1NMVA

Solution structure of human pin1
Total Genus 30
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
30
sequence length
163
structure length
163
Chain Sequence
MADEEKLPPGWEKRMSRSSGRVYYFNHITNASQWERPSGNSSSGGKNGQGEPARVRCSHLLVKHSQSRRPSSWRQEKITRTKEEALELINGYIQKIKSGEEDFESLASQFSDCSSAKARGDLGAFSRGQMQKPFEDASFALRTGEMSGPVFTDSGIHIILRTE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural Analysis of the Mitotic Regulator hPin1 in Solution: INSIGHTS INTO DOMAIN ARCHITECTURE AND SUBSTRATE BINDING.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Isomerase
molecule keywords Peptidyl-prolyl cis-trans isomerase NIMA-interacting 1
total genus 30
structure length 163
sequence length 163
ec nomenclature ec 5.2.1.8: Peptidylprolyl isomerase.
pdb deposition date 2003-01-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00397 WW WW domain
A PF00639 Rotamase PPIC-type PPIASE domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.20.70.10 Mainly Beta Single Sheet Ubiquitin Ligase Nedd4; Chain: W; Ubiquitin Ligase Nedd4; Chain: W; 1nmvA01
3.10.50.40 Alpha Beta Roll Chitinase A; domain 3 Chitinase A; domain 3 1nmvA02
2MLXA 4E5RA 1FKLA 3IKGA 3O5RA 1R9HA 2RURA 3KCEA 4J4NA 2M8IA 3MDYB 1J4RA 1EG4A 4REXA 1BKFA 5BXJA 1Q6IA 2F4EA 1N1AA 3RFWA 1JNSA 2XPBA 1FKJA 2PV1A 4ODOA 3KAHA 1JNTA 2IF4A 4ODRA 5DIUA 2Y78A 5GPGA 4DRQA 2DMVA 4TW8A 2DK1A 4DRPA 2M2AA 4TNSA 1WMVA 5HT1A 3O5DA 4W9PA 4ODNA 4U84A 2UZ5A 2DG9A 4IPXA 3UQIA 4FAPA 2LGOA 1FKHA 1YATA 2JXWA 3KAIA 2ITKA 3ODKA 2YSGA 3M85A 3KACA 1ROTA 2OFNA 4FN2A 4QT2A 3VAWA 2KO7A 1FD9A 2DK7A 1FKKA 5DITA 2KR7A 3O5LA 1NMVA 3O5QA 4QT3A 2EZ5W 3O5IA 1JVWA 4DH0A 2XP7A 2FAPA 2PPNA 2YSBA 3UF8A 2M08A 2RE3A 3B7XA 2LJ4A 1YW5A 1Q6HA 3PRDA 4DRHA 3O5MA 2AWGA 3JXVA 3O5JA 1O6WA 5AHTA 3M7NA 1ROUA 1EQ3A 3KAFA 2YSFA 2JMFA 2MLYA 3PRBA 5HW7A 1EYMA 4DRMA 2DG4A 4U85A 4IQ2A 4DRIA 4DROA 1TCOC 3NTPA 4ITZA 4LAVA 4IQCA 3O5GA 1BL4A 2RUCA 1EG3A 3TDBA 4O2TA 3IKDA 2ZR4A 1K9RA 3PA7A 2FKEA 4DZ3A 3TC5A 4JFJA 2ZR5A 2L2SA 2PV2A 3WH0A 2DWVA 1WR7A 1B6CA 1FKTA 4LAXA 3UI5A 1Y0OA 3O5KA 3O5FA 2F2DA 4MSPA 2Q5AA 2XP9A 1FKGA 2XP4A 2PV3A 3NI6A 2LPVA 1M5YA 4G50A 4BF8A 5J6EA 1J6YA 2YSIA 2KE0A 2ZQSA 1PINA 1FKDA 4DRNA 2F21A 5HW6A 2ZQTA 4QIBA 3O5OA 1QZ2A 2PBCA 2BA1A 2XP8A 1JMQA 1NSGA 1KT0A 2ZAJA 2RSEA 3CNGA 2XP6A 4G2PA 5D75A 5DIVA 4TW7A 2E45A 2XPAA 2ZQVA 2L4JA 4NNRA 4TX0A 3KADA 2PPPA 2MNTA 2KI3A 5HW8A 2JX8A 5HTGA 3O5EA 2KFWA 3KAGA 2KGJA 4JFKA 2XP5A 3JYMA 4W9QA 4DRKA 5HUAA 5I98A 3CGNA 1W26A 3IHZA 3UQBA 1U79A 2JV4A 1D7JA 1NMWA 4MGVA 2MPHA 1P5QA 4DT4A 4LAWA 3UI4A 1F40A 2D9FA 4GGQA 3IK8A 3OOBA 1TK7A 3L4HA 4ODLA 4DIPA 1ZCNA 5HKGA 3LE4A 4TW6A 1HXVA 2DJYA 1FKSA 2YSHA 4J4OA 4ODKA 4JFLA 3RGCA 4JFMA 4C02B 3O5PA 2XP3A 1J4IA 3KABA 2LAJA 1FKBA 1PBKA 2DG3A 2K8IA 2M1IA 2MDIA 2VCDA 4U86A 1D6OA 2RUQA 4ODQA 2RQSA 2M3OW 5HWBA 3TCZA 2MLZA 1I5HW 4TYOA 5B8IC 1C9HA 3CGMA 1FAPA 1D7HA 1K9QA 5CQ2A 3JYJA 4DZ2A 3NRKA 3I6CA 1T11A 1FJDA 1Q6UA 2JZVA 2N87A 2M8JA 2ZR6A 3GPKA 3KZ7A 4W9OA 4ODPA 3UQAA 5HWCA 4JYSA 1ZK6A 1Q1CA 2RUDA 1A7XA 3LUOA 4DRJA 1D7IA 1QPFA 1L1PA 4R0XA 4GIVA 1J4HA 1FKFA 2KXQA 4ODMA 4N19A 1FKRA 2ZQUA 3UI6A 2PPOA 2MF9A 2VN1A 3EY6A 1KT1A 3H9RB 1QPLA 3FAPA 1F8AB 4JFIA 2LKNA 4LAYA 1FKIA
chains in the Genus database with same CATH superfamily
2MLXA 1FKLA 2QF8A 3OA5A 2RURA 4J4NA 2M8IA 1J4RA 1EG4A 1BKFA 5GPRA 3ARVA 3ALGA 2XPBA 2PV1A 1JNTA 3ARXA 2Y78A 2DMVA 2YBUA 1HJXA 3CH9A 5HT1A 1W1TA 4ODNA 1KFWA 2B31A 4IPXA 3ODKA 3M85A 1WAWA 2OFNA 4QT2A 1FD9A 4R5EA 5DITA 1OWQA 2KR7A 2EZ5W 4WKHA 1JVWA 2XP7A 2PPNA 3B7XA 1YW5A 4HBOA 3O5JA 3JXVA 4Z2IA 1O6WA 3AROA 3FY1A 2DG4A 4U85A 5JH8A 1HJWA 1TR8A 4MAVA 3CHDA 2ZR4A 3PA7A 2FKEA 3TC5A 2PV2A 4LAXA 2DWVA 1XRVA 1GRJA 3O5KA 4MNMA 3CHFA 5J6EA 4A0UA 1FKDA 1QZ2A 1W9UA 1JMQA 2RSEA 1H0GA 4G2PA 2XP6A 3FSCA 3AS1A 4Z2KA 2JX8A 2KGJA 4DRKA 4AY1A 3CGNA 3UQBA 4NZCA 1NMWA 1F40A 1P5QA 2ETNA 1GOIA 4ODLA 1TK7A 4DIPA 5HKGA 2WAEA 1EIBA 4TW6A 2DT0A 3ARWA 4WJXA 1PBKA 2K8IA 1D6OA 2RQSA 2QRVA 1I5HW 1C9HA 2O9OA 3ARTA 3JYJA 1SR0A 1FJDA 1Q6UA 3KZ7A 2ZR6A 4W9OA 1UR8A 4ODPA 2DSWA 3LUOA 4DRJA 4R0XA 1IX5A 3GTYX 3ALFA 3CHEA 1KT1A 2LKNA 3B9DA 1E44A 3IKGA 2Y8NB 5E62A 2YAJB 5BXJA 2F4EA 1NWTA 5HTGA 1FFRA 5DIUA 2IF4A 5GPGA 4TW8A 4TNSA 1OGBA 3MQHA 2WM0A 4U84A 3UQIA 1E9LA 2ITKA 3KACA 4FN2A 3VAWA 1X6LA 2G8ZA 2IUZA 3O5IA 1E6ZA 4DH0A 2A3BA 1LL6A 4Z2JA 2YSBA 2LJ4A 1Q6HA 4DRHA 5DEZA 2AWGA 3M7NA 1ROUA 1EQ3A 2YSFA 2MLYA 4DRIA 1TCOC 3NTPA 4QZVB 1HKMA 1EG3A 3TDBA 1K9RA 3WQWA 4DWSD 2ZR5A 3WH0A 1FKTA 2DSVA 3O5FA 5HBFA 2XP9A 2YBTA 2LPVA 1W9PA 4BF8A 3FXYA 2KE0A 4MPKA 3ARSA 1PINA 4P8VA 4DRNA 2F21A 1HKIA 4A0TA 1KT0A 2WLYA 2DT3A 4NSBA 5DIVA 4TW7A 2E45A 1H0IA 2OLHA 4TX0A 1HJVA 3WL1A 5E64A 4IT6A 2KI3A 1CTNA 1LL7A 4MNKA 3KAGA 2XP5A 3JYMA 4URIA 4IT4A 3WD0A 1U79A 2JV4A 3LKXA 1D7JA 1GPFA 1ZBCA 2DSZA 4MGVA 4Z2GA 4MTVA 3AQUA 4GGQA 3OOBA 1HXVA 2AOSA 3BXWA 4P8WA 1EDQA 2ESCA 4ODKA 3RGCA 3WKZA 3PQHA 3MDYB 1RP5A 2M3OW 3RM4A 3TCZA 2MLZA 4TYOA 3AS0A 2WLZA 1FFQA 1D7HA 5GQBA 3NRKA 1T11A 3G6LA 3GPKA 2N87A 3UQAA 2RUDA 1A7XA 1QPFA 4GIVA 1FKFA 2KXQA 4ODMA 4N19A 3WL0A 3GU0A 1ZBVA 4JFIA 3LKXB 1VF8A 5DO2A 4E5RA 4DWSB 2OWOA 3O5RA 1R9HA 4S3KA 3KCEA 4P8UA 4REXA 1JNSA 1Q6IA 1N1AA 4ODOA 3KAHA 3ARRA 1OGGA 3PRAA 4ODRA 4DRQA 3B9EA 3RM9A 3O5DA 3PR9A 4W9PA 3WIJA 2UZ5A 1FKHA 1YATA 2JXWA 3CZ8A 2DK7A 1FKKA 1NH6A 3O5LA 1W1YA 3O5QA 4QT3A 3W4RA 2RE3A 3G6MA 1LG2A 4ZPVR 1JNDA 5HW7A 1ZU8A 1EYMA 1WNOA 1D2KA 4IQ2A 2F23A 4ITZA 4LAVA 1JNEA 2B5UB 3WD1A 3AS3A 3O5GA 4PTMA 4O2TA 3IKDA 2EULA 2WK2A 3UI5A 4Z2HA 2F2DA 4MSPA 2Q5AA 5U47A 1FKGA 2XP4A 2PV3A 3NI6A 2DPEA 1M5YA 4G50A 3FSBA 5E66A 4HARA 2ZQSA 4Z2LA 1W1PA 3MCBB 1K9TA 2PBCA 1NSGA 1W1VA 5D75A 3CNGA 4MNJA 3ARZA 2XPAA 3FS8A 4NNRA 3KADA 4XAKA 2PPPA 1SYTA 4WKFA 2MNTA 3O5EA 2KFWA 1LL4A 1ZBWA 4JFKA 3MCBA 4W9QA 5I98A 3IHZA 1EHNA 1X6NA 1NWRA 2MPHA 4DT4A 3UI4A 1WB0A 2D9FA 3IK8A 1ZCNA 3WQVA 4L3NA 2FDMA 2YSHA 4JFLA 4S3JA 3O5PA 1J4IA 1FKBA 2M1IA 2VCDA 4ZPTR 2DG3A 2MDIA 4ML4A 5HWBA 4KQZA 3ARPA 1LG1A 4KR0B 2A3AA 5B8IC 1O6IA 1UR9A 1FAPA 2DT2A 3CGMA 4HBEA 1E15A 1K9QA 5CQ2A 3WD2A 4GLXA 3WD3A 4JYSA 1ZK6A 1Q1CA 4MNLA 1ZL1A 1D7IA 1NWUA 2G41A 1J4HA 1ITXA 1FKRA 2ZQUA 3UI6A 3MQGA 2PPOA 1HKKA 3H9RB 3QOKA 4LAYA 1ZBKA 4WIWA 1E6NA 1E6PA 3RFWA 1FKJA 3AS2A 4DRPA 2DK1A 2M2AA 1WMVA 3B8SA 2A3EA 2DG9A 4FAPA 2LGOA 3KAIA 2YSGA 1ROTA 1HKJA 2KO7A 4ZPWR 1NWSA 1NMVA 1GUVA 3WD4A 2FAPA 4Q22A 4DWSA 3UF8A 2M08A 1W9VA 4ZS6A 3PRDA 3O5MA 3ARUA 3BMBA 5AHTA 4Q7NA 3KAFA 3PRBA 2JMFA 4LGXA 2WADA 4DRMA 5DF0A 4DROA 1E6RA 4IQCA 1JCHB 3RM8A 1BL4A 2RUCA 4WKAA 5E65A 4DZ3A 4DWSC 4JFJA 2L2SA 1WR7A 1B6CA 2A3CA 1Y0OA 3ARQA 1ZB5A 3EIPA 2YSIA 4UDMA 5HW6A 2ZQTA 4QIBA 3O5OA 2BA1A 2XP8A 2ZAJA 2ZQVA 3ARYA 2L4JA 5HW8A 1TFVA 5HUAA 1W26A 3RMEA 4W5UA 2PI6A 1LQ0A 4LAWA 1RD6A 3L4HA 2DSUA 3LE4A 1LJYA 2DJYA 1FKSA 4J4OA 4L72B 4C02B 4JFMA 2XP3A 1J6YA 3KABA 2LAJA 2O92A 4U86A 4WK9A 2RUQA 4ODQA 4DZ2A 2P4VA 2PN0A 3I6CA 5E5WA 2JZVA 2M8JA 5HWCA 3CHCA 3B9AA 1L1PA 1XHGA 2DT1A 2MF9A 2VN1A 3EY6A 4P8XA 1QPLA 3FAPA 1F8AB 1FLCA 1FKIA
chains in the Genus database with same CATH topology
2MLXA 1FKLA 2QF8A 3OA5A 2RURA 4J4NA 2M8IA 1J4RA 1EG4A 1BKFA 5GPRA 3ARVA 3ALGA 2XPBA 2PV1A 1JNTA 3ARXA 2Y78A 2DMVA 2YBUA 1HJXA 3CH9A 5HT1A 1W1TA 4ODNA 1KFWA 2B31A 4IPXA 3ODKA 3M85A 1WAWA 2OFNA 4QT2A 1FD9A 4R5EA 5DITA 1OWQA 2KR7A 2EZ5W 4WKHA 1JVWA 2XP7A 2PPNA 3B7XA 1YW5A 4HBOA 3O5JA 3JXVA 4Z2IA 1O6WA 3AROA 3FY1A 2DG4A 4U85A 5JH8A 1HJWA 1TR8A 4MAVA 3CHDA 2ZR4A 3PA7A 2FKEA 3TC5A 2PV2A 4LAXA 2DWVA 1XRVA 3O5KA 4MNMA 3CHFA 5J6EA 4A0UA 1FKDA 1QZ2A 1W9UA 1JMQA 2RSEA 1H0GA 4G2PA 2XP6A 3FSCA 3AS1A 4Z2KA 2JX8A 2KGJA 4DRKA 4AY1A 3CGNA 3UQBA 4NZCA 1NMWA 1F40A 1P5QA 1GOIA 4ODLA 1TK7A 4DIPA 5HKGA 2WAEA 1EIBA 4TW6A 2DT0A 3ARWA 4WJXA 1PBKA 2K8IA 1D6OA 2RQSA 2QRVA 1I5HW 1C9HA 2O9OA 3ARTA 3JYJA 1SR0A 1FJDA 1Q6UA 3KZ7A 2ZR6A 4W9OA 1UR8A 4ODPA 2DSWA 3LUOA 4DRJA 4R0XA 1IX5A 3ALFA 3CHEA 1KT1A 2LKNA 3B9DA 3IKGA 2Y8NB 5E62A 2YAJB 5BXJA 2F4EA 1NWTA 5HTGA 1FFRA 5DIUA 2IF4A 5GPGA 4TW8A 4TNSA 1OGBA 3MQHA 2WM0A 4U84A 3UQIA 1E9LA 2ITKA 3KACA 4FN2A 3VAWA 1X6LA 2G8ZA 2IUZA 3O5IA 1E6ZA 4DH0A 2A3BA 1LL6A 4Z2JA 2YSBA 2LJ4A 1Q6HA 4DRHA 5DEZA 2AWGA 3M7NA 1ROUA 1EQ3A 2YSFA 2MLYA 4DRIA 1TCOC 3NTPA 4QZVB 1HKMA 1EG3A 3TDBA 1K9RA 3WQWA 4DWSD 2ZR5A 3WH0A 1FKTA 2DSVA 3O5FA 5HBFA 2XP9A 2YBTA 2LPVA 1W9PA 4BF8A 3FXYA 2KE0A 4MPKA 3ARSA 1PINA 4P8VA 4DRNA 2F21A 1HKIA 4A0TA 1KT0A 2WLYA 2DT3A 4NSBA 5DIVA 4TW7A 2E45A 1H0IA 2OLHA 4TX0A 1HJVA 3WL1A 5E64A 4IT6A 2KI3A 1CTNA 1LL7A 4MNKA 3KAGA 2XP5A 3JYMA 4URIA 4IT4A 3WD0A 1U79A 2JV4A 3LKXA 1D7JA 1GPFA 1ZBCA 2DSZA 4MGVA 4Z2GA 4MTVA 3AQUA 4GGQA 3OOBA 1HXVA 2AOSA 3BXWA 4P8WA 1EDQA 2ESCA 4ODKA 3RGCA 3WKZA 3PQHA 3MDYB 1RP5A 2M3OW 3RM4A 3TCZA 2MLZA 4TYOA 3AS0A 2WLZA 1FFQA 1D7HA 5GQBA 3NRKA 1T11A 3G6LA 3GPKA 2N87A 3UQAA 2RUDA 1A7XA 1QPFA 4GIVA 1FKFA 2KXQA 4ODMA 4N19A 3WL0A 1ZBVA 4JFIA 3LKXB 1VF8A 5DO2A 4E5RA 4DWSB 2OWOA 3O5RA 1R9HA 4S3KA 3KCEA 4P8UA 4REXA 1JNSA 1Q6IA 1N1AA 4ODOA 3KAHA 3ARRA 1OGGA 3PRAA 4ODRA 4DRQA 3B9EA 3RM9A 3O5DA 3PR9A 4W9PA 3WIJA 2UZ5A 1FKHA 1YATA 2JXWA 3CZ8A 2DK7A 1FKKA 1NH6A 3O5LA 1W1YA 3O5QA 4QT3A 3W4RA 2RE3A 3G6MA 1LG2A 4ZPVR 1JNDA 5HW7A 1ZU8A 1EYMA 1WNOA 1D2KA 4IQ2A 4ITZA 4LAVA 1JNEA 3WD1A 3AS3A 3O5GA 4PTMA 4O2TA 3IKDA 2WK2A 3UI5A 4Z2HA 2F2DA 4MSPA 2Q5AA 5U47A 1FKGA 2XP4A 2PV3A 3NI6A 2DPEA 1M5YA 4G50A 3FSBA 5E66A 4HARA 2ZQSA 4Z2LA 1W1PA 3MCBB 1K9TA 2PBCA 1NSGA 1W1VA 5D75A 3CNGA 4MNJA 3ARZA 2XPAA 3FS8A 4NNRA 3KADA 4XAKA 2PPPA 1SYTA 4WKFA 2MNTA 3O5EA 2KFWA 1LL4A 1ZBWA 4JFKA 3MCBA 4W9QA 5I98A 3IHZA 1EHNA 1X6NA 1NWRA 2MPHA 4DT4A 3UI4A 1WB0A 2D9FA 3IK8A 1ZCNA 3WQVA 4L3NA 2FDMA 2YSHA 4JFLA 4S3JA 3O5PA 1J4IA 1FKBA 2M1IA 2VCDA 4ZPTR 2DG3A 2MDIA 4ML4A 5HWBA 4KQZA 3ARPA 1LG1A 4KR0B 2A3AA 5B8IC 1O6IA 1UR9A 1FAPA 2DT2A 3CGMA 4HBEA 1E15A 1K9QA 5CQ2A 3WD2A 4GLXA 3WD3A 4JYSA 1ZK6A 1Q1CA 4MNLA 1ZL1A 1D7IA 1NWUA 2G41A 1J4HA 1ITXA 1FKRA 2ZQUA 3UI6A 3MQGA 2PPOA 1HKKA 3H9RB 3QOKA 4LAYA 1ZBKA 4WIWA 1E6NA 1E6PA 3RFWA 1FKJA 3AS2A 4DRPA 2DK1A 2M2AA 1WMVA 3B8SA 2A3EA 2DG9A 4FAPA 2LGOA 3KAIA 2YSGA 1ROTA 1HKJA 2KO7A 4ZPWR 1NWSA 1NMVA 1GUVA 3WD4A 2FAPA 4Q22A 4DWSA 3UF8A 2M08A 1W9VA 4ZS6A 3PRDA 3O5MA 3ARUA 5AHTA 4Q7NA 3KAFA 3PRBA 2JMFA 4LGXA 2WADA 4DRMA 5DF0A 4DROA 1E6RA 4IQCA 3RM8A 1BL4A 2RUCA 4WKAA 5E65A 4DZ3A 4DWSC 4JFJA 2L2SA 1WR7A 1B6CA 2A3CA 1Y0OA 3ARQA 1ZB5A 2YSIA 5HW6A 2ZQTA 4QIBA 3O5OA 2BA1A 2XP8A 2ZAJA 2ZQVA 3ARYA 2L4JA 5HW8A 1TFVA 5HUAA 1W26A 3RMEA 4W5UA 2PI6A 1LQ0A 4LAWA 1RD6A 3L4HA 2DSUA 3LE4A 1LJYA 2DJYA 1FKSA 4J4OA 4L72B 4C02B 4JFMA 2XP3A 1J6YA 3KABA 2LAJA 2O92A 4U86A 4WK9A 2RUQA 4ODQA 4DZ2A 3I6CA 5E5WA 2JZVA 2M8JA 5HWCA 3CHCA 3B9AA 1L1PA 1XHGA 2DT1A 2MF9A 2VN1A 3EY6A 4P8XA 1QPLA 3FAPA 1F8AB 1FLCA 1FKIA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2MLX A;  4E5R A;  1FKL A;  3IKG A;  3O5R A;  1R9H A;  2RUR A;  3KCE A;  4J4N A;  2M8I A;  3MDY B;  1J4R A;  1EG4 A;  4REX A;  1BKF A;  5BXJ A;  1Q6I A;  2F4E A;  1N1A A;  3RFW A;  1JNS A;  2XPB A;  1FKJ A;  2PV1 A;  4ODO A;  3KAH A;  1JNT A;  2IF4 A;  4ODR A;  5DIU A;  2Y78 A;  5GPG A;  4DRQ A;  2DMV A;  4TW8 A;  2DK1 A;  4DRP A;  2M2A A;  4TNS A;  1WMV A;  5HT1 A;  3O5D A;  4W9P A;  4ODN A;  4U84 A;  2UZ5 A;  2DG9 A;  4IPX A;  3UQI A;  4FAP A;  2LGO A;  1FKH A;  1YAT A;  2JXW A;  3KAI A;  2ITK A;  3ODK A;  2YSG A;  3M85 A;  3KAC A;  1ROT A;  2OFN A;  4FN2 A;  4QT2 A;  3VAW A;  2KO7 A;  1FD9 A;  2DK7 A;  1FKK A;  5DIT A;  2KR7 A;  3O5L A;  1NMV A;  3O5Q A;  4QT3 A;  2EZ5 W;  3O5I A;  1JVW A;  4DH0 A;  2XP7 A;  2FAP A;  2PPN A;  2YSB A;  3UF8 A;  2M08 A;  2RE3 A;  3B7X A;  2LJ4 A;  1YW5 A;  1Q6H A;  3PRD A;  4DRH A;  3O5M A;  2AWG A;  3JXV A;  3O5J A;  1O6W A;  5AHT A;  3M7N A;  1ROU A;  1EQ3 A;  3KAF A;  2YSF A;  2JMF A;  2MLY A;  3PRB A;  5HW7 A;  1EYM A;  4DRM A;  2DG4 A;  4U85 A;  4IQ2 A;  4DRI A;  4DRO A;  1TCO C;  3NTP A;  4ITZ A;  4LAV A;  4IQC A;  3O5G A;  1BL4 A;  2RUC A;  1EG3 A;  3TDB A;  4O2T A;  3IKD A;  2ZR4 A;  1K9R A;  3PA7 A;  2FKE A;  4DZ3 A;  3TC5 A;  4JFJ A;  2ZR5 A;  2L2S A;  2PV2 A;  3WH0 A;  2DWV A;  1WR7 A;  1B6C A;  1FKT A;  4LAX A;  3UI5 A;  1Y0O A;  3O5K A;  3O5F A;  2F2D A;  4MSP A;  2Q5A A;  2XP9 A;  1FKG A;  2XP4 A;  2PV3 A;  3NI6 A;  2LPV A;  1M5Y A;  4G50 A;  4BF8 A;  5J6E A;  1J6Y A;  2YSI A;  2KE0 A;  2ZQS A;  1PIN A;  1FKD A;  4DRN A;  2F21 A;  5HW6 A;  2ZQT A;  4QIB A;  3O5O A;  1QZ2 A;  2PBC A;  2BA1 A;  2XP8 A;  1JMQ A;  1NSG A;  1KT0 A;  2ZAJ A;  2RSE A;  3CNG A;  2XP6 A;  4G2P A;  5D75 A;  5DIV A;  4TW7 A;  2E45 A;  2XPA A;  2ZQV A;  2L4J A;  4NNR A;  4TX0 A;  3KAD A;  2PPP A;  2MNT A;  2KI3 A;  5HW8 A;  2JX8 A;  5HTG A;  3O5E A;  2KFW A;  3KAG A;  2KGJ A;  4JFK A;  2XP5 A;  3JYM A;  4W9Q A;  4DRK A;  5HUA A;  5I98 A;  3CGN A;  1W26 A;  3IHZ A;  3UQB A;  1U79 A;  2JV4 A;  1D7J A;  1NMW A;  4MGV A;  2MPH A;  1P5Q A;  4DT4 A;  4LAW A;  3UI4 A;  1F40 A;  2D9F A;  4GGQ A;  3IK8 A;  3OOB A;  1TK7 A;  3L4H A;  4ODL A;  4DIP A;  1ZCN A;  5HKG A;  3LE4 A;  4TW6 A;  1HXV A;  2DJY A;  1FKS A;  2YSH A;  4J4O A;  4ODK A;  4JFL A;  3RGC A;  4JFM A;  4C02 B;  3O5P A;  2XP3 A;  1J4I A;  3KAB A;  2LAJ A;  1FKB A;  1PBK A;  2DG3 A;  2K8I A;  2M1I A;  2MDI A;  2VCD A;  4U86 A;  1D6O A;  2RUQ A;  4ODQ A;  2RQS A;  2M3O W;  5HWB A;  3TCZ A;  2MLZ A;  1I5H W;  4TYO A;  5B8I C;  1C9H A;  3CGM A;  1FAP A;  1D7H A;  1K9Q A;  5CQ2 A;  3JYJ A;  4DZ2 A;  3NRK A;  3I6C A;  1T11 A;  1FJD A;  1Q6U A;  2JZV A;  2N87 A;  2M8J A;  2ZR6 A;  3GPK A;  3KZ7 A;  4W9O A;  4ODP A;  3UQA A;  5HWC A;  4JYS A;  1ZK6 A;  1Q1C A;  2RUD A;  1A7X A;  3LUO A;  4DRJ A;  1D7I A;  1QPF A;  1L1P A;  4R0X A;  4GIV A;  1J4H A;  1FKF A;  2KXQ A;  4ODM A;  4N19 A;  1FKR A;  2ZQU A;  3UI6 A;  2PPO A;  2MF9 A;  2VN1 A;  3EY6 A;  1KT1 A;  3H9R B;  1QPL A;  3FAP A;  1F8A B;  4JFI A;  2LKN A;  4LAY A;  1FKI A; 
#chains in the Genus database with same CATH topology
 2MLX A;  1FKL A;  2QF8 A;  3OA5 A;  2RUR A;  4J4N A;  2M8I A;  1J4R A;  1EG4 A;  1BKF A;  5GPR A;  3ARV A;  3ALG A;  2XPB A;  2PV1 A;  1JNT A;  3ARX A;  2Y78 A;  2DMV A;  2YBU A;  1HJX A;  3CH9 A;  5HT1 A;  1W1T A;  4ODN A;  1KFW A;  2B31 A;  4IPX A;  3ODK A;  3M85 A;  1WAW A;  2OFN A;  4QT2 A;  1FD9 A;  4R5E A;  5DIT A;  1OWQ A;  2KR7 A;  2EZ5 W;  4WKH A;  1JVW A;  2XP7 A;  2PPN A;  3B7X A;  1YW5 A;  4HBO A;  3O5J A;  3JXV A;  4Z2I A;  1O6W A;  3ARO A;  3FY1 A;  2DG4 A;  4U85 A;  5JH8 A;  1HJW A;  1TR8 A;  4MAV A;  3CHD A;  2ZR4 A;  3PA7 A;  2FKE A;  3TC5 A;  2PV2 A;  4LAX A;  2DWV A;  1XRV A;  1GRJ A;  3O5K A;  4MNM A;  3CHF A;  5J6E A;  4A0U A;  1FKD A;  1QZ2 A;  1W9U A;  1JMQ A;  2RSE A;  1H0G A;  4G2P A;  2XP6 A;  3FSC A;  3AS1 A;  4Z2K A;  2JX8 A;  2KGJ A;  4DRK A;  4AY1 A;  3CGN A;  3UQB A;  4NZC A;  1NMW A;  1F40 A;  1P5Q A;  2ETN A;  1GOI A;  4ODL A;  1TK7 A;  4DIP A;  5HKG A;  2WAE A;  1EIB A;  4TW6 A;  2DT0 A;  3ARW A;  4WJX A;  1PBK A;  2K8I A;  1D6O A;  2RQS A;  2QRV A;  1I5H W;  1C9H A;  2O9O A;  3ART A;  3JYJ A;  1SR0 A;  1FJD A;  1Q6U A;  3KZ7 A;  2ZR6 A;  4W9O A;  1UR8 A;  4ODP A;  2DSW A;  3LUO A;  4DRJ A;  4R0X A;  1IX5 A;  3GTY X;  3ALF A;  3CHE A;  1KT1 A;  2LKN A;  3B9D A;  1E44 A;  3IKG A;  2Y8N B;  5E62 A;  2YAJ B;  5BXJ A;  2F4E A;  1NWT A;  5HTG A;  1FFR A;  5DIU A;  2IF4 A;  5GPG A;  4TW8 A;  4TNS A;  1OGB A;  3MQH A;  2WM0 A;  4U84 A;  3UQI A;  1E9L A;  2ITK A;  3KAC A;  4FN2 A;  3VAW A;  1X6L A;  2G8Z A;  2IUZ A;  3O5I A;  1E6Z A;  4DH0 A;  2A3B A;  1LL6 A;  4Z2J A;  2YSB A;  2LJ4 A;  1Q6H A;  4DRH A;  5DEZ A;  2AWG A;  3M7N A;  1ROU A;  1EQ3 A;  2YSF A;  2MLY A;  4DRI A;  1TCO C;  3NTP A;  4QZV B;  1HKM A;  1EG3 A;  3TDB A;  1K9R A;  3WQW A;  4DWS D;  2ZR5 A;  3WH0 A;  1FKT A;  2DSV A;  3O5F A;  5HBF A;  2XP9 A;  2YBT A;  2LPV A;  1W9P A;  4BF8 A;  3FXY A;  2KE0 A;  4MPK A;  3ARS A;  1PIN A;  4P8V A;  4DRN A;  2F21 A;  1HKI A;  4A0T A;  1KT0 A;  2WLY A;  2DT3 A;  4NSB A;  5DIV A;  4TW7 A;  2E45 A;  1H0I A;  2OLH A;  4TX0 A;  1HJV A;  3WL1 A;  5E64 A;  4IT6 A;  2KI3 A;  1CTN A;  1LL7 A;  4MNK A;  3KAG A;  2XP5 A;  3JYM A;  4URI A;  4IT4 A;  3WD0 A;  1U79 A;  2JV4 A;  3LKX A;  1D7J A;  1GPF A;  1ZBC A;  2DSZ A;  4MGV A;  4Z2G A;  4MTV A;  3AQU A;  4GGQ A;  3OOB A;  1HXV A;  2AOS A;  3BXW A;  4P8W A;  1EDQ A;  2ESC A;  4ODK A;  3RGC A;  3WKZ A;  3PQH A;  3MDY B;  1RP5 A;  2M3O W;  3RM4 A;  3TCZ A;  2MLZ A;  4TYO A;  3AS0 A;  2WLZ A;  1FFQ A;  1D7H A;  5GQB A;  3NRK A;  1T11 A;  3G6L A;  3GPK A;  2N87 A;  3UQA A;  2RUD A;  1A7X A;  1QPF A;  4GIV A;  1FKF A;  2KXQ A;  4ODM A;  4N19 A;  3WL0 A;  3GU0 A;  1ZBV A;  4JFI A;  3LKX B;  1VF8 A;  5DO2 A;  4E5R A;  4DWS B;  2OWO A;  3O5R A;  1R9H A;  4S3K A;  3KCE A;  4P8U A;  4REX A;  1JNS A;  1Q6I A;  1N1A A;  4ODO A;  3KAH A;  3ARR A;  1OGG A;  3PRA A;  4ODR A;  4DRQ A;  3B9E A;  3RM9 A;  3O5D A;  3PR9 A;  4W9P A;  3WIJ A;  2UZ5 A;  1FKH A;  1YAT A;  2JXW A;  3CZ8 A;  2DK7 A;  1FKK A;  1NH6 A;  3O5L A;  1W1Y A;  3O5Q A;  4QT3 A;  3W4R A;  2RE3 A;  3G6M A;  1LG2 A;  4ZPV R;  1JND A;  5HW7 A;  1ZU8 A;  1EYM A;  1WNO A;  1D2K A;  4IQ2 A;  2F23 A;  4ITZ A;  4LAV A;  1JNE A;  2B5U B;  3WD1 A;  3AS3 A;  3O5G A;  4PTM A;  4O2T A;  3IKD A;  2EUL A;  2WK2 A;  3UI5 A;  4Z2H A;  2F2D A;  4MSP A;  2Q5A A;  5U47 A;  1FKG A;  2XP4 A;  2PV3 A;  3NI6 A;  2DPE A;  1M5Y A;  4G50 A;  3FSB A;  5E66 A;  4HAR A;  2ZQS A;  4Z2L A;  1W1P A;  3MCB B;  1K9T A;  2PBC A;  1NSG A;  1W1V A;  5D75 A;  3CNG A;  4MNJ A;  3ARZ A;  2XPA A;  3FS8 A;  4NNR A;  3KAD A;  4XAK A;  2PPP A;  1SYT A;  4WKF A;  2MNT A;  3O5E A;  2KFW A;  1LL4 A;  1ZBW A;  4JFK A;  3MCB A;  4W9Q A;  5I98 A;  3IHZ A;  1EHN A;  1X6N A;  1NWR A;  2MPH A;  4DT4 A;  3UI4 A;  1WB0 A;  2D9F A;  3IK8 A;  1ZCN A;  3WQV A;  4L3N A;  2FDM A;  2YSH A;  4JFL A;  4S3J A;  3O5P A;  1J4I A;  1FKB A;  2M1I A;  2VCD A;  4ZPT R;  2DG3 A;  2MDI A;  4ML4 A;  5HWB A;  4KQZ A;  3ARP A;  1LG1 A;  4KR0 B;  2A3A A;  5B8I C;  1O6I A;  1UR9 A;  1FAP A;  2DT2 A;  3CGM A;  4HBE A;  1E15 A;  1K9Q A;  5CQ2 A;  3WD2 A;  4GLX A;  3WD3 A;  4JYS A;  1ZK6 A;  1Q1C A;  4MNL A;  1ZL1 A;  1D7I A;  1NWU A;  2G41 A;  1J4H A;  1ITX A;  1FKR A;  2ZQU A;  3UI6 A;  3MQG A;  2PPO A;  1HKK A;  3H9R B;  3QOK A;  4LAY A;  1ZBK A;  4WIW A;  1E6N A;  1E6P A;  3RFW A;  1FKJ A;  3AS2 A;  4DRP A;  2DK1 A;  2M2A A;  1WMV A;  3B8S A;  2A3E A;  2DG9 A;  4FAP A;  2LGO A;  3KAI A;  2YSG A;  1ROT A;  1HKJ A;  2KO7 A;  4ZPW R;  1NWS A;  1NMV A;  1GUV A;  3WD4 A;  2FAP A;  4Q22 A;  4DWS A;  3UF8 A;  2M08 A;  1W9V A;  4ZS6 A;  3PRD A;  3O5M A;  3ARU A;  3BMB A;  5AHT A;  4Q7N A;  3KAF A;  3PRB A;  2JMF A;  4LGX A;  2WAD A;  4DRM A;  5DF0 A;  4DRO A;  1E6R A;  4IQC A;  1JCH B;  3RM8 A;  1BL4 A;  2RUC A;  4WKA A;  5E65 A;  4DZ3 A;  4DWS C;  4JFJ A;  2L2S A;  1WR7 A;  1B6C A;  2A3C A;  1Y0O A;  3ARQ A;  1ZB5 A;  3EIP A;  2YSI A;  4UDM A;  5HW6 A;  2ZQT A;  4QIB A;  3O5O A;  2BA1 A;  2XP8 A;  2ZAJ A;  2ZQV A;  3ARY A;  2L4J A;  5HW8 A;  1TFV A;  5HUA A;  1W26 A;  3RME A;  4W5U A;  2PI6 A;  1LQ0 A;  4LAW A;  1RD6 A;  3L4H A;  2DSU A;  3LE4 A;  1LJY A;  2DJY A;  1FKS A;  4J4O A;  4L72 B;  4C02 B;  4JFM A;  2XP3 A;  1J6Y A;  3KAB A;  2LAJ A;  2O92 A;  4U86 A;  4WK9 A;  2RUQ A;  4ODQ A;  4DZ2 A;  2P4V A;  2PN0 A;  3I6C A;  5E5W A;  2JZV A;  2M8J A;  5HWC A;  3CHC A;  3B9A A;  1L1P A;  1XHG A;  2DT1 A;  2MF9 A;  2VN1 A;  3EY6 A;  4P8X A;  1QPL A;  3FAP A;  1F8A B;  1FLC A;  1FKI A; 
#chains in the Genus database with same CATH homology
 2MLX A;  1FKL A;  2QF8 A;  3OA5 A;  2RUR A;  4J4N A;  2M8I A;  1J4R A;  1EG4 A;  1BKF A;  5GPR A;  3ARV A;  3ALG A;  2XPB A;  2PV1 A;  1JNT A;  3ARX A;  2Y78 A;  2DMV A;  2YBU A;  1HJX A;  3CH9 A;  5HT1 A;  1W1T A;  4ODN A;  1KFW A;  2B31 A;  4IPX A;  3ODK A;  3M85 A;  1WAW A;  2OFN A;  4QT2 A;  1FD9 A;  4R5E A;  5DIT A;  1OWQ A;  2KR7 A;  2EZ5 W;  4WKH A;  1JVW A;  2XP7 A;  2PPN A;  3B7X A;  1YW5 A;  4HBO A;  3O5J A;  3JXV A;  4Z2I A;  1O6W A;  3ARO A;  3FY1 A;  2DG4 A;  4U85 A;  5JH8 A;  1HJW A;  1TR8 A;  4MAV A;  3CHD A;  2ZR4 A;  3PA7 A;  2FKE A;  3TC5 A;  2PV2 A;  4LAX A;  2DWV A;  1XRV A;  3O5K A;  4MNM A;  3CHF A;  5J6E A;  4A0U A;  1FKD A;  1QZ2 A;  1W9U A;  1JMQ A;  2RSE A;  1H0G A;  4G2P A;  2XP6 A;  3FSC A;  3AS1 A;  4Z2K A;  2JX8 A;  2KGJ A;  4DRK A;  4AY1 A;  3CGN A;  3UQB A;  4NZC A;  1NMW A;  1F40 A;  1P5Q A;  1GOI A;  4ODL A;  1TK7 A;  4DIP A;  5HKG A;  2WAE A;  1EIB A;  4TW6 A;  2DT0 A;  3ARW A;  4WJX A;  1PBK A;  2K8I A;  1D6O A;  2RQS A;  2QRV A;  1I5H W;  1C9H A;  2O9O A;  3ART A;  3JYJ A;  1SR0 A;  1FJD A;  1Q6U A;  3KZ7 A;  2ZR6 A;  4W9O A;  1UR8 A;  4ODP A;  2DSW A;  3LUO A;  4DRJ A;  4R0X A;  1IX5 A;  3ALF A;  3CHE A;  1KT1 A;  2LKN A;  3B9D A;  3IKG A;  2Y8N B;  5E62 A;  2YAJ B;  5BXJ A;  2F4E A;  1NWT A;  5HTG A;  1FFR A;  5DIU A;  2IF4 A;  5GPG A;  4TW8 A;  4TNS A;  1OGB A;  3MQH A;  2WM0 A;  4U84 A;  3UQI A;  1E9L A;  2ITK A;  3KAC A;  4FN2 A;  3VAW A;  1X6L A;  2G8Z A;  2IUZ A;  3O5I A;  1E6Z A;  4DH0 A;  2A3B A;  1LL6 A;  4Z2J A;  2YSB A;  2LJ4 A;  1Q6H A;  4DRH A;  5DEZ A;  2AWG A;  3M7N A;  1ROU A;  1EQ3 A;  2YSF A;  2MLY A;  4DRI A;  1TCO C;  3NTP A;  4QZV B;  1HKM A;  1EG3 A;  3TDB A;  1K9R A;  3WQW A;  4DWS D;  2ZR5 A;  3WH0 A;  1FKT A;  2DSV A;  3O5F A;  5HBF A;  2XP9 A;  2YBT A;  2LPV A;  1W9P A;  4BF8 A;  3FXY A;  2KE0 A;  4MPK A;  3ARS A;  1PIN A;  4P8V A;  4DRN A;  2F21 A;  1HKI A;  4A0T A;  1KT0 A;  2WLY A;  2DT3 A;  4NSB A;  5DIV A;  4TW7 A;  2E45 A;  1H0I A;  2OLH A;  4TX0 A;  1HJV A;  3WL1 A;  5E64 A;  4IT6 A;  2KI3 A;  1CTN A;  1LL7 A;  4MNK A;  3KAG A;  2XP5 A;  3JYM A;  4URI A;  4IT4 A;  3WD0 A;  1U79 A;  2JV4 A;  3LKX A;  1D7J A;  1GPF A;  1ZBC A;  2DSZ A;  4MGV A;  4Z2G A;  4MTV A;  3AQU A;  4GGQ A;  3OOB A;  1HXV A;  2AOS A;  3BXW A;  4P8W A;  1EDQ A;  2ESC A;  4ODK A;  3RGC A;  3WKZ A;  3PQH A;  3MDY B;  1RP5 A;  2M3O W;  3RM4 A;  3TCZ A;  2MLZ A;  4TYO A;  3AS0 A;  2WLZ A;  1FFQ A;  1D7H A;  5GQB A;  3NRK A;  1T11 A;  3G6L A;  3GPK A;  2N87 A;  3UQA A;  2RUD A;  1A7X A;  1QPF A;  4GIV A;  1FKF A;  2KXQ A;  4ODM A;  4N19 A;  3WL0 A;  1ZBV A;  4JFI A;  3LKX B;  1VF8 A;  5DO2 A;  4E5R A;  4DWS B;  2OWO A;  3O5R A;  1R9H A;  4S3K A;  3KCE A;  4P8U A;  4REX A;  1JNS A;  1Q6I A;  1N1A A;  4ODO A;  3KAH A;  3ARR A;  1OGG A;  3PRA A;  4ODR A;  4DRQ A;  3B9E A;  3RM9 A;  3O5D A;  3PR9 A;  4W9P A;  3WIJ A;  2UZ5 A;  1FKH A;  1YAT A;  2JXW A;  3CZ8 A;  2DK7 A;  1FKK A;  1NH6 A;  3O5L A;  1W1Y A;  3O5Q A;  4QT3 A;  3W4R A;  2RE3 A;  3G6M A;  1LG2 A;  4ZPV R;  1JND A;  5HW7 A;  1ZU8 A;  1EYM A;  1WNO A;  1D2K A;  4IQ2 A;  4ITZ A;  4LAV A;  1JNE A;  3WD1 A;  3AS3 A;  3O5G A;  4PTM A;  4O2T A;  3IKD A;  2WK2 A;  3UI5 A;  4Z2H A;  2F2D A;  4MSP A;  2Q5A A;  5U47 A;  1FKG A;  2XP4 A;  2PV3 A;  3NI6 A;  2DPE A;  1M5Y A;  4G50 A;  3FSB A;  5E66 A;  4HAR A;  2ZQS A;  4Z2L A;  1W1P A;  3MCB B;  1K9T A;  2PBC A;  1NSG A;  1W1V A;  5D75 A;  3CNG A;  4MNJ A;  3ARZ A;  2XPA A;  3FS8 A;  4NNR A;  3KAD A;  4XAK A;  2PPP A;  1SYT A;  4WKF A;  2MNT A;  3O5E A;  2KFW A;  1LL4 A;  1ZBW A;  4JFK A;  3MCB A;  4W9Q A;  5I98 A;  3IHZ A;  1EHN A;  1X6N A;  1NWR A;  2MPH A;  4DT4 A;  3UI4 A;  1WB0 A;  2D9F A;  3IK8 A;  1ZCN A;  3WQV A;  4L3N A;  2FDM A;  2YSH A;  4JFL A;  4S3J A;  3O5P A;  1J4I A;  1FKB A;  2M1I A;  2VCD A;  4ZPT R;  2DG3 A;  2MDI A;  4ML4 A;  5HWB A;  4KQZ A;  3ARP A;  1LG1 A;  4KR0 B;  2A3A A;  5B8I C;  1O6I A;  1UR9 A;  1FAP A;  2DT2 A;  3CGM A;  4HBE A;  1E15 A;  1K9Q A;  5CQ2 A;  3WD2 A;  4GLX A;  3WD3 A;  4JYS A;  1ZK6 A;  1Q1C A;  4MNL A;  1ZL1 A;  1D7I A;  1NWU A;  2G41 A;  1J4H A;  1ITX A;  1FKR A;  2ZQU A;  3UI6 A;  3MQG A;  2PPO A;  1HKK A;  3H9R B;  3QOK A;  4LAY A;  1ZBK A;  4WIW A;  1E6N A;  1E6P A;  3RFW A;  1FKJ A;  3AS2 A;  4DRP A;  2DK1 A;  2M2A A;  1WMV A;  3B8S A;  2A3E A;  2DG9 A;  4FAP A;  2LGO A;  3KAI A;  2YSG A;  1ROT A;  1HKJ A;  2KO7 A;  4ZPW R;  1NWS A;  1NMV A;  1GUV A;  3WD4 A;  2FAP A;  4Q22 A;  4DWS A;  3UF8 A;  2M08 A;  1W9V A;  4ZS6 A;  3PRD A;  3O5M A;  3ARU A;  5AHT A;  4Q7N A;  3KAF A;  3PRB A;  2JMF A;  4LGX A;  2WAD A;  4DRM A;  5DF0 A;  4DRO A;  1E6R A;  4IQC A;  3RM8 A;  1BL4 A;  2RUC A;  4WKA A;  5E65 A;  4DZ3 A;  4DWS C;  4JFJ A;  2L2S A;  1WR7 A;  1B6C A;  2A3C A;  1Y0O A;  3ARQ A;  1ZB5 A;  2YSI A;  5HW6 A;  2ZQT A;  4QIB A;  3O5O A;  2BA1 A;  2XP8 A;  2ZAJ A;  2ZQV A;  3ARY A;  2L4J A;  5HW8 A;  1TFV A;  5HUA A;  1W26 A;  3RME A;  4W5U A;  2PI6 A;  1LQ0 A;  4LAW A;  1RD6 A;  3L4H A;  2DSU A;  3LE4 A;  1LJY A;  2DJY A;  1FKS A;  4J4O A;  4L72 B;  4C02 B;  4JFM A;  2XP3 A;  1J6Y A;  3KAB A;  2LAJ A;  2O92 A;  4U86 A;  4WK9 A;  2RUQ A;  4ODQ A;  4DZ2 A;  3I6C A;  5E5W A;  2JZV A;  2M8J A;  5HWC A;  3CHC A;  3B9A A;  1L1P A;  1XHG A;  2DT1 A;  2MF9 A;  2VN1 A;  3EY6 A;  4P8X A;  1QPL A;  3FAP A;  1F8A B;  1FLC A;  1FKI A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...