2JMFA

Solution structure of the su(dx) ww4- notch py peptide complex
Total Genus 2
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
2
sequence length
43
structure length
43
Chain Sequence
VSLINEGPLPPGWEIRYTAAGERFFVDHNTRRTTFEDPRPGAP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords E3 ubiquitin-protein ligase suppressor of deltex
publication title Specificity and Autoregulation of Notch Binding by Tandem WW Domains in Suppressor of Deltex
pubmed doi rcsb
source organism Drosophila melanogaster
molecule tags Ligase/signaling protein
total genus 2
structure length 43
sequence length 43
ec nomenclature ec 2.3.2.26: HECT-type E3 ubiquitin transferase.
pdb deposition date 2006-11-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00397 WW WW domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.20.70.10 Mainly Beta Single Sheet Ubiquitin Ligase Nedd4; Chain: W; Ubiquitin Ligase Nedd4; Chain: W; 2jmfA01
2DK1A 2XP6A 4U85A 2DK7A 4U86A 3KAGA 2JV4A 1EG4A 3LE4A 1I5HW 4REXA 3WH0A 2LAJA 3KAIA 5CQ2A 2ZQUA 1O6WA 2M8IA 1NMVA 2M3OW 3TDBA 2ZQSA 2XP7A 1EG3A 2KXQA 3ODKA 3KABA 2XPBA 1K9QA 1WR7A 1F8AB 2E45A 1JMQA 2Q5AA 5AHTA 3TC5A 2ZR6A 2ZQVA 1WMVA 2DJYA 2YSFA 3KCEA 2MDIA 3OOBA 2ZQTA 3NTPA 2JX8A 2ITKA 1ZCNA 2EZ5W 1K9RA 2JMFA 3KAFA 2XPAA 4U84A 3M85A 2ZAJA 3CNGA 2XP8A 2ZR5A 2XP9A 2YSIA 2YSHA 4E5RA 2XP3A 2XP4A 3M7NA 2M8JA 2L4JA 2DMVA 3KADA 2YSBA 2BA1A 3TCZA 1TK7A 2ZR4A 4QIBA 1PINA 2YSGA 2DWVA 1YW5A 2XP5A 3L4HA 2F21A 2RE3A 2JXWA 3KAHA
chains in the Genus database with same CATH superfamily
5E66A 3MCBA 2DK1A 2XP6A 4U85A 2DK7A 4U86A 4GLXA 3KAGA 2JV4A 1EG4A 3LE4A 3FS8A 1I5HW 4REXA 3WH0A 2OWOA 1FLCA 2LAJA 3KAIA 5CQ2A 2ZQUA 1O6WA 2M8IA 1NMVA 2M3OW 3TDBA 2ZQSA 2XP7A 1EG3A 3MCBB 2KXQA 3ODKA 3KABA 2XPBA 5E65A 1K9QA 3MQGA 1WR7A 1F8AB 2E45A 2Y8NB 3FSCA 1JMQA 2Q5AA 5AHTA 3TC5A 2ZR6A 2ZQVA 5U47A 1WMVA 2DJYA 2YSFA 3KCEA 2MDIA 3OOBA 2YAJB 4A0TA 2ZQTA 3MQHA 3NTPA 2JX8A 5E5WA 2ITKA 1ZCNA 2WADA 2EZ5W 1K9RA 2WAEA 2JMFA 3KAFA 2XPAA 4U84A 5E62A 3M85A 2ZAJA 3LKXA 3CNGA 2XP8A 2ZR5A 2XP9A 2YSIA 2YSHA 4E5RA 1TR8A 2XP3A 3PQHA 2XP4A 3M7NA 2M8JA 2L4JA 2DMVA 1RP5A 3KADA 2YSBA 2BA1A 2QRVA 3FSBA 1TK7A 2ZR4A 4QIBA 3TCZA 1PINA 2YSGA 3LKXB 2DWVA 1YW5A 2XP5A 3L4HA 4A0UA 2F21A 2RE3A 2JXWA 5E64A 3KAHA
chains in the Genus database with same CATH topology
5E66A 3MCBA 2DK1A 2XP6A 4U85A 2DK7A 4U86A 4GLXA 3KAGA 2JV4A 1EG4A 3LE4A 3FS8A 1I5HW 4REXA 3WH0A 2OWOA 1FLCA 2LAJA 3KAIA 5CQ2A 2ZQUA 1O6WA 2M8IA 1NMVA 2M3OW 3TDBA 2ZQSA 2XP7A 1EG3A 3MCBB 2KXQA 3ODKA 3KABA 2XPBA 5E65A 1K9QA 3MQGA 1WR7A 1F8AB 2E45A 2Y8NB 3FSCA 1JMQA 2Q5AA 5AHTA 3TC5A 2ZR6A 2ZQVA 5U47A 1WMVA 2DJYA 2YSFA 3KCEA 2MDIA 3OOBA 2YAJB 4A0TA 2ZQTA 3MQHA 3NTPA 2JX8A 5E5WA 2ITKA 1ZCNA 2WADA 2EZ5W 1K9RA 2WAEA 2JMFA 3KAFA 2XPAA 4U84A 5E62A 3M85A 2ZAJA 3LKXA 3CNGA 2XP8A 2ZR5A 2XP9A 2YSIA 2YSHA 4E5RA 1TR8A 2XP3A 3PQHA 2XP4A 3M7NA 2M8JA 2L4JA 2DMVA 1RP5A 3KADA 2YSBA 2BA1A 2QRVA 3FSBA 1TK7A 2ZR4A 4QIBA 3TCZA 1PINA 2YSGA 3LKXB 2DWVA 1YW5A 2XP5A 3L4HA 4A0UA 2F21A 2RE3A 2JXWA 5E64A 3KAHA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2DK1 A;  2XP6 A;  4U85 A;  2DK7 A;  4U86 A;  3KAG A;  2JV4 A;  1EG4 A;  3LE4 A;  1I5H W;  4REX A;  3WH0 A;  2LAJ A;  3KAI A;  5CQ2 A;  2ZQU A;  1O6W A;  2M8I A;  1NMV A;  2M3O W;  3TDB A;  2ZQS A;  2XP7 A;  1EG3 A;  2KXQ A;  3ODK A;  3KAB A;  2XPB A;  1K9Q A;  1WR7 A;  1F8A B;  2E45 A;  1JMQ A;  2Q5A A;  5AHT A;  3TC5 A;  2ZR6 A;  2ZQV A;  1WMV A;  2DJY A;  2YSF A;  3KCE A;  2MDI A;  3OOB A;  2ZQT A;  3NTP A;  2JX8 A;  2ITK A;  1ZCN A;  2EZ5 W;  1K9R A;  2JMF A;  3KAF A;  2XPA A;  4U84 A;  3M85 A;  2ZAJ A;  3CNG A;  2XP8 A;  2ZR5 A;  2XP9 A;  2YSI A;  2YSH A;  4E5R A;  2XP3 A;  2XP4 A;  3M7N A;  2M8J A;  2L4J A;  2DMV A;  3KAD A;  2YSB A;  2BA1 A;  3TCZ A;  1TK7 A;  2ZR4 A;  4QIB A;  1PIN A;  2YSG A;  2DWV A;  1YW5 A;  2XP5 A;  3L4H A;  2F21 A;  2RE3 A;  2JXW A;  3KAH A; 
#chains in the Genus database with same CATH topology
 5E66 A;  3MCB A;  2DK1 A;  2XP6 A;  4U85 A;  2DK7 A;  4U86 A;  4GLX A;  3KAG A;  2JV4 A;  1EG4 A;  3LE4 A;  3FS8 A;  1I5H W;  4REX A;  3WH0 A;  2OWO A;  1FLC A;  2LAJ A;  3KAI A;  5CQ2 A;  2ZQU A;  1O6W A;  2M8I A;  1NMV A;  2M3O W;  3TDB A;  2ZQS A;  2XP7 A;  1EG3 A;  3MCB B;  2KXQ A;  3ODK A;  3KAB A;  2XPB A;  5E65 A;  1K9Q A;  3MQG A;  1WR7 A;  1F8A B;  2E45 A;  2Y8N B;  3FSC A;  1JMQ A;  2Q5A A;  5AHT A;  3TC5 A;  2ZR6 A;  2ZQV A;  5U47 A;  1WMV A;  2DJY A;  2YSF A;  3KCE A;  2MDI A;  3OOB A;  2YAJ B;  4A0T A;  2ZQT A;  3MQH A;  3NTP A;  2JX8 A;  5E5W A;  2ITK A;  1ZCN A;  2WAD A;  2EZ5 W;  1K9R A;  2WAE A;  2JMF A;  3KAF A;  2XPA A;  4U84 A;  5E62 A;  3M85 A;  2ZAJ A;  3LKX A;  3CNG A;  2XP8 A;  2ZR5 A;  2XP9 A;  2YSI A;  2YSH A;  4E5R A;  1TR8 A;  2XP3 A;  3PQH A;  2XP4 A;  3M7N A;  2M8J A;  2L4J A;  2DMV A;  1RP5 A;  3KAD A;  2YSB A;  2BA1 A;  2QRV A;  3FSB A;  1TK7 A;  2ZR4 A;  4QIB A;  3TCZ A;  1PIN A;  2YSG A;  3LKX B;  2DWV A;  1YW5 A;  2XP5 A;  3L4H A;  4A0U A;  2F21 A;  2RE3 A;  2JXW A;  5E64 A;  3KAH A; 
#chains in the Genus database with same CATH homology
 5E66 A;  3MCB A;  2DK1 A;  2XP6 A;  4U85 A;  2DK7 A;  4U86 A;  4GLX A;  3KAG A;  2JV4 A;  1EG4 A;  3LE4 A;  3FS8 A;  1I5H W;  4REX A;  3WH0 A;  2OWO A;  1FLC A;  2LAJ A;  3KAI A;  5CQ2 A;  2ZQU A;  1O6W A;  2M8I A;  1NMV A;  2M3O W;  3TDB A;  2ZQS A;  2XP7 A;  1EG3 A;  3MCB B;  2KXQ A;  3ODK A;  3KAB A;  2XPB A;  5E65 A;  1K9Q A;  3MQG A;  1WR7 A;  1F8A B;  2E45 A;  2Y8N B;  3FSC A;  1JMQ A;  2Q5A A;  5AHT A;  3TC5 A;  2ZR6 A;  2ZQV A;  5U47 A;  1WMV A;  2DJY A;  2YSF A;  3KCE A;  2MDI A;  3OOB A;  2YAJ B;  4A0T A;  2ZQT A;  3MQH A;  3NTP A;  2JX8 A;  5E5W A;  2ITK A;  1ZCN A;  2WAD A;  2EZ5 W;  1K9R A;  2WAE A;  2JMF A;  3KAF A;  2XPA A;  4U84 A;  5E62 A;  3M85 A;  2ZAJ A;  3LKX A;  3CNG A;  2XP8 A;  2ZR5 A;  2XP9 A;  2YSI A;  2YSH A;  4E5R A;  1TR8 A;  2XP3 A;  3PQH A;  2XP4 A;  3M7N A;  2M8J A;  2L4J A;  2DMV A;  1RP5 A;  3KAD A;  2YSB A;  2BA1 A;  2QRV A;  3FSB A;  1TK7 A;  2ZR4 A;  4QIB A;  3TCZ A;  1PIN A;  2YSG A;  3LKX B;  2DWV A;  1YW5 A;  2XP5 A;  3L4H A;  4A0U A;  2F21 A;  2RE3 A;  2JXW A;  5E64 A;  3KAH A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...