;  5F6T A;  3KAG A;  1J1D A;  5KU1 A;  1BT6 A;  3BUM B;  1R2U A;  2PVB A;  3CWG A;  1K9R A;  1JUO A;  1JC2 A;  1A29 A;  1G8I A;  3NSL A;  4NDD A;  4AQJ A;  1NX1 A;  3O2P A;  1FW4 A;  2R2I A;  3DF0 A;  1M39 A;  4DCK A;  2BL0 B;  1WR7 A;  3KF9 A;  2Q91 A;  3L4H A;  1AHR A;  1OZS A;  5CQ2 A;  2H61 A;  2L5X B;  3D0Y B;  2LM5 A;  4U84 A;  3VRO A;  2M8U A;  2JNX A;  2CBL A;  2COL B;  3MSE B;  3WH0 A;  2F2O A;  1NWD A;  1Y1A A;  4C0J A;  1UHI A;  1KK8 B;  1SR6 C;  2K61 A;  1YRU B;  5GQQ C;  2SCP A;  3TDZ A;  1KFU L;  2M29 A;  3CLN A;  3GK4 X;  1MWN A;  1SCM B;  3AKA A;  1MUX A;  2KQ6 A;  3ZNI A;  1OMD A;  2KGB C;  4I5N B;  2ZN9 A;  2WND A;  2I94 A;  3TUY C;  4A4C A;  1WDC B;  2M1K B;  1Y6W A;  1MHO A;  3RM1 A;  1SCV A;  1TNW A;  2BL0 C;  3VRN A;  1LIN A;  1PUL A;  3I5G C;  1QJT A;  2E6W A;  2KSP A;  5IBW A;  2XP3 A;  1WY9 A;  1QAS A;  1B8R A;  2K2F A;  3BUX B;  2DMV A;  2HF5 A;  5J3X A;  5I2Q A;  4PE7 A;  2ZR6 A;  2JXW A;  2F3Y A;  1WRL A;  5AAN A;  4PE0 A;  1BMO A;  2WOS A;  2LAN A;  4E68 A;  1K95 A;  2I18 A;  4ETO A;  1KQM B;  4C0K A;  5AXI A;  1SL8 A;  4CLN A;  4XJK B;  1H8B A;  2MLE C;  3VRQ A;  1KK8 C;  3CGA A;  4GGF A;  4I5K A;  1FI6 A;  2AUC A;  2HET A;  1SK6 D;  1OSA A;  3RLZ A;  1QV0 A;  1IKU A;  1SCM C;  2ISD A;  1DTL A;  2BBM A;  3WNX B;  2LVI A;  2GGZ A;  1VRK A;  1I5H W;  2A4J A;  1WDC C;  3ZWH A;  1A2X A;  4GBA A;  3KAH A;  4D1E A;  1WRZ A;  1BOD A;  1NUB A;  1QX2 A;  2L51 A;  1K94 A;  2FCE A;  2LMT A;  3BOW A;  3FS7 A;  1XFY O;  1S1E A;  1UHN A;  5AER A;  4JQ0 D;  1TNX A;  2KAV A;  2LC5 A;  4HRE E;  2Y1N A;  1TIZ A;  2CCM A;  4MRX A;  1QIV A;  2BKH B;  1JFJ A;  1PSB A;  1BR1 B;  2KGR A;  3CTN A;  2H2K A;  3LCP C;  2LUX A;  1JMQ A;  2M49 B;  3NSI A;  1DT7 B;  1IQ5 A;  1SBJ A;  2L4H A;  3DVK A;  4WRI A;  5CPV A;  1FPW A;  2K0J A;  3LLE A;  2ITK A;  3LL8 B;  3A4U B;  2EC6 C;  5D69 A;  1NCY A;  5HLO A;  2GGM A;  1QLS A;  2FCD A;  1CDN A;  1JSA A;  2YSF A;  1CKK A;  2YSG A;  2IS9 A;  3PM8 A;  3H4S E;  2PAS A;  4OV2 A;  2BCA A;  2V53 A;  3PAT A;  2K2A A;  3KEV A;  1UWO A;  1LA3 A;  1XO5 A;  1JF2 A;  4U85 A;  1DJY A;  1ZAC A;  2DOQ A;  2AAO A;  1A75 B;  1CLB A;  3SG5 A;  2LE9 B;  1V1F A;  3F45 A;  2LMU A;  4FTG A;  4M2Q A;  2L4J A;  3M85 A;  4XYN A;  1XFX O;  3FWC A;  1QVI Z;  1DJX A;  2LLU A;  2MBX A;  2LMV A;  2BE6 A;  1K90 D;  2K8M B;  1NP8 A;  3EK8 A;  1TNQ A;  3VRP A;  2XP7 A;  1YTZ C;  2SAS A;  1HQV A;  1CLM A;  3DF0 B;  1OE9 B;  1L7Z A;  4MRY A;  5HLV A;  2BBN A;  2KYC A;  2NCO A;  5JJG A;  1CFC A;  1C7W A;  1F54 A;  3TDU A;  1DF0 A;  2F3Z A;  1LXF C;  3I5H B;  1GGZ A;  2LVJ A;  2Q4U A;  1QVI Y;  1NYA A;  3QRX A;  1SR6 B;  4JWQ A;  1UHK A;  1V1G A;  1EJ3 A;  4USL A;  4YGA A;  1S36 A;  1M46 A;  1REC A;  4U8D A;  2KQY A;  2K7C A;  1K9P A;  1KFX L;  3TUY B;  4REX A;  3O6B A;  5AFP A;  1J55 A;  3O78 A;  3OX5 A;  4ORB B;  4R1E A;  2M3O W;  2WCF A;  1EL4 A;  1N0Y A;  2M3W A;  2I2R E;  4PHM A;  3I5G B;  2BCB A;  4YGB B;  2F21 A;  4GFT A;  2L0P A;  1M63 B;  2OS8 B;  1PK0 D;  3NSO A;  3TDI A;  3ICB A;  3SJS A;  4CFR A;  1F4O A;  1WRK A;  3KO0 A;  2G2B A;  1JF0 A;  1QX5 B; 
#chains in the Genus database with same CATH topology
 1RWY A;  2LAP A;  3S0B A;  2H61 C;  5ER4 X;  1AUI B;  2KFF A;  1ALV A;  2JUL A;  4I5J A;  1XK4 A;  5FI7 A;  2LHL A;  3I5H C;  4ZCU A;  2CT9 A;  1IH0 A;  1FLC A;  1KCY A;  2JZI A;  1AJ4 A;  4NQG A;  2LCP A;  3PJI A;  1H4B A;  2LVV A;  5EL2 A;  4F0Z B;  1BJF A;  1CMG A;  2LAJ A;  2QAC A;  2PRU A;  4A4B A;  4P5O E;  3OB2 B;  2M8J A;  3DZT A;  3CR2 A;  4JPZ B;  1QAT A;  2JX8 A;  2XP5 A;  4MZJ A;  1U5I B;  3BFA A;  2M7L A;  1CM1 A;  5JOL A;  1X02 A;  2MDI A;  1NIW A;  1A4P A;  1J7O A;  3UO9 A;  3O4X A;  1CM4 A;  2BE4 A;  2BNX A;  2WOR A;  3R1O A;  2QPT A;  3EVR A;  2JU0 A;  3BJH A;  1T14 A;  2OS8 C;  3LK0 A;  4PT1 A;  1B8C A;  2GV5 A;  2WAE A;  1G33 A;  1PSR A;  4ZCV A;  4F7F A;  2RE3 A;  3OGN A;  5I2L A;  1S6J A;  1WMV A;  3HCM A;  1SRA A;  1S6I A;  1F55 A;  2HPS A;  1QTX A;  2OWO A;  2M9G A;  4P2Y B;  4A0U A;  1DQE A;  1TTX A;  2ZRS A;  3DVE A;  2MHH A;  2JWW A;  4DS7 A;  1K96 A;  1SPY A;  2XP9 A;  1DEL A;  2BCX A;  1NCZ A;  5DKN A;  5I2O A;  2HQ8 A;  1D1O A;  5U47 A;  2EC6 B;  3GK2 A;  5E62 A;  3M7N A;  2JMF A;  3FSB A;  3TS5 B;  1PVB A;  2PAL A;  1DJZ A;  4YI8 A;  1SL9 A;  3OP0 A;  5DIC A;  1J1E A;  5DKR A;  4GGF C;  5E5W A;  3KHE A;  3JVT B;  3UNW A;  1W7J B;  1TNP A;  3PN7 C;  1B1G A;  1W9Z A;  1K9K A;  2DK1 A;  3JTD B;  1F8A B;  1OOH A;  2CXJ A;  3VRR A;  5HKZ A;  2PMY A;  3A8R A;  3D78 A;  4QJ3 B;  1NPQ A;  1JFK A;  2LVK A;  2WCB A;  1ZCN A;  2XPA A;  3DD4 A;  1YUT A;  3D74 A;  3L4L A;  3SG6 A;  1C07 A;  4OKH A;  1YUU A;  4AOM A;  1XFV O;  1KFX S;  1F71 A;  2JT3 A;  4WQ2 A;  1AJ5 A;  2WAD A;  4YGD B;  1GQM A;  2KAY A;  3AAJ A;  2LP2 A;  3FE9 A;  2JT8 A;  4JKT A;  1CFF A;  1DGU A;  3TDB A;  4PE4 A;  5DKQ A;  2LP3 A;  2QEO A;  1UUS A;  2Y1M A;  1J7R A;  1TCF A;  4I5L B;  1GM0 A;  1IRJ A;  1YX8 A;  2YAJ B;  2M0R A;  1RRO A;  4YI9 A;  3K1E A;  3SS5 A;  4MVF A;  2GTE A;  1KK7 Y;  2QEV A;  1O6W A;  1QS7 A;  4FQO A;  1EG4 A;  1L2O C;  1DJH A;  3CZ1 A;  1EXR A;  2KAX A;  2MAZ A;  2KXQ A;  3TS5 C;  1R6P A;  1YX7 A;  5B8I B;  2F2P A;  3OHM B;  3TZ1 A;  1QWV A;  1UUR A;  3JVT C;  1AK8 A;  1SMG A;  1DF0 B;  4NDC A;  1YUR A;  3EKJ A;  5FI2 A;  4GAO A;  4U86 A;  2K7O A;  1UHJ A;  3JTD C;  4XJK A;  3SS3 A;  5BPJ A;  3TCZ A;  5CSI A;  4IL1 A;  3BFB A;  5HYD A;  3NHI A;  1QLK A;  2KBI A;  4ICB A;  1ALW A;  1KWO B;  2MRD A;  1B47 A;  3SIA A;  2MA2 A;  3C1V A;  3O4Y A;  2LHI A;  1CB1 A;  1LVC D;  1DVI A;  4YRU A;  2LV7 A;  3IF7 A;  1IJ6 A;  1KSM A;  1KSO A;  2WCK A;  3AKB A;  1M45 A;  3NSK A;  5K89 A;  1NX3 A;  2ZR4 A;  1J7Q A;  1Z4H A;  3DXL A;  4TNC A;  1ZFS A;  1XYD A;  1DEK A;  1OOI X;  1W7I B;  2NCP A;  3OB1 B;  5PAL A;  3KAF A;  1IGV A;  1RFJ A;  2KI6 D;  1YUS A;  2VRG A;  3QME A;  3NTP A;  2CNP A;  2KI4 B;  1M31 A;  3PAL A;  2KI6 C;  1DGV A;  4MZL A;  1YVL A;  3DVJ A;  5G08 A;  1TCO B;  1B9A A;  1E8A A;  1UHH A;  1WLM A;  5CSN A;  1B4C A;  2M8I A;  2ZAJ A;  4YGE B;  3IVT A;  3MQH A;  1Q80 A;  1MXL C;  2XP8 A;  4WQ3 A;  3SG7 A;  2NLN A;  2NXQ A;  3EK4 A;  1MXE A;  3EKH A;  1TOP A;  4OVN F;  1CNP A;  2NZ0 A;  1DMO A;  3WHU B;  1RTP 1;  1ZOT B;  1KWO C;  3S0G A;  1FBV A;  1TRF A;  4KYN A;  3BUW B;  5HKY A;  1SKT A;  2WC8 A;  1OW4 A;  2JOJ A;  2Y4Q A;  3S0F A;  4MLW A;  4CID A;  1QX7 A;  3EK7 A;  1CDP A;  2E30 A;  1AP4 A;  2L4I A;  3I5F C;  3I5I B;  3VGO A;  1S5G Z;  2DJY A;  2ZQU A;  1PRW A;  3B7A A;  3EVV A;  2CTN A;  2EZ5 W;  3KCE A;  1Y0V H;  1IG5 A;  1J7P A;  1CDL A;  1F70 A;  2M1U A;  1CFD A;  2JRF A;  2JV4 A;  2XP6 A;  2KI4 C;  3RZS A;  4DRW A;  1Y1U A;  1XVJ A;  3CS1 A;  4DIR A;  3E3R A;  1FI5 A;  3BUN B;  1LA0 A;  1SYM A;  2KBM A;  3L47 A;  1EG3 A;  1XFZ O;  4MN0 A;  3AAK A;  2I7A A;  1JWD A;  4PHN A;  2G9B A;  2FOT A;  1G4Y R;  4HRH A;  1SNL A;  1XK4 C;  3KPX A;  2P6B B;  1K9U A;  1PAL A;  2K60 A;  2Y5I A;  3NGV A;  1S5G Y;  2F33 A;  2KOT A;  3FIA A;  3NXA A;  5ER5 A;  1OZO A;  4AQI A;  3WXA A;  1F8H A;  2QDI A;  3PN7 B;  1XFR A;  2KLE A;  4M2O A;  4MEW A;  3KAB A;  2WCL A;  1RJV A;  2Q5A A;  2JTT A;  4QJ5 B;  1S6C A;  3IQQ A;  4E5R A;  1S3P A;  1QV1 A;  1PIN A;  2DK7 A;  2QEH A;  4HSZ A;  1GGW A;  2DWV A;  4DUQ A;  2ZQS A;  2WC6 A;  2L2E A;  4YBH B;  1BG1 A;  3I5I C;  2M7N A;  1NMV A;  1NSH A;  1SW8 A;  4PHK A;  3BOW B;  1CTR A;  4ORC B;  5HKW A;  2OTG B;  3BXK A;  4C0L A;  1CMF A;  2M97 A;  4MBE A;  3PLF B;  4GPL B;  2K7B A;  4GGN A;  2YSH A;  1UP5 A;  1TWO A;  2YGU A;  4NDB A;  1CFP A;  2AMI A;  1KQV A;  3D10 A;  3EG5 B;  1L2O B;  1DJI A;  2L5Y A;  3EVU A;  3D0Y A;  4QIB A;  5AHT A;  1B8L A;  4PHJ A;  3SG3 A;  4BY4 A;  2YSB A;  2JT0 A;  2JTZ A;  3LK1 A;  3R1P A;  4PAL A;  5HL1 A;  1NX2 A;  5AEQ A;  1RK9 A;  3GK1 A;  2JXL A;  3CZT X;  3CR4 X;  1BR4 B;  1WLZ A;  1AVS A;  2MLF C;  1IJ5 A;  1KK7 Z;  5CSF A;  3FS8 A;  2KHN A;  3K21 A;  4GUK A;  4MSP A;  1K8U A;  1XA5 A;  2JPT A;  3L4A A;  1C3Z A;  1FF1 A;  2LLT A;  3BUO B;  1U5I A;  1SSE B;  4CPV A;  3B87 A;  2XP4 A;  2O5G A;  1B7T Z;  1OMV A;  3CZ0 A;  3D76 A;  1SY9 A;  2BKI B;  2L98 A;  2OTG C;  1IQ3 A;  2BA1 A;  3GOF A;  1QXP A;  4YGC B;  4PCW A;  1BF5 A;  3B86 A;  2JNF A;  2ZND A;  5D7F A;  1LKJ A;  3WHT B;  1JBA A;  2OPO A;  3D73 A;  3FSC A;  1S26 D;  1XFU O;  1ZUZ A;  2JXC A;  2RGI A;  1N65 A;  4OR9 B;  1DJW A;  1C7V A;  1K2H A;  4N1F A;  5I8N A;  1NX0 A;  1IWQ A;  4N1G A;  1B7T Y;  1RP5 A;  2ZNE A;  3SIB A;  2LUC A;  5CSJ A;  2L50 A;  2WC5 A;  1NCX A;  2JQ6 A;  2O60 A;  3D77 A;  1MF8 B;  3IQO A;  3S0A A;  2D8N A;  3ODK A;  1CLL A;  1TUJ A;  2KPH A;  3R72 A;  2WCH A;  3PSR A;  4Q04 A;  1KQM C;  1QIW A;  2KYF A;  3CR5 X;  1N2D A;  2ZRT A;  4JD9 A;  2KFG A;  2LLS A;  1BOC A;  3FWB A;  1XFW O;  3PFV A;  3SG2 A;  2LNK A;  2ZR5 A;  2ZN8 A;  1K93 D;  2K7D A;  2PSR A;  2EHB A;  3BFH A;  1HT9 A;  3BYA A;  3I5F B;  4N5X A;  1BLQ A;  1YW5 A;  3TC5 A;  4L9M A;  3MCB A;  5E65 A;  2TN4 A;  2HQW A;  4PDZ A;  5FYX A;  2JC2 A;  4OZD A;  4PE1 A;  1MQ1 A;  3D75 A;  4QJ4 B;  2E45 A;  2ZQT A;  1MR8 A;  2KFH A;  2EGD A;  2ERB A;  2ZKM X;  2WCE A;  4OCI A;  3OOB A;  2L2C A;  1YVH A;  3OX6 A;  4BY5 A;  2YSI A;  1KFU S;  1OMR A;  3LE4 A;  1DJG A;  1BU3 A;  1SL7 A;  2FJU B;  4M2P A;  1K9Q A;  1TK7 A;  5KTY A;  1TN4 A;  1OOF A;  1GJY A;  2FJY A;  2ZQV A;  2QEB A;  3KAI A;  3LKX A;  1ZMZ A;  2B1U A;  2MJW B;  1CDM A;  4HRG A;  3DYE A;  4ORA B;  3CNG A;  3CZ2 A;  3R1V A;  2XPB A;  3NHT A;  1Y1X A;  1YRT B;  2BAP A;  4MZK A;  1F4Q A;  2F8P A;  2PQL A;  2ZFD A;  3HX4 A;  5TNC A;  3CDN A;  2KDH A;  5KSZ A;  4CFQ A;  3BQ3 A;  2KNE A;  3M0W A;  3KAD A;  1OQP A;  1EH2 A;  4A0T A;  1A03 A;  5I94 A;  3SG4 A;  1PVA A;  1YR5 A;  2BEC A;  1A75 A;  3DVM A;  1ODB A;  4UPG A;  1OOJ A;  4GNK B;  5F6T A;  3KAG A;  4INW A;  1J1D A;  5KU1 A;  1BT6 A;  3BUM B;  1R2U A;  2PVB A;  3CWG A;  1K9R A;  1JUO A;  1JC2 A;  1A29 A;  1G8I A;  3NSL A;  4NDD A;  4AQJ A;  1NX1 A;  3O2P A;  1FW4 A;  2R2I A;  3DF0 A;  1M39 A;  4DCK A;  2BL0 B;  1WR7 A;  3KF9 A;  3V2L A;  2Q91 A;  1ORG A;  3L4H A;  1AHR A;  3SS4 A;  1OZS A;  5CQ2 A;  2H61 A;  3DY9 A;  2L5X B;  3D0Y B;  2LM5 A;  4U84 A;  3VRO A;  2M8U A;  2JNX A;  2CBL A;  2COL B;  3MSE B;  3WH0 A;  2F2O A;  1NWD A;  1Y1A A;  4C0J A;  1UHI A;  1KK8 B;  1SR6 C;  2K61 A;  1YRU B;  5GQQ C;  2SCP A;  3TDZ A;  3S0E A;  1KFU L;  2M29 A;  3CLN A;  3GK4 X;  1MWN A;  1SCM B;  3AKA A;  1MUX A;  3FE8 A;  2KQ6 A;  3ZNI A;  1OMD A;  2KGB C;  4I5N B;  2ZN9 A;  2WND A;  2I94 A;  3TUY C;  4A4C A;  1WDC B;  2M1K B;  4IJ7 A;  1Y6W A;  1MHO A;  3RM1 A;  2WCJ A;  1IIO A;  1SCV A;  1TNW A;  2BL0 C;  3VRN A;  1LIN A;  1PUL A;  3I5G C;  1QJT A;  2E6W A;  2KSP A;  5IBW A;  2XP3 A;  3N7H A;  1WY9 A;  1QAS A;  1B8R A;  2K2F A;  3BUX B;  5FI6 A;  1TR8 A;  2HF5 A;  5J3X A;  5I2Q A;  2DMV A;  4PE7 A;  2ZR6 A;  2JXW A;  2F3Y A;  1WRL A;  5AAN A;  4PE0 A;  1BMO A;  2WOS A;  2LAN A;  5D3O A;  2QRV A;  4E68 A;  1K95 A;  2I18 A;  4ETO A;  1KQM B;  4C0K A;  5AXI A;  1SL8 A;  4CLN A;  4XJK B;  1H8B A;  2MLE C;  3VRQ A;  1KK8 C;  3CGA A;  4GGF A;  4I5K A;  2JPO A;  2AUC A;  1FI6 A;  1DC1 A;  2HET A;  1SK6 D;  1OSA A;  3RLZ A;  1QV0 A;  1IKU A;  1SCM C;  3PM2 A;  2ISD A;  1DTL A;  2BBM A;  3WNX B;  2LVI A;  2GGZ A;  1VRK A;  2WCM A;  5E66 A;  1I5H W;  2A4J A;  1WDC C;  3ZWH A;  1A2X A;  4GBA A;  3KAH A;  4D1E A;  1WRZ A;  1BOD A;  3FE6 A;  4FQT A;  3MCB B;  1NUB A;  1QX2 A;  2L51 A;  1K94 A;  2FCE A;  2LMT A;  3BOW A;  3FS7 A;  1XFY O;  3VB1 A;  1S1E A;  4GLX A;  1UHN A;  5AER A;  4JQ0 D;  1TNX A;  2KAV A;  2LC5 A;  4HRE E;  2Y1N A;  1TIZ A;  2CCM A;  4MRX A;  1LS8 A;  1QIV A;  2BKH B;  1JFJ A;  1PSB A;  3S0D A;  1BR1 B;  2KGR A;  3CTN A;  1C3Y A;  3B88 A;  2H2K A;  3LCP C;  2LUX A;  1JMQ A;  2M49 B;  3NSI A;  3CYZ A;  1DT7 B;  3LKX B;  1IQ5 A;  1SBJ A;  2L4H A;  3CAB A;  3DVK A;  4WRI A;  5CPV A;  1FPW A;  2K0J A;  3LLE A;  2ITK A;  3LL8 B;  3A4U B;  2EC6 C;  5D69 A;  1NCY A;  5HLO A;  2GGM A;  1QLS A;  2FCD A;  1P28 A;  1CDN A;  1JSA A;  2YSF A;  1CKK A;  2YSG A;  2IS9 A;  3PQH A;  3PM8 A;  3H4S E;  2PAS A;  4OV2 A;  2BCA A;  2V53 A;  2PYQ A;  3PAT A;  4INX A;  2K2A A;  3KEV A;  1UWO A;  1LA3 A;  1XO5 A;  2H8V A;  1JF2 A;  4U85 A;  1DJY A;  1ZAC A;  2DOQ A;  2AAO A;  1A75 B;  1CLB A;  3SG5 A;  2LE9 B;  1V1F A;  3F45 A;  2LMU A;  4FTG A;  4M2Q A;  2L4J A;  3M85 A;  4XYN A;  1XFX O;  3FWC A;  1QVI Z;  1DJX A;  2LLU A;  2MBX A;  2LMV A;  2BE6 A;  1K90 D;  2K8M B;  1NP8 A;  3EK8 A;  1TNQ A;  3VRP A;  1Z2C B;  2XP7 A;  1YTZ C;  2SAS A;  1HQV A;  1CLM A;  3DF0 B;  1OE9 B;  5E64 A;  3Q8I A;  2KLD A;  1L7Z A;  4MRY A;  5HLV A;  2BBN A;  2KYC A;  2NCO A;  2P71 A;  5JJG A;  1CFC A;  2Y8N B;  1C7W A;  1F54 A;  3TDU A;  1DF0 A;  2F3Z A;  1LXF C;  3I5H B;  1GGZ A;  2LVJ A;  2Q4U A;  1QVI Y;  1NYA A;  3QRX A;  1SR6 B;  4JWQ A;  1UHK A;  1V1G A;  3MQG A;  1EJ3 A;  4USL A;  4YGA A;  1S36 A;  1M46 A;  1REC A;  4U8D A;  2KQY A;  3OBV A;  2K7C A;  1K9P A;  1KFX L;  3TUY B;  4REX A;  2P70 A;  3O6B A;  1J55 A;  5AFP A;  3O78 A;  3OX5 A;  4ORB B;  3B6X A;  4R1E A;  2M3O W;  2WCF A;  1EL4 A;  1N0Y A;  2M3W A;  2I2R E;  4PHM A;  3I5G B;  2BCB A;  1OOG A;  4YGB B;  2F21 A;  4GFT A;  2L0P A;  1M63 B;  2OS8 B;  1PK0 D;  3NSO A;  3TDI A;  3ICB A;  3SJS A;  4CFR A;  1F4O A;  1WRK A;  3KO0 A;  2G2B A;  1JF0 A;  1TUZ A;  1QX5 B; 
#chains in the Genus database with same CATH homology
 1RWY A;  2LAP A;  2H61 C;  5ER4 X;  1AUI B;  2KFF A;  1ALV A;  2JUL A;  4I5J A;  1XK4 A;  2LHL A;  3I5H C;  4ZCU A;  2CT9 A;  1IH0 A;  1FLC A;  1KCY A;  2JZI A;  1AJ4 A;  4NQG A;  2LCP A;  1H4B A;  2LVV A;  4F0Z B;  1BJF A;  1CMG A;  2LAJ A;  2QAC A;  2PRU A;  4A4B A;  4P5O E;  3OB2 B;  2M8J A;  4JPZ B;  3CR2 A;  2JX8 A;  1QAT A;  2XP5 A;  4MZJ A;  1U5I B;  2M7L A;  1CM1 A;  5JOL A;  1X02 A;  2MDI A;  1NIW A;  1A4P A;  1J7O A;  1CM4 A;  2BE4 A;  2WOR A;  2QPT A;  3EVR A;  2JU0 A;  2OS8 C;  3LK0 A;  1B8C A;  2GV5 A;  2WAE A;  1G33 A;  1PSR A;  4ZCV A;  2RE3 A;  5I2L A;  1S6J A;  1WMV A;  3HCM A;  1SRA A;  1S6I A;  1F55 A;  2HPS A;  1QTX A;  2OWO A;  2M9G A;  4P2Y B;  4A0U A;  1TTX A;  2ZRS A;  3DVE A;  2MHH A;  2JWW A;  4DS7 A;  1K96 A;  1SPY A;  2XP9 A;  2BCX A;  1NCZ A;  5DKN A;  5I2O A;  2HQ8 A;  1D1O A;  5U47 A;  2EC6 B;  3GK2 A;  5E62 A;  3M7N A;  2JMF A;  3FSB A;  3TS5 B;  1PVB A;  2PAL A;  1DJZ A;  4YI8 A;  1SL9 A;  3OP0 A;  1J1E A;  5DKR A;  4GGF C;  5E5W A;  3KHE A;  3JVT B;  1W7J B;  1TNP A;  3PN7 C;  1B1G A;  1K9K A;  2DK1 A;  3JTD B;  1F8A B;  2CXJ A;  3VRR A;  5HKZ A;  2PMY A;  3A8R A;  4QJ3 B;  1NPQ A;  1JFK A;  2LVK A;  2WCB A;  1ZCN A;  2XPA A;  3DD4 A;  1YUT A;  1C07 A;  3SG6 A;  4OKH A;  1YUU A;  4AOM A;  1XFV O;  1KFX S;  1F71 A;  2JT3 A;  4WQ2 A;  1AJ5 A;  2WAD A;  4YGD B;  1GQM A;  2KAY A;  3AAJ A;  2LP2 A;  2JT8 A;  1CFF A;  1DGU A;  3TDB A;  4PE4 A;  5DKQ A;  2LP3 A;  2Y1M A;  1UUS A;  1J7R A;  1TCF A;  4I5L B;  1IRJ A;  1YX8 A;  2YAJ B;  2M0R A;  1RRO A;  4YI9 A;  4MVF A;  1O6W A;  1KK7 Y;  1QS7 A;  4FQO A;  1EG4 A;  1L2O C;  1DJH A;  2KXQ A;  1EXR A;  2KAX A;  2MAZ A;  3TS5 C;  1R6P A;  1YX7 A;  5B8I B;  2F2P A;  3OHM B;  3TZ1 A;  1UUR A;  3JVT C;  1AK8 A;  1SMG A;  1DF0 B;  4NDC A;  1YUR A;  3EKJ A;  4GAO A;  4U86 A;  2K7O A;  1UHJ A;  3JTD C;  4XJK A;  5BPJ A;  3TCZ A;  5CSI A;  4IL1 A;  5HYD A;  1QLK A;  2KBI A;  4ICB A;  1ALW A;  1KWO B;  2MRD A;  1B47 A;  3SIA A;  2MA2 A;  3C1V A;  3O4Y A;  2LHI A;  1CB1 A;  1LVC D;  1DVI A;  4YRU A;  2LV7 A;  3IF7 A;  1IJ6 A;  1KSM A;  1KSO A;  3AKB A;  3NSK A;  1M45 A;  5K89 A;  2ZR4 A;  1NX3 A;  1J7Q A;  4TNC A;  1ZFS A;  1XYD A;  1W7I B;  5PAL A;  2NCP A;  3KAF A;  3OB1 B;  1IGV A;  1RFJ A;  2KI6 D;  1YUS A;  2VRG A;  3NTP A;  2CNP A;  2KI4 B;  1M31 A;  3PAL A;  2KI6 C;  1DGV A;  4MZL A;  1YVL A;  3DVJ A;  5G08 A;  1TCO B;  1B9A A;  1E8A A;  1UHH A;  1WLM A;  5CSN A;  1B4C A;  2M8I A;  2ZAJ A;  4YGE B;  3MQH A;  1Q80 A;  1MXL C;  2XP8 A;  4WQ3 A;  3SG7 A;  2NLN A;  2NXQ A;  3EK4 A;  1MXE A;  3EKH A;  1TOP A;  4OVN F;  1CNP A;  2NZ0 A;  1DMO A;  3WHU B;  1RTP 1;  1ZOT B;  1KWO C;  1FBV A;  1TRF A;  3BUW B;  5HKY A;  1SKT A;  2WC8 A;  2JOJ A;  2Y4Q A;  4MLW A;  4CID A;  1QX7 A;  3EK7 A;  1CDP A;  2E30 A;  1AP4 A;  2L4I A;  3I5F C;  3I5I B;  3VGO A;  1S5G Z;  2DJY A;  2ZQU A;  1PRW A;  3EVV A;  2CTN A;  2EZ5 W;  3KCE A;  1Y0V H;  1IG5 A;  1J7P A;  1CDL A;  1F70 A;  2M1U A;  1CFD A;  2JRF A;  2JV4 A;  2XP6 A;  2KI4 C;  4DRW A;  1Y1U A;  1XVJ A;  3CS1 A;  4DIR A;  3E3R A;  1FI5 A;  3BUN B;  1LA0 A;  1SYM A;  2KBM A;  4MN0 A;  1EG3 A;  1XFZ O;  3AAK A;  2I7A A;  1JWD A;  4PHN A;  2G9B A;  2FOT A;  1G4Y R;  4HRH A;  1SNL A;  1XK4 C;  3KPX A;  2P6B B;  1K9U A;  1PAL A;  2Y5I A;  3NXA A;  1S5G Y;  2F33 A;  2KOT A;  3FIA A;  4AQI A;  5ER5 A;  1OZO A;  3WXA A;  1F8H A;  3PN7 B;  4M2O A;  4MEW A;  3KAB A;  1RJV A;  2Q5A A;  2JTT A;  4QJ5 B;  1S6C A;  3IQQ A;  4E5R A;  1S3P A;  1QV1 A;  1PIN A;  2DK7 A;  4HSZ A;  1GGW A;  2DWV A;  4DUQ A;  2ZQS A;  1BG1 A;  2L2E A;  4YBH B;  3I5I C;  2M7N A;  1NMV A;  1NSH A;  1SW8 A;  4PHK A;  3BOW B;  1CTR A;  4ORC B;  5HKW A;  2OTG B;  3BXK A;  4C0L A;  1CMF A;  2M97 A;  4MBE A;  3PLF B;  4GPL B;  2K7B A;  4GGN A;  2YSH A;  1UP5 A;  1CFP A;  1KQV A;  4NDB A;  2AMI A;  3D10 A;  1L2O B;  1DJI A;  3EVU A;  4QIB A;  3D0Y A;  5AHT A;  1B8L A;  4PHJ A;  3SG3 A;  4BY4 A;  2YSB A;  2JT0 A;  2JTZ A;  3LK1 A;  4PAL A;  1NX2 A;  5AEQ A;  1RK9 A;  3GK1 A;  2JXL A;  3CZT X;  3CR4 X;  1BR4 B;  1WLZ A;  1AVS A;  2MLF C;  1IJ5 A;  1KK7 Z;  5CSF A;  3FS8 A;  2KHN A;  3K21 A;  4GUK A;  4MSP A;  1K8U A;  1XA5 A;  2JPT A;  1FF1 A;  2LLT A;  3BUO B;  1U5I A;  4CPV A;  2XP4 A;  2O5G A;  1B7T Z;  1OMV A;  1IQ3 A;  1SY9 A;  2BKI B;  2L98 A;  2OTG C;  2BA1 A;  3GOF A;  1QXP A;  4YGC B;  4PCW A;  1BF5 A;  2JNF A;  2ZND A;  5D7F A;  1LKJ A;  3WHT B;  1JBA A;  2OPO A;  3FSC A;  1S26 D;  1XFU O;  1ZUZ A;  2JXC A;  2RGI A;  1N65 A;  4OR9 B;  1DJW A;  1C7V A;  1K2H A;  4N1F A;  5I8N A;  1NX0 A;  1IWQ A;  4N1G A;  1B7T Y;  1RP5 A;  2ZNE A;  3SIB A;  2LUC A;  5CSJ A;  2L50 A;  1NCX A;  2JQ6 A;  2O60 A;  1MF8 B;  3IQO A;  2D8N A;  3ODK A;  1CLL A;  3PSR A;  4Q04 A;  1KQM C;  1QIW A;  2KYF A;  3CR5 X;  1N2D A;  2ZRT A;  2KFG A;  2LLS A;  1BOC A;  3FWB A;  1XFW O;  3PFV A;  3SG2 A;  2LNK A;  2ZR5 A;  2ZN8 A;  1K93 D;  2K7D A;  2PSR A;  2EHB A;  3BYA A;  1HT9 A;  3I5F B;  1BLQ A;  4N5X A;  1YW5 A;  3TC5 A;  4L9M A;  3MCB A;  5E65 A;  2TN4 A;  2HQW A;  4PDZ A;  5FYX A;  2JC2 A;  4PE1 A;  4QJ4 B;  1MQ1 A;  2E45 A;  2ZQT A;  1MR8 A;  2KFH A;  2EGD A;  3OOB A;  2ZKM X;  2WCE A;  4OCI A;  3OX6 A;  1YVH A;  4BY5 A;  2YSI A;  1KFU S;  1OMR A;  3LE4 A;  1DJG A;  1BU3 A;  1SL7 A;  2FJU B;  4M2P A;  1K9Q A;  1TK7 A;  5KTY A;  1TN4 A;  3LKX A;  1GJY A;  2ZQV A;  3KAI A;  1ZMZ A;  2B1U A;  2MJW B;  1CDM A;  4HRG A;  4ORA B;  3CNG A;  2XPB A;  1Y1X A;  1YRT B;  4MZK A;  1F4Q A;  2F8P A;  2ZFD A;  3HX4 A;  5TNC A;  2KDH A;  5KSZ A;  4CFQ A;  3BQ3 A;  2KNE A;  3M0W A;  3KAD A;  1OQP A;  1EH2 A;  4A0T A;  1A03 A;  3SG4 A;  1PVA A;  1YR5 A;  2BEC A;  1A75 A;  3DVM A;  1ODB A;  4UPG A;  1OOJ A;  4GNK B;  5F6T A;  3KAG A;  1J1D A;  5KU1 A;  1BT6 A;  3BUM B;  1R2U A;  2PVB A;  3CWG A;  1K9R A;  1JUO A;  1JC2 A;  1A29 A;  1G8I A;  3NSL A;  4NDD A;  4AQJ A;  1NX1 A;  3O2P A;  1FW4 A;  2R2I A;  3DF0 A;  1M39 A;  4DCK A;  2BL0 B;  1WR7 A;  3KF9 A;  2Q91 A;  3L4H A;  1AHR A;  1OZS A;  5CQ2 A;  2H61 A;  2L5X B;  3D0Y B;  2LM5 A;  4U84 A;  3VRO A;  2M8U A;  2JNX A;  2CBL A;  2COL B;  3MSE B;  3WH0 A;  2F2O A;  1NWD A;  1Y1A A;  4C0J A;  1UHI A;  1KK8 B;  1SR6 C;  2K61 A;  1YRU B;  5GQQ C;  2SCP A;  3TDZ A;  1KFU L;  2M29 A;  3CLN A;  3GK4 X;  1MWN A;  1SCM B;  3AKA A;  1MUX A;  2KQ6 A;  3ZNI A;  1OMD A;  2KGB C;  4I5N B;  2ZN9 A;  2WND A;  2I94 A;  3TUY C;  4A4C A;  1WDC B;  2M1K B;  1Y6W A;  1MHO A;  3RM1 A;  1SCV A;  1TNW A;  2BL0 C;  3VRN A;  1LIN A;  1PUL A;  3I5G C;  1QJT A;  2E6W A;  2KSP A;  5IBW A;  2XP3 A;  1WY9 A;  1QAS A;  1B8R A;  2K2F A;  3BUX B;  1TR8 A;  2DMV A;  2HF5 A;  5J3X A;  5I2Q A;  4PE7 A;  2ZR6 A;  2JXW A;  2F3Y A;  1WRL A;  5AAN A;  4PE0 A;  1BMO A;  2WOS A;  2LAN A;  2QRV A;  4E68 A;  1K95 A;  2I18 A;  4ETO A;  1KQM B;  4C0K A;  5AXI A;  1SL8 A;  4CLN A;  4XJK B;  1H8B A;  2MLE C;  3VRQ A;  1KK8 C;  3CGA A;  4GGF A;  4I5K A;  1FI6 A;  2AUC A;  2HET A;  1SK6 D;  1OSA A;  3RLZ A;  1QV0 A;  1IKU A;  1SCM C;  2ISD A;  1DTL A;  2BBM A;  3WNX B;  2LVI A;  2GGZ A;  1VRK A;  5E66 A;  1I5H W;  2A4J A;  1WDC C;  3ZWH A;  1A2X A;  4GBA A;  3KAH A;  4D1E A;  1WRZ A;  1BOD A;  3MCB B;  1NUB A;  1QX2 A;  2L51 A;  1K94 A;  2FCE A;  2LMT A;  3BOW A;  3FS7 A;  1XFY O;  4GLX A;  1S1E A;  1UHN A;  5AER A;  4JQ0 D;  1TNX A;  2KAV A;  2LC5 A;  4HRE E;  2Y1N A;  1TIZ A;  2CCM A;  4MRX A;  1QIV A;  2BKH B;  1JFJ A;  1PSB A;  1BR1 B;  2KGR A;  3CTN A;  2H2K A;  3LCP C;  2LUX A;  1JMQ A;  2M49 B;  3NSI A;  1DT7 B;  3LKX B;  1IQ5 A;  1SBJ A;  2L4H A;  3DVK A;  4WRI A;  5CPV A;  1FPW A;  2K0J A;  3LLE A;  2ITK A;  3LL8 B;  3A4U B;  2EC6 C;  5D69 A;  1NCY A;  5HLO A;  2GGM A;  1QLS A;  2FCD A;  1CDN A;  1JSA A;  2YSF A;  1CKK A;  2YSG A;  2IS9 A;  3PQH A;  3PM8 A;  3H4S E;  2PAS A;  4OV2 A;  2BCA A;  2V53 A;  3PAT A;  2K2A A;  3KEV A;  1UWO A;  1LA3 A;  1XO5 A;  1JF2 A;  4U85 A;  1DJY A;  1ZAC A;  2DOQ A;  2AAO A;  1A75 B;  1CLB A;  3SG5 A;  2LE9 B;  1V1F A;  3F45 A;  2LMU A;  4FTG A;  4M2Q A;  2L4J A;  3M85 A;  4XYN A;  1XFX O;  3FWC A;  1QVI Z;  1DJX A;  2LLU A;  2MBX A;  2LMV A;  2BE6 A;  1K90 D;  2K8M B;  1NP8 A;  3EK8 A;  1TNQ A;  3VRP A;  2XP7 A;  1YTZ C;  2SAS A;  1HQV A;  1CLM A;  3DF0 B;  1OE9 B;  5E64 A;  1L7Z A;  4MRY A;  5HLV A;  2BBN A;  2KYC A;  2NCO A;  5JJG A;  1CFC A;  2Y8N B;  1C7W A;  1F54 A;  3TDU A;  1DF0 A;  2F3Z A;  1LXF C;  3I5H B;  1GGZ A;  2LVJ A;  2Q4U A;  1QVI Y;  1NYA A;  3QRX A;  1SR6 B;  4JWQ A;  1UHK A;  1V1G A;  3MQG A;  1EJ3 A;  4USL A;  4YGA A;  1S36 A;  1M46 A;  1REC A;  4U8D A;  2KQY A;  2K7C A;  1K9P A;  1KFX L;  3TUY B;  4REX A;  3O6B A;  5AFP A;  1J55 A;  3O78 A;  3OX5 A;  4ORB B;  4R1E A;  2M3O W;  2WCF A;  1EL4 A;  1N0Y A;  2M3W A;  2I2R E;  4PHM A;  3I5G B;  2BCB A;  4YGB B;  2F21 A;  4GFT A;  2L0P A;  1M63 B;  2OS8 B;  1PK0 D;  3NSO A;  3TDI A;  3ICB A;  3SJS A;  4CFR A;  1F4O A;  1WRK A;  3KO0 A;  2G2B A;  1JF0 A;  1QX5 B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...