2JMFA

Solution structure of the su(dx) ww4- notch py peptide complex
Total Genus 2
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
2
sequence length
43
structure length
43
Chain Sequence
VSLINEGPLPPGWEIRYTAAGERFFVDHNTRRTTFEDPRPGAP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Ligase/signaling protein
molecule keywords E3 ubiquitin-protein ligase suppressor of deltex
publication title Specificity and Autoregulation of Notch Binding by Tandem WW Domains in Suppressor of Deltex
pubmed doi rcsb
source organism Drosophila melanogaster
total genus 2
structure length 43
sequence length 43
ec nomenclature ec 2.3.2.26: HECT-type E3 ubiquitin transferase.
pdb deposition date 2006-11-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00397 WW WW domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.20.70.10 Mainly Beta Single Sheet Ubiquitin Ligase Nedd4; Chain: W; Ubiquitin Ligase Nedd4; Chain: W; 2jmfA01
4U86A 2JX8A 1EG4A 3KADA 2DWVA 3KAFA 2M8JA 3TCZA 1F8AB 2DMVA 2ITKA 2ZAJA 3M7NA 3NTPA 1ZCNA 2XP9A 5CQ2A 2ZQSA 3M85A 2MDIA 2DK7A 2M3OW 2XP6A 3OOBA 2ZQTA 4E5RA 1PINA 2L4JA 1K9QA 3KAHA 2JV4A 4REXA 1YW5A 2M8IA 2LAJA 2DJYA 2RE3A 2XP7A 2YSBA 2KXQA 2XP4A 3L4HA 1WR7A 3LE4A 2YSHA 1JMQA 2Q5AA 2YSIA 5AHTA 3KABA 2ZR4A 4QIBA 3TDBA 3WH0A 3CNGA 2YSFA 3KAIA 3KAGA 2XPAA 3ODKA 2EZ5W 2ZR6A 4U85A 4U84A 2ZR5A 2ZQUA 2XP8A 3KCEA 2F21A 2BA1A 2DK1A 2E45A 1K9RA 1O6WA 2JMFA 2XP3A 3TC5A 2JXWA 2YSGA 1NMVA 1WMVA 2XP5A 1EG3A 2XPBA 2ZQVA 1I5HW 1TK7A
chains in the Genus database with same CATH superfamily
3LKXB 4U86A 2JX8A 2QRVA 1EG4A 3KADA 2DWVA 3KAFA 2M8JA 5E62A 3TCZA 1F8AB 2DMVA 2ITKA 2ZAJA 4GLXA 3M7NA 3NTPA 1ZCNA 2XP9A 5CQ2A 2ZQSA 2WADA 3M85A 2MDIA 2DK7A 5E64A 2M3OW 2XP6A 3OOBA 2ZQTA 4E5RA 1PINA 2L4JA 1K9QA 3KAHA 1TR8A 2JV4A 1FLCA 3FSCA 4REXA 1YW5A 2M8IA 2LAJA 2DJYA 3FS8A 2RE3A 2XP7A 2YSBA 2KXQA 2XP4A 3MCBA 3L4HA 1WR7A 4A0UA 3LE4A 2YSHA 3PQHA 4A0TA 1JMQA 3MQHA 2Q5AA 2YSIA 5AHTA 3FSBA 3KABA 2ZR4A 4QIBA 3TDBA 3WH0A 3CNGA 2YSFA 2WAEA 3KAIA 3KAGA 2XPAA 2YAJB 3ODKA 2EZ5W 3LKXA 2ZR6A 4U85A 3MCBB 4U84A 2ZR5A 2ZQUA 2Y8NB 2XP8A 3KCEA 2F21A 2BA1A 2DK1A 5E66A 2E45A 1K9RA 2OWOA 1O6WA 2JMFA 2XP3A 3TC5A 2JXWA 1RP5A 3MQGA 2YSGA 1NMVA 1WMVA 2XP5A 5U47A 1EG3A 5E5WA 2XPBA 5E65A 2ZQVA 1I5HW 1TK7A
chains in the Genus database with same CATH topology
3LKXB 4U86A 2JX8A 2QRVA 1EG4A 3KADA 2DWVA 3KAFA 2M8JA 5E62A 3TCZA 1F8AB 2DMVA 2ITKA 2ZAJA 4GLXA 3M7NA 3NTPA 1ZCNA 2XP9A 5CQ2A 2ZQSA 2WADA 3M85A 2MDIA 2DK7A 5E64A 2M3OW 2XP6A 3OOBA 2ZQTA 4E5RA 1PINA 2L4JA 1K9QA 3KAHA 1TR8A 2JV4A 1FLCA 3FSCA 4REXA 1YW5A 2M8IA 2LAJA 2DJYA 3FS8A 2RE3A 2XP7A 2YSBA 2KXQA 2XP4A 3MCBA 3L4HA 1WR7A 4A0UA 3LE4A 2YSHA 3PQHA 4A0TA 1JMQA 3MQHA 2Q5AA 2YSIA 5AHTA 3FSBA 3KABA 2ZR4A 4QIBA 3TDBA 3WH0A 3CNGA 2YSFA 2WAEA 3KAIA 3KAGA 2XPAA 2YAJB 3ODKA 2EZ5W 3LKXA 2ZR6A 4U85A 3MCBB 4U84A 2ZR5A 2ZQUA 2Y8NB 2XP8A 3KCEA 2F21A 2BA1A 2DK1A 5E66A 2E45A 1K9RA 2OWOA 1O6WA 2JMFA 2XP3A 3TC5A 2JXWA 1RP5A 3MQGA 2YSGA 1NMVA 1WMVA 2XP5A 5U47A 1EG3A 5E5WA 2XPBA 5E65A 2ZQVA 1I5HW 1TK7A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4U86 A;  2JX8 A;  1EG4 A;  3KAD A;  2DWV A;  3KAF A;  2M8J A;  3TCZ A;  1F8A B;  2DMV A;  2ITK A;  2ZAJ A;  3M7N A;  3NTP A;  1ZCN A;  2XP9 A;  5CQ2 A;  2ZQS A;  3M85 A;  2MDI A;  2DK7 A;  2M3O W;  2XP6 A;  3OOB A;  2ZQT A;  4E5R A;  1PIN A;  2L4J A;  1K9Q A;  3KAH A;  2JV4 A;  4REX A;  1YW5 A;  2M8I A;  2LAJ A;  2DJY A;  2RE3 A;  2XP7 A;  2YSB A;  2KXQ A;  2XP4 A;  3L4H A;  1WR7 A;  3LE4 A;  2YSH A;  1JMQ A;  2Q5A A;  2YSI A;  5AHT A;  3KAB A;  2ZR4 A;  4QIB A;  3TDB A;  3WH0 A;  3CNG A;  2YSF A;  3KAI A;  3KAG A;  2XPA A;  3ODK A;  2EZ5 W;  2ZR6 A;  4U85 A;  4U84 A;  2ZR5 A;  2ZQU A;  2XP8 A;  3KCE A;  2F21 A;  2BA1 A;  2DK1 A;  2E45 A;  1K9R A;  1O6W A;  2JMF A;  2XP3 A;  3TC5 A;  2JXW A;  2YSG A;  1NMV A;  1WMV A;  2XP5 A;  1EG3 A;  2XPB A;  2ZQV A;  1I5H W;  1TK7 A; 
#chains in the Genus database with same CATH topology
 3LKX B;  4U86 A;  2JX8 A;  2QRV A;  1EG4 A;  3KAD A;  2DWV A;  3KAF A;  2M8J A;  5E62 A;  3TCZ A;  1F8A B;  2DMV A;  2ITK A;  2ZAJ A;  4GLX A;  3M7N A;  3NTP A;  1ZCN A;  2XP9 A;  5CQ2 A;  2ZQS A;  2WAD A;  3M85 A;  2MDI A;  2DK7 A;  5E64 A;  2M3O W;  2XP6 A;  3OOB A;  2ZQT A;  4E5R A;  1PIN A;  2L4J A;  1K9Q A;  3KAH A;  1TR8 A;  2JV4 A;  1FLC A;  3FSC A;  4REX A;  1YW5 A;  2M8I A;  2LAJ A;  2DJY A;  3FS8 A;  2RE3 A;  2XP7 A;  2YSB A;  2KXQ A;  2XP4 A;  3MCB A;  3L4H A;  1WR7 A;  4A0U A;  3LE4 A;  2YSH A;  3PQH A;  4A0T A;  1JMQ A;  3MQH A;  2Q5A A;  2YSI A;  5AHT A;  3FSB A;  3KAB A;  2ZR4 A;  4QIB A;  3TDB A;  3WH0 A;  3CNG A;  2YSF A;  2WAE A;  3KAI A;  3KAG A;  2XPA A;  2YAJ B;  3ODK A;  2EZ5 W;  3LKX A;  2ZR6 A;  4U85 A;  3MCB B;  4U84 A;  2ZR5 A;  2ZQU A;  2Y8N B;  2XP8 A;  3KCE A;  2F21 A;  2BA1 A;  2DK1 A;  5E66 A;  2E45 A;  1K9R A;  2OWO A;  1O6W A;  2JMF A;  2XP3 A;  3TC5 A;  2JXW A;  1RP5 A;  3MQG A;  2YSG A;  1NMV A;  1WMV A;  2XP5 A;  5U47 A;  1EG3 A;  5E5W A;  2XPB A;  5E65 A;  2ZQV A;  1I5H W;  1TK7 A; 
#chains in the Genus database with same CATH homology
 3LKX B;  4U86 A;  2JX8 A;  2QRV A;  1EG4 A;  3KAD A;  2DWV A;  3KAF A;  2M8J A;  5E62 A;  3TCZ A;  1F8A B;  2DMV A;  2ITK A;  2ZAJ A;  4GLX A;  3M7N A;  3NTP A;  1ZCN A;  2XP9 A;  5CQ2 A;  2ZQS A;  2WAD A;  3M85 A;  2MDI A;  2DK7 A;  5E64 A;  2M3O W;  2XP6 A;  3OOB A;  2ZQT A;  4E5R A;  1PIN A;  2L4J A;  1K9Q A;  3KAH A;  1TR8 A;  2JV4 A;  1FLC A;  3FSC A;  4REX A;  1YW5 A;  2M8I A;  2LAJ A;  2DJY A;  3FS8 A;  2RE3 A;  2XP7 A;  2YSB A;  2KXQ A;  2XP4 A;  3MCB A;  3L4H A;  1WR7 A;  4A0U A;  3LE4 A;  2YSH A;  3PQH A;  4A0T A;  1JMQ A;  3MQH A;  2Q5A A;  2YSI A;  5AHT A;  3FSB A;  3KAB A;  2ZR4 A;  4QIB A;  3TDB A;  3WH0 A;  3CNG A;  2YSF A;  2WAE A;  3KAI A;  3KAG A;  2XPA A;  2YAJ B;  3ODK A;  2EZ5 W;  3LKX A;  2ZR6 A;  4U85 A;  3MCB B;  4U84 A;  2ZR5 A;  2ZQU A;  2Y8N B;  2XP8 A;  3KCE A;  2F21 A;  2BA1 A;  2DK1 A;  5E66 A;  2E45 A;  1K9R A;  2OWO A;  1O6W A;  2JMF A;  2XP3 A;  3TC5 A;  2JXW A;  1RP5 A;  3MQG A;  2YSG A;  1NMV A;  1WMV A;  2XP5 A;  5U47 A;  1EG3 A;  5E5W A;  2XPB A;  5E65 A;  2ZQV A;  1I5H W;  1TK7 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...