1NMVA

Solution structure of human pin1
Total Genus 30
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
30
sequence length
163
structure length
163
Chain Sequence
MADEEKLPPGWEKRMSRSSGRVYYFNHITNASQWERPSGNSSSGGKNGQGEPARVRCSHLLVKHSQSRRPSSWRQEKITRTKEEALELINGYIQKIKSGEEDFESLASQFSDCSSAKARGDLGAFSRGQMQKPFEDASFALRTGEMSGPVFTDSGIHIILRTE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural Analysis of the Mitotic Regulator hPin1 in Solution: INSIGHTS INTO DOMAIN ARCHITECTURE AND SUBSTRATE BINDING.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Isomerase
molecule keywords Peptidyl-prolyl cis-trans isomerase NIMA-interacting 1
total genus 30
structure length 163
sequence length 163
ec nomenclature ec 5.2.1.8: Peptidylprolyl isomerase.
pdb deposition date 2003-01-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00397 WW WW domain
A PF00639 Rotamase PPIC-type PPIASE domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.20.70.10 Mainly Beta Single Sheet Ubiquitin Ligase Nedd4; Chain: W; Ubiquitin Ligase Nedd4; Chain: W; 1nmvA01
3.10.50.40 Alpha Beta Roll Chitinase A; domain 3 Chitinase A; domain 3 1nmvA02
1I5HW 2ZQUA 3O5DA 2ITKA 3JYJA 2XPBA 1PINA 3ODKA 1FKDA 2PV2A 4IQ2A 3KAHA 4QT3A 3CGMA 3O5OA 4TYOA 2XPAA 4ODRA 1J6YA 3UI4A 1KT1A 2KR7A 2RUCA 2XP5A 2PV3A 3IHZA 1TCOC 1T11A 3IK8A 5GPGA 4FAPA 1J4IA 2DJYA 3JYMA 3UQAA 3NI6A 2YSHA 1WR7A 1EYMA 4JYSA 5DIUA 1L1PA 3FAPA 2LAJA 1QPFA 2RE3A 1FKLA 1N1AA 2DK7A 1FKIA 2LJ4A 2ZQTA 3KACA 4W9PA 2PPOA 3UI6A 4DRKA 2JXWA 1D7IA 4U85A 4LAVA 1C9HA 1O6WA 4LAYA 2IF4A 1P5QA 2Q5AA 2OFNA 3UQIA 2M8IA 2XP7A 3H9RB 1FKGA 3O5QA 1QPLA 1NMVA 1R9HA 4MSPA 4ODKA 4W9OA 1HXVA 2ZQVA 4TNSA 1B6CA 4TW8A 3PA7A 1U79A 4C02B 2XP6A 3O5IA 1ROUA 2ZR6A 4DRHA 3KCEA 2DMVA 1ROTA 2LGOA 2VN1A 3MDYB 5DITA 1WMVA 1FKSA 1ZK6A 3VAWA 1K9RA 3M85A 4N19A 2F21A 5CQ2A 2JX8A 2F2DA 2Y78A 1Q6IA 4G50A 4R0XA 4QIBA 3KAFA 4JFJA 2N87A 4BF8A 1Y0OA 1FAPA 1FKTA 3L4HA 1FKHA 4U86A 2PBCA 5HKGA 2JMFA 4DRMA 3UF8A 1EG3A 1JNSA 5HUAA 1Q6UA 2DK1A 4DRIA 5J6EA 3O5FA 5AHTA 4NNRA 1FJDA 4DZ3A 3NTPA 3TCZA 2K8IA 2LKNA 4ODOA 4MGVA 4TW6A 3EY6A 1QZ2A 2D9FA 3IKGA 3O5LA 2FKEA 2MF9A 3UQBA 2VCDA 4J4OA 2L4JA 1F40A 4IQCA 1A7XA 2JZVA 3O5RA 2E45A 4DROA 3O5EA 2RQSA 1F8AB 1D6OA 4ITZA 2MPHA 4GIVA 5HW6A 4TX0A 1NMWA 1BKFA 2KO7A 1EG4A 2YSGA 3IKDA 3UI5A 4QT2A 3O5JA 3JXVA 1FKJA 3TC5A 3O5GA 2XP8A 4LAXA 2M3OW 1YW5A 2F4EA 2XP9A 2KFWA 1K9QA 2FAPA 4DRJA 2PV1A 4O2TA 2DG9A 2LPVA 2DG3A 4U84A 1JMQA 2M8JA 2M08A 2MLYA 4ODLA 5HW8A 2DWVA 1M5YA 2YSFA 4JFLA 1TK7A 2MNTA 5DIVA 1FKRA 2KI3A 3CNGA 3O5PA 3TDBA 3O5MA 2KGJA 2KXQA 1JVWA 1D7JA 4REXA 4IPXA 4J4NA 1JNTA 4DH0A 4DRQA 2ZR5A 2L2SA 1BL4A 1J4RA 3NRKA 4LAWA 5HW7A 4FN2A 1FD9A 2UZ5A 1YATA 3KABA 4DRNA 2KE0A 1PBKA 4JFMA 2XP3A 3M7NA 2RSEA 4ODNA 5BXJA 3WH0A 2XP4A 2M1IA 3CGNA 1Q1CA 2MLXA 3PRBA 1ZCNA 2RUQA 1Q6HA 3KADA 2DG4A 4ODPA 4G2PA 3RFWA 2RURA 5B8IC 1NSGA 2EZ5W 2YSBA 2ZR4A 2PPNA 2AWGA 3KZ7A 5D75A 3LUOA 4DRPA 4DIPA 2MLZA 1EQ3A 2JV4A 4JFKA 4ODQA 4GGQA 5HWBA 3KAIA 4ODMA 3LE4A 1D7HA 5HT1A 2BA1A 3RGCA 1FKKA 2PPPA 4DT4A 4DZ2A 2YSIA 1KT0A 3GPKA 5HWCA 1J4HA 3I6CA 3B7XA 3PRDA 5I98A 3OOBA 3KAGA 1FKBA 4E5RA 2M2AA 1FKFA 2ZAJA 3O5KA 4W9QA 5HTGA 1W26A 4JFIA 2MDIA 4TW7A 2RUDA 2ZQSA
chains in the Genus database with same CATH superfamily
2ZQUA 2ITKA 4IT4A 3MCBB 1PINA 1NWRA 4MPKA 4WKFA 1OGGA 2A3AA 1ZL1A 4MNMA 3UI4A 1RP5A 1TCOC 5GQBA 3JYMA 2LAJA 2RE3A 1XRVA 4DRKA 4Z2KA 1WB0A 1H0GA 4LAYA 1O6WA 1H0IA 3WKZA 2Q5AA 4WK9A 2XP7A 3RFWA 4MSPA 1QPLA 3CHDA 2ZQVA 2B31A 2PN0A 4P8UA 4C02B 1UR8A 1ROUA 5E66A 1ZK6A 3AS2A 4N19A 5CQ2A 3FSCA 1Q6IA 4QIBA 1HKJA 3AS0A 4Q7NA 1HKIA 2JMFA 4DRMA 1JNSA 1Q6UA 4DRIA 4DZ3A 3NTPA 1RD6A 5E65A 3IKGA 1WAWA 4ZS6A 1LL7A 4IQCA 4MAVA 4DROA 2E45A 1VF8A 1D6OA 4ITZA 3AQUA 2O9OA 1OGBA 4NZCA 1X6LA 1SYTA 1EG4A 3IKDA 3UI5A 1IX5A 5GPRA 3TC5A 1XHGA 1E6PA 1K9QA 2LPVA 4U84A 2M8JA 4ODLA 2A3BA 2MNTA 4WIWA 1W1PA 2WLYA 2KGJA 4DRQA 2YAJB 4REXA 3WD2A 4LAWA 2UZ5A 2A3EA 3KABA 1E15A 2G8ZA 4JFMA 2XP3A 1HKMA 1Q1CA 2DG4A 4ODPA 3ARTA 2RURA 5B8IC 2PPNA 2ZR4A 4ZPWR 4DRPA 4ZPVR 2JV4A 4ODQA 1ZBWA 4ODMA 1LJYA 1D7HA 3RMEA 1E6ZA 1FKKA 4DT4A 4DZ2A 1KT0A 3GPKA 1J4HA 5I98A 3WQWA 4E5RA 3O5KA 4KQZA 5HTGA 3H9RB 3JYJA 3ODKA 3CHFA 3O5OA 3QOKA 2XPAA 4ODRA 4DWSA 2DT0A 2RUCA 2PV3A 3IK8A 4AY1A 3OA5A 3MCBA 3UQAA 3NI6A 1L1PA 3FAPA 4WKHA 1EHNA 4LGXA 1FKLA 2LJ4A 3KACA 2ZQTA 2JXWA 2YBUA 4U85A 2WK2A 1LG1A 4MNJA 3UQIA 1FKGA 4URIA 4TNSA 4TW8A 3PA7A 1U79A 2XP6A 1EDQA 1W1VA 3ARYA 4DRHA 3KCEA 2LGOA 2VN1A 3ARZA 3MDYB 1FKSA 1K9RA 2F21A 2JX8A 2F2DA 4G50A 1TR8A 5DF0A 4JFJA 5U47A 4DWSD 1FKHA 5DO2A 3GTYX 3EIPA 3TCZA 4MGVA 2D9FA 4IT6A 2O92A 3UQBA 2ESCA 1ZB5A 1F40A 1A7XA 3O5RA 4Q22A 5E5WA 3ALFA 1GPFA 1NWTA 3FS8A 4TX0A 2KO7A 2YSGA 1TFVA 3WL0A 2M3OW 1YW5A 3WQVA 3GU0A 4MNKA 4DRJA 3WD0A 2AOSA 2MLYA 4MTVA 5HW8A 2YSFA 2F23A 4JFLA 4HBEA 5DIVA 3WD4A 3CNGA 1O6IA 1ZBCA 1JNTA 2L2SA 1K9TA 4FN2A 1FD9A 1YATA 4P8XA 4ODNA 1CTNA 1HJWA 2RSEA 2WM0A 3G6MA 3PRBA 2WAEA 2DT1A 1NSGA 3ARPA 3KZ7A 5D75A 4JFKA 5E62A 3KAIA 3LE4A 5HT1A 3RGCA 2PPPA 3B7XA 1W9VA 5E64A 3OOBA 1FKFA 4TW7A 3FXYA 3PR9A 1SR0A 1LL6A 4QZVB 1NWSA 3KAHA 1GUVA 1J6YA 2PI6A 1FFRA 1KT1A 2KR7A 2XP5A 4DWSB 4A0UA 1NH6A 3WIJA 2YSHA 1WR7A 5DIUA 1N1AA 1FKIA 1GOIA 2PPOA 1D7IA 2IF4A 2IUZA 3BXWA 2OFNA 1R9HA 4ODKA 2P4VA 1HXVA 5DEZA 3WL1A 1B6CA 1JCHB 3O5IA 1ROTA 3ARVA 1ZBKA 3M85A 5HKGA 4KR0B 2Y78A 4UDMA 3KAFA 2N87A 1Y0OA 4S3JA 1FKTA 3L4HA 2PBCA 2DT3A 4HBOA 5HUAA 2DK1A 3CH9A 5J6EA 3LKXA 1LG2A 2K8IA 4ODOA 4MNLA 1QZ2A 4XAKA 2DSVA 2DSUA 2B5UB 3B9AA 1NWUA 2YBTA 3O5EA 1F8AB 4GIVA 3AROA 1HJXA 4A0TA 1NMWA 1BKFA 1W9UA 4WKAA 3JXVA 1FKJA 2DPEA 3O5GA 2XP8A 3W4RA 2F4EA 2XP9A 2EULA 1E6NA 2FAPA 2PV1A 4O2TA 1JMQA 2M08A 2DWVA 1LL4A 1M5YA 4L72B 1W1TA 1TK7A 3LKXB 1W1YA 3O5PA 3TDBA 3O5MA 2KXQA 1D7JA 3MQHA 2ZR5A 1BL4A 1J4RA 3RM9A 2KE0A 1PBKA 3ALGA 5BXJA 3M7NA 2FDMA 2MLXA 1ZCNA 1Q6HA 3KADA 1KFWA 3CHEA 1E6RA 2EZ5W 2YSBA 1EQ3A 3ARWA 2MLZA 4GGQA 5HWBA 3G6LA 3B9EA 5HWCA 3BMBA 3I6CA 3PRDA 3KAGA 2M2AA 1FLCA 3B8SA 4W9QA 1D2KA 1JNDA 5HW6A 2ZQSA 1I5HW 3O5DA 2XPBA 1OWQA 4QT3A 1FKDA 2PV2A 4IQ2A 4TYOA 4W9PA 3CGMA 4DRNA 4Z2IA 4NSBA 3FSBA 3IHZA 5GPGA 1T11A 4FAPA 1J4IA 2DJYA 4JYSA 1EYMA 3WD1A 4ML4A 3B9DA 4R5EA 1QPFA 2DK7A 3UI6A 3PQHA 2OWOA 3PRAA 4LAVA 1C9HA 1P5QA 4Z2LA 2M8IA 3O5QA 1X6NA 1NMVA 3AS1A 4W9OA 2ZR6A 2DMVA 5DITA 2OLHA 1WMVA 3VAWA 4R0XA 3CZ8A 3WD3A 4BF8A 1FAPA 2WADA 4U86A 3UF8A 1EG3A 3O5FA 5AHTA 4NNRA 1FJDA 2LKNA 4TW6A 4P8VA 4S3KA 3EY6A 3ARUA 3O5LA 2FKEA 2MF9A 2VCDA 4J4OA 2L4JA 1WNOA 2DT2A 2JZVA 2RQSA 3RM4A 2MPHA 1UR9A 3MQGA 4ZPTR 2QRVA 3ARSA 2Y8NB 4QT2A 3O5JA 5HBFA 2WLZA 4LAXA 4Z2JA 2KFWA 2A3CA 1E9LA 2DG9A 2DG3A 1ZU8A 4WJXA 1FFQA 4W5UA 1ZBVA 2QF8A 2KI3A 3ARQA 1FKRA 1GRJA 4GLXA 1JVWA 4IPXA 4DH0A 4J4NA 1EIBA 2DSZA 2G41A 3RM8A 4HARA 1LQ0A 3NRKA 5HW7A 2DSWA 2ETNA 3ARXA 1JNEA 3WH0A 2XP4A 2M1IA 3CGNA 4L3NA 4Z2HA 1E44A 2RUQA 1HJVA 4G2PA 4PTMA 5JH8A 2AWGA 3AS3A 3LUOA 4DIPA 1HKKA 3ARRA 3FY1A 1ITXA 1W9PA 2BA1A 4P8WA 2YSIA 4Z2GA 4DWSC 1FKBA 2ZAJA 3CHCA 1W26A 4JFIA 2MDIA 2RUDA
chains in the Genus database with same CATH topology
2ZQUA 2ITKA 4IT4A 3MCBB 1PINA 1NWRA 4MPKA 4WKFA 1OGGA 2A3AA 1ZL1A 4MNMA 3UI4A 1RP5A 1TCOC 5GQBA 3JYMA 2LAJA 2RE3A 1XRVA 4DRKA 4Z2KA 1WB0A 1H0GA 4LAYA 1O6WA 1H0IA 3WKZA 2Q5AA 4WK9A 2XP7A 3RFWA 4MSPA 1QPLA 3CHDA 2ZQVA 2B31A 4P8UA 4C02B 1UR8A 1ROUA 5E66A 1ZK6A 3AS2A 4N19A 5CQ2A 3FSCA 1Q6IA 4QIBA 1HKJA 3AS0A 4Q7NA 1HKIA 2JMFA 4DRMA 1JNSA 1Q6UA 4DRIA 4DZ3A 3NTPA 1RD6A 5E65A 3IKGA 1WAWA 4ZS6A 1LL7A 4IQCA 4MAVA 4DROA 2E45A 1VF8A 1D6OA 4ITZA 3AQUA 2O9OA 1OGBA 4NZCA 1X6LA 1SYTA 1EG4A 3IKDA 3UI5A 1IX5A 5GPRA 3TC5A 1XHGA 1E6PA 1K9QA 2LPVA 4U84A 2M8JA 4ODLA 2A3BA 2MNTA 4WIWA 1W1PA 2WLYA 2KGJA 4DRQA 2YAJB 4REXA 3WD2A 4LAWA 2UZ5A 2A3EA 3KABA 1E15A 2G8ZA 4JFMA 2XP3A 1HKMA 1Q1CA 2DG4A 4ODPA 3ARTA 2RURA 5B8IC 2PPNA 2ZR4A 4ZPWR 4DRPA 4ZPVR 2JV4A 4ODQA 1ZBWA 4ODMA 1LJYA 1D7HA 3RMEA 1E6ZA 1FKKA 4DT4A 4DZ2A 1KT0A 3GPKA 1J4HA 5I98A 3WQWA 4E5RA 3O5KA 4KQZA 5HTGA 3H9RB 3JYJA 3ODKA 3CHFA 3O5OA 3QOKA 2XPAA 4ODRA 4DWSA 2DT0A 2RUCA 2PV3A 3IK8A 4AY1A 3OA5A 3MCBA 3UQAA 3NI6A 1L1PA 3FAPA 4WKHA 1EHNA 4LGXA 1FKLA 2LJ4A 3KACA 2ZQTA 2JXWA 2YBUA 4U85A 2WK2A 1LG1A 4MNJA 3UQIA 1FKGA 4URIA 4TNSA 4TW8A 3PA7A 1U79A 2XP6A 1EDQA 1W1VA 3ARYA 4DRHA 3KCEA 2LGOA 2VN1A 3ARZA 3MDYB 1FKSA 1K9RA 2F21A 2JX8A 2F2DA 4G50A 1TR8A 5DF0A 4JFJA 5U47A 4DWSD 1FKHA 5DO2A 3TCZA 4MGVA 2D9FA 4IT6A 2O92A 3UQBA 2ESCA 1ZB5A 1F40A 1A7XA 3O5RA 4Q22A 5E5WA 3ALFA 1GPFA 1NWTA 3FS8A 4TX0A 2KO7A 2YSGA 1TFVA 3WL0A 2M3OW 1YW5A 3WQVA 4MNKA 4DRJA 3WD0A 2AOSA 2MLYA 4MTVA 5HW8A 2YSFA 4JFLA 4HBEA 5DIVA 3WD4A 3CNGA 1O6IA 1ZBCA 1JNTA 2L2SA 1K9TA 4FN2A 1FD9A 1YATA 4P8XA 4ODNA 1CTNA 1HJWA 2RSEA 2WM0A 3G6MA 3PRBA 2WAEA 2DT1A 1NSGA 3ARPA 3KZ7A 5D75A 4JFKA 5E62A 3KAIA 3LE4A 5HT1A 3RGCA 2PPPA 3B7XA 1W9VA 5E64A 3OOBA 1FKFA 4TW7A 3FXYA 3PR9A 1SR0A 1LL6A 4QZVB 1NWSA 3KAHA 1GUVA 1J6YA 2PI6A 1FFRA 1KT1A 2KR7A 2XP5A 4DWSB 4A0UA 1NH6A 3WIJA 2YSHA 1WR7A 5DIUA 1N1AA 1FKIA 1GOIA 2PPOA 1D7IA 2IF4A 2IUZA 3BXWA 2OFNA 1R9HA 4ODKA 1HXVA 5DEZA 3WL1A 1B6CA 3O5IA 1ROTA 3ARVA 1ZBKA 3M85A 5HKGA 4KR0B 2Y78A 3KAFA 2N87A 1Y0OA 4S3JA 1FKTA 3L4HA 2PBCA 2DT3A 4HBOA 5HUAA 2DK1A 3CH9A 5J6EA 3LKXA 1LG2A 2K8IA 4ODOA 4MNLA 1QZ2A 4XAKA 2DSVA 2DSUA 3B9AA 1NWUA 2YBTA 3O5EA 1F8AB 4GIVA 3AROA 1HJXA 4A0TA 1NMWA 1BKFA 1W9UA 4WKAA 3JXVA 1FKJA 2DPEA 3O5GA 2XP8A 3W4RA 2F4EA 2XP9A 2FAPA 1E6NA 2PV1A 4O2TA 1JMQA 2M08A 2DWVA 1LL4A 1M5YA 4L72B 1W1TA 1TK7A 3LKXB 1W1YA 3O5PA 3TDBA 3O5MA 2KXQA 1D7JA 3MQHA 2ZR5A 1BL4A 1J4RA 3RM9A 2KE0A 1PBKA 3ALGA 5BXJA 3M7NA 2FDMA 2MLXA 1ZCNA 1Q6HA 3KADA 1KFWA 3CHEA 1E6RA 2EZ5W 2YSBA 1EQ3A 3ARWA 2MLZA 4GGQA 5HWBA 3G6LA 3B9EA 5HWCA 3I6CA 3PRDA 3KAGA 2M2AA 1FLCA 3B8SA 4W9QA 1D2KA 1JNDA 5HW6A 2ZQSA 1I5HW 3O5DA 2XPBA 1OWQA 4QT3A 1FKDA 2PV2A 4IQ2A 4TYOA 4W9PA 3CGMA 4DRNA 4Z2IA 4NSBA 3FSBA 3IHZA 5GPGA 1T11A 4FAPA 1J4IA 2DJYA 4JYSA 1EYMA 3WD1A 4ML4A 3B9DA 4R5EA 1QPFA 2DK7A 3UI6A 3PQHA 2OWOA 3PRAA 4LAVA 1C9HA 1P5QA 4Z2LA 2M8IA 3O5QA 1X6NA 1NMVA 3AS1A 4W9OA 2ZR6A 2DMVA 5DITA 2OLHA 1WMVA 3VAWA 4R0XA 3CZ8A 3WD3A 4BF8A 1FAPA 2WADA 4U86A 3UF8A 1EG3A 3O5FA 5AHTA 4NNRA 1FJDA 2LKNA 4TW6A 4P8VA 4S3KA 3EY6A 3ARUA 3O5LA 2FKEA 2MF9A 2VCDA 4J4OA 2L4JA 1WNOA 2DT2A 2JZVA 2RQSA 3RM4A 2MPHA 1UR9A 3MQGA 4ZPTR 2QRVA 3ARSA 2Y8NB 4QT2A 3O5JA 5HBFA 2WLZA 4LAXA 4Z2JA 2KFWA 2A3CA 1E9LA 2DG9A 2DG3A 1ZU8A 4WJXA 1FFQA 4W5UA 1ZBVA 2QF8A 2KI3A 3ARQA 1FKRA 4GLXA 1JVWA 4IPXA 4DH0A 4J4NA 1EIBA 2DSZA 2G41A 3RM8A 4HARA 1LQ0A 3NRKA 5HW7A 2DSWA 3ARXA 1JNEA 3WH0A 2XP4A 2M1IA 3CGNA 4L3NA 4Z2HA 2RUQA 1HJVA 4G2PA 4PTMA 5JH8A 2AWGA 3AS3A 3LUOA 4DIPA 1HKKA 3ARRA 3FY1A 1ITXA 1W9PA 2BA1A 4P8WA 2YSIA 4Z2GA 4DWSC 1FKBA 2ZAJA 3CHCA 1W26A 4JFIA 2MDIA 2RUDA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1I5H W;  2ZQU A;  3O5D A;  2ITK A;  3JYJ A;  2XPB A;  1PIN A;  3ODK A;  1FKD A;  2PV2 A;  4IQ2 A;  3KAH A;  4QT3 A;  3CGM A;  3O5O A;  4TYO A;  2XPA A;  4ODR A;  1J6Y A;  3UI4 A;  1KT1 A;  2KR7 A;  2RUC A;  2XP5 A;  2PV3 A;  3IHZ A;  1TCO C;  1T11 A;  3IK8 A;  5GPG A;  4FAP A;  1J4I A;  2DJY A;  3JYM A;  3UQA A;  3NI6 A;  2YSH A;  1WR7 A;  1EYM A;  4JYS A;  5DIU A;  1L1P A;  3FAP A;  2LAJ A;  1QPF A;  2RE3 A;  1FKL A;  1N1A A;  2DK7 A;  1FKI A;  2LJ4 A;  2ZQT A;  3KAC A;  4W9P A;  2PPO A;  3UI6 A;  4DRK A;  2JXW A;  1D7I A;  4U85 A;  4LAV A;  1C9H A;  1O6W A;  4LAY A;  2IF4 A;  1P5Q A;  2Q5A A;  2OFN A;  3UQI A;  2M8I A;  2XP7 A;  3H9R B;  1FKG A;  3O5Q A;  1QPL A;  1NMV A;  1R9H A;  4MSP A;  4ODK A;  4W9O A;  1HXV A;  2ZQV A;  4TNS A;  1B6C A;  4TW8 A;  3PA7 A;  1U79 A;  4C02 B;  2XP6 A;  3O5I A;  1ROU A;  2ZR6 A;  4DRH A;  3KCE A;  2DMV A;  1ROT A;  2LGO A;  2VN1 A;  3MDY B;  5DIT A;  1WMV A;  1FKS A;  1ZK6 A;  3VAW A;  1K9R A;  3M85 A;  4N19 A;  2F21 A;  5CQ2 A;  2JX8 A;  2F2D A;  2Y78 A;  1Q6I A;  4G50 A;  4R0X A;  4QIB A;  3KAF A;  4JFJ A;  2N87 A;  4BF8 A;  1Y0O A;  1FAP A;  1FKT A;  3L4H A;  1FKH A;  4U86 A;  2PBC A;  5HKG A;  2JMF A;  4DRM A;  3UF8 A;  1EG3 A;  1JNS A;  5HUA A;  1Q6U A;  2DK1 A;  4DRI A;  5J6E A;  3O5F A;  5AHT A;  4NNR A;  1FJD A;  4DZ3 A;  3NTP A;  3TCZ A;  2K8I A;  2LKN A;  4ODO A;  4MGV A;  4TW6 A;  3EY6 A;  1QZ2 A;  2D9F A;  3IKG A;  3O5L A;  2FKE A;  2MF9 A;  3UQB A;  2VCD A;  4J4O A;  2L4J A;  1F40 A;  4IQC A;  1A7X A;  2JZV A;  3O5R A;  2E45 A;  4DRO A;  3O5E A;  2RQS A;  1F8A B;  1D6O A;  4ITZ A;  2MPH A;  4GIV A;  5HW6 A;  4TX0 A;  1NMW A;  1BKF A;  2KO7 A;  1EG4 A;  2YSG A;  3IKD A;  3UI5 A;  4QT2 A;  3O5J A;  3JXV A;  1FKJ A;  3TC5 A;  3O5G A;  2XP8 A;  4LAX A;  2M3O W;  1YW5 A;  2F4E A;  2XP9 A;  2KFW A;  1K9Q A;  2FAP A;  4DRJ A;  2PV1 A;  4O2T A;  2DG9 A;  2LPV A;  2DG3 A;  4U84 A;  1JMQ A;  2M8J A;  2M08 A;  2MLY A;  4ODL A;  5HW8 A;  2DWV A;  1M5Y A;  2YSF A;  4JFL A;  1TK7 A;  2MNT A;  5DIV A;  1FKR A;  2KI3 A;  3CNG A;  3O5P A;  3TDB A;  3O5M A;  2KGJ A;  2KXQ A;  1JVW A;  1D7J A;  4REX A;  4IPX A;  4J4N A;  1JNT A;  4DH0 A;  4DRQ A;  2ZR5 A;  2L2S A;  1BL4 A;  1J4R A;  3NRK A;  4LAW A;  5HW7 A;  4FN2 A;  1FD9 A;  2UZ5 A;  1YAT A;  3KAB A;  4DRN A;  2KE0 A;  1PBK A;  4JFM A;  2XP3 A;  3M7N A;  2RSE A;  4ODN A;  5BXJ A;  3WH0 A;  2XP4 A;  2M1I A;  3CGN A;  1Q1C A;  2MLX A;  3PRB A;  1ZCN A;  2RUQ A;  1Q6H A;  3KAD A;  2DG4 A;  4ODP A;  4G2P A;  3RFW A;  2RUR A;  5B8I C;  1NSG A;  2EZ5 W;  2YSB A;  2ZR4 A;  2PPN A;  2AWG A;  3KZ7 A;  5D75 A;  3LUO A;  4DRP A;  4DIP A;  2MLZ A;  1EQ3 A;  2JV4 A;  4JFK A;  4ODQ A;  4GGQ A;  5HWB A;  3KAI A;  4ODM A;  3LE4 A;  1D7H A;  5HT1 A;  2BA1 A;  3RGC A;  1FKK A;  2PPP A;  4DT4 A;  4DZ2 A;  2YSI A;  1KT0 A;  3GPK A;  5HWC A;  1J4H A;  3I6C A;  3B7X A;  3PRD A;  5I98 A;  3OOB A;  3KAG A;  1FKB A;  4E5R A;  2M2A A;  1FKF A;  2ZAJ A;  3O5K A;  4W9Q A;  5HTG A;  1W26 A;  4JFI A;  2MDI A;  4TW7 A;  2RUD A;  2ZQS A; 
#chains in the Genus database with same CATH topology
 2ZQU A;  2ITK A;  4IT4 A;  3MCB B;  1PIN A;  1NWR A;  4MPK A;  4WKF A;  1OGG A;  2A3A A;  1ZL1 A;  4MNM A;  3UI4 A;  1RP5 A;  1TCO C;  5GQB A;  3JYM A;  2LAJ A;  2RE3 A;  1XRV A;  4DRK A;  4Z2K A;  1WB0 A;  1H0G A;  4LAY A;  1O6W A;  1H0I A;  3WKZ A;  2Q5A A;  4WK9 A;  2XP7 A;  3RFW A;  4MSP A;  1QPL A;  3CHD A;  2ZQV A;  2B31 A;  2PN0 A;  4P8U A;  4C02 B;  1UR8 A;  1ROU A;  5E66 A;  1ZK6 A;  3AS2 A;  4N19 A;  5CQ2 A;  3FSC A;  1Q6I A;  4QIB A;  1HKJ A;  3AS0 A;  4Q7N A;  1HKI A;  2JMF A;  4DRM A;  1JNS A;  1Q6U A;  4DRI A;  4DZ3 A;  3NTP A;  1RD6 A;  5E65 A;  3IKG A;  1WAW A;  4ZS6 A;  1LL7 A;  4IQC A;  4MAV A;  4DRO A;  2E45 A;  1VF8 A;  1D6O A;  4ITZ A;  3AQU A;  2O9O A;  1OGB A;  4NZC A;  1X6L A;  1SYT A;  1EG4 A;  3IKD A;  3UI5 A;  1IX5 A;  5GPR A;  3TC5 A;  1XHG A;  1E6P A;  1K9Q A;  2LPV A;  4U84 A;  2M8J A;  4ODL A;  2A3B A;  2MNT A;  4WIW A;  1W1P A;  2WLY A;  2KGJ A;  4DRQ A;  2YAJ B;  4REX A;  3WD2 A;  4LAW A;  2UZ5 A;  2A3E A;  3KAB A;  1E15 A;  2G8Z A;  4JFM A;  2XP3 A;  1HKM A;  1Q1C A;  2DG4 A;  4ODP A;  3ART A;  2RUR A;  5B8I C;  2PPN A;  2ZR4 A;  4ZPW R;  4DRP A;  4ZPV R;  2JV4 A;  4ODQ A;  1ZBW A;  4ODM A;  1LJY A;  1D7H A;  3RME A;  1E6Z A;  1FKK A;  4DT4 A;  4DZ2 A;  1KT0 A;  3GPK A;  1J4H A;  5I98 A;  3WQW A;  4E5R A;  3O5K A;  4KQZ A;  5HTG A;  3H9R B;  3JYJ A;  3ODK A;  3CHF A;  3O5O A;  3QOK A;  2XPA A;  4ODR A;  4DWS A;  2DT0 A;  2RUC A;  2PV3 A;  3IK8 A;  4AY1 A;  3OA5 A;  3MCB A;  3UQA A;  3NI6 A;  1L1P A;  3FAP A;  4WKH A;  1EHN A;  4LGX A;  1FKL A;  2LJ4 A;  3KAC A;  2ZQT A;  2JXW A;  2YBU A;  4U85 A;  2WK2 A;  1LG1 A;  4MNJ A;  3UQI A;  1FKG A;  4URI A;  4TNS A;  4TW8 A;  3PA7 A;  1U79 A;  2XP6 A;  1EDQ A;  1W1V A;  3ARY A;  4DRH A;  3KCE A;  2LGO A;  2VN1 A;  3ARZ A;  3MDY B;  1FKS A;  1K9R A;  2F21 A;  2JX8 A;  2F2D A;  4G50 A;  1TR8 A;  5DF0 A;  4JFJ A;  5U47 A;  4DWS D;  1FKH A;  5DO2 A;  3GTY X;  3EIP A;  3TCZ A;  4MGV A;  2D9F A;  4IT6 A;  2O92 A;  3UQB A;  2ESC A;  1ZB5 A;  1F40 A;  1A7X A;  3O5R A;  4Q22 A;  5E5W A;  3ALF A;  1GPF A;  1NWT A;  3FS8 A;  4TX0 A;  2KO7 A;  2YSG A;  1TFV A;  3WL0 A;  2M3O W;  1YW5 A;  3WQV A;  3GU0 A;  4MNK A;  4DRJ A;  3WD0 A;  2AOS A;  2MLY A;  4MTV A;  5HW8 A;  2YSF A;  2F23 A;  4JFL A;  4HBE A;  5DIV A;  3WD4 A;  3CNG A;  1O6I A;  1ZBC A;  1JNT A;  2L2S A;  1K9T A;  4FN2 A;  1FD9 A;  1YAT A;  4P8X A;  4ODN A;  1CTN A;  1HJW A;  2RSE A;  2WM0 A;  3G6M A;  3PRB A;  2WAE A;  2DT1 A;  1NSG A;  3ARP A;  3KZ7 A;  5D75 A;  4JFK A;  5E62 A;  3KAI A;  3LE4 A;  5HT1 A;  3RGC A;  2PPP A;  3B7X A;  1W9V A;  5E64 A;  3OOB A;  1FKF A;  4TW7 A;  3FXY A;  3PR9 A;  1SR0 A;  1LL6 A;  4QZV B;  1NWS A;  3KAH A;  1GUV A;  1J6Y A;  2PI6 A;  1FFR A;  1KT1 A;  2KR7 A;  2XP5 A;  4DWS B;  4A0U A;  1NH6 A;  3WIJ A;  2YSH A;  1WR7 A;  5DIU A;  1N1A A;  1FKI A;  1GOI A;  2PPO A;  1D7I A;  2IF4 A;  2IUZ A;  3BXW A;  2OFN A;  1R9H A;  4ODK A;  2P4V A;  1HXV A;  5DEZ A;  3WL1 A;  1B6C A;  1JCH B;  3O5I A;  1ROT A;  3ARV A;  1ZBK A;  3M85 A;  5HKG A;  4KR0 B;  2Y78 A;  4UDM A;  3KAF A;  2N87 A;  1Y0O A;  4S3J A;  1FKT A;  3L4H A;  2PBC A;  2DT3 A;  4HBO A;  5HUA A;  2DK1 A;  3CH9 A;  5J6E A;  3LKX A;  1LG2 A;  2K8I A;  4ODO A;  4MNL A;  1QZ2 A;  4XAK A;  2DSV A;  2DSU A;  2B5U B;  3B9A A;  1NWU A;  2YBT A;  3O5E A;  1F8A B;  4GIV A;  3ARO A;  1HJX A;  4A0T A;  1NMW A;  1BKF A;  1W9U A;  4WKA A;  3JXV A;  1FKJ A;  2DPE A;  3O5G A;  2XP8 A;  3W4R A;  2F4E A;  2XP9 A;  2EUL A;  1E6N A;  2FAP A;  2PV1 A;  4O2T A;  1JMQ A;  2M08 A;  2DWV A;  1LL4 A;  1M5Y A;  4L72 B;  1W1T A;  1TK7 A;  3LKX B;  1W1Y A;  3O5P A;  3TDB A;  3O5M A;  2KXQ A;  1D7J A;  3MQH A;  2ZR5 A;  1BL4 A;  1J4R A;  3RM9 A;  2KE0 A;  1PBK A;  3ALG A;  5BXJ A;  3M7N A;  2FDM A;  2MLX A;  1ZCN A;  1Q6H A;  3KAD A;  1KFW A;  3CHE A;  1E6R A;  2EZ5 W;  2YSB A;  1EQ3 A;  3ARW A;  2MLZ A;  4GGQ A;  5HWB A;  3G6L A;  3B9E A;  5HWC A;  3BMB A;  3I6C A;  3PRD A;  3KAG A;  2M2A A;  1FLC A;  3B8S A;  4W9Q A;  1D2K A;  1JND A;  5HW6 A;  2ZQS A;  1I5H W;  3O5D A;  2XPB A;  1OWQ A;  4QT3 A;  1FKD A;  2PV2 A;  4IQ2 A;  4TYO A;  4W9P A;  3CGM A;  4DRN A;  4Z2I A;  4NSB A;  3FSB A;  3IHZ A;  5GPG A;  1T11 A;  4FAP A;  1J4I A;  2DJY A;  4JYS A;  1EYM A;  3WD1 A;  4ML4 A;  3B9D A;  4R5E A;  1QPF A;  2DK7 A;  3UI6 A;  3PQH A;  2OWO A;  3PRA A;  4LAV A;  1C9H A;  1P5Q A;  4Z2L A;  2M8I A;  3O5Q A;  1X6N A;  1NMV A;  3AS1 A;  4W9O A;  2ZR6 A;  2DMV A;  5DIT A;  2OLH A;  1WMV A;  3VAW A;  4R0X A;  3CZ8 A;  3WD3 A;  4BF8 A;  1FAP A;  2WAD A;  4U86 A;  3UF8 A;  1EG3 A;  3O5F A;  5AHT A;  4NNR A;  1FJD A;  2LKN A;  4TW6 A;  4P8V A;  4S3K A;  3EY6 A;  3ARU A;  3O5L A;  2FKE A;  2MF9 A;  2VCD A;  4J4O A;  2L4J A;  1WNO A;  2DT2 A;  2JZV A;  2RQS A;  3RM4 A;  2MPH A;  1UR9 A;  3MQG A;  4ZPT R;  2QRV A;  3ARS A;  2Y8N B;  4QT2 A;  3O5J A;  5HBF A;  2WLZ A;  4LAX A;  4Z2J A;  2KFW A;  2A3C A;  1E9L A;  2DG9 A;  2DG3 A;  1ZU8 A;  4WJX A;  1FFQ A;  4W5U A;  1ZBV A;  2QF8 A;  2KI3 A;  3ARQ A;  1FKR A;  1GRJ A;  4GLX A;  1JVW A;  4IPX A;  4DH0 A;  4J4N A;  1EIB A;  2DSZ A;  2G41 A;  3RM8 A;  4HAR A;  1LQ0 A;  3NRK A;  5HW7 A;  2DSW A;  2ETN A;  3ARX A;  1JNE A;  3WH0 A;  2XP4 A;  2M1I A;  3CGN A;  4L3N A;  4Z2H A;  1E44 A;  2RUQ A;  1HJV A;  4G2P A;  4PTM A;  5JH8 A;  2AWG A;  3AS3 A;  3LUO A;  4DIP A;  1HKK A;  3ARR A;  3FY1 A;  1ITX A;  1W9P A;  2BA1 A;  4P8W A;  2YSI A;  4Z2G A;  4DWS C;  1FKB A;  2ZAJ A;  3CHC A;  1W26 A;  4JFI A;  2MDI A;  2RUD A; 
#chains in the Genus database with same CATH homology
 2ZQU A;  2ITK A;  4IT4 A;  3MCB B;  1PIN A;  1NWR A;  4MPK A;  4WKF A;  1OGG A;  2A3A A;  1ZL1 A;  4MNM A;  3UI4 A;  1RP5 A;  1TCO C;  5GQB A;  3JYM A;  2LAJ A;  2RE3 A;  1XRV A;  4DRK A;  4Z2K A;  1WB0 A;  1H0G A;  4LAY A;  1O6W A;  1H0I A;  3WKZ A;  2Q5A A;  4WK9 A;  2XP7 A;  3RFW A;  4MSP A;  1QPL A;  3CHD A;  2ZQV A;  2B31 A;  4P8U A;  4C02 B;  1UR8 A;  1ROU A;  5E66 A;  1ZK6 A;  3AS2 A;  4N19 A;  5CQ2 A;  3FSC A;  1Q6I A;  4QIB A;  1HKJ A;  3AS0 A;  4Q7N A;  1HKI A;  2JMF A;  4DRM A;  1JNS A;  1Q6U A;  4DRI A;  4DZ3 A;  3NTP A;  1RD6 A;  5E65 A;  3IKG A;  1WAW A;  4ZS6 A;  1LL7 A;  4IQC A;  4MAV A;  4DRO A;  2E45 A;  1VF8 A;  1D6O A;  4ITZ A;  3AQU A;  2O9O A;  1OGB A;  4NZC A;  1X6L A;  1SYT A;  1EG4 A;  3IKD A;  3UI5 A;  1IX5 A;  5GPR A;  3TC5 A;  1XHG A;  1E6P A;  1K9Q A;  2LPV A;  4U84 A;  2M8J A;  4ODL A;  2A3B A;  2MNT A;  4WIW A;  1W1P A;  2WLY A;  2KGJ A;  4DRQ A;  2YAJ B;  4REX A;  3WD2 A;  4LAW A;  2UZ5 A;  2A3E A;  3KAB A;  1E15 A;  2G8Z A;  4JFM A;  2XP3 A;  1HKM A;  1Q1C A;  2DG4 A;  4ODP A;  3ART A;  2RUR A;  5B8I C;  2PPN A;  2ZR4 A;  4ZPW R;  4DRP A;  4ZPV R;  2JV4 A;  4ODQ A;  1ZBW A;  4ODM A;  1LJY A;  1D7H A;  3RME A;  1E6Z A;  1FKK A;  4DT4 A;  4DZ2 A;  1KT0 A;  3GPK A;  1J4H A;  5I98 A;  3WQW A;  4E5R A;  3O5K A;  4KQZ A;  5HTG A;  3H9R B;  3JYJ A;  3ODK A;  3CHF A;  3O5O A;  3QOK A;  2XPA A;  4ODR A;  4DWS A;  2DT0 A;  2RUC A;  2PV3 A;  3IK8 A;  4AY1 A;  3OA5 A;  3MCB A;  3UQA A;  3NI6 A;  1L1P A;  3FAP A;  4WKH A;  1EHN A;  4LGX A;  1FKL A;  2LJ4 A;  3KAC A;  2ZQT A;  2JXW A;  2YBU A;  4U85 A;  2WK2 A;  1LG1 A;  4MNJ A;  3UQI A;  1FKG A;  4URI A;  4TNS A;  4TW8 A;  3PA7 A;  1U79 A;  2XP6 A;  1EDQ A;  1W1V A;  3ARY A;  4DRH A;  3KCE A;  2LGO A;  2VN1 A;  3ARZ A;  3MDY B;  1FKS A;  1K9R A;  2F21 A;  2JX8 A;  2F2D A;  4G50 A;  1TR8 A;  5DF0 A;  4JFJ A;  5U47 A;  4DWS D;  1FKH A;  5DO2 A;  3TCZ A;  4MGV A;  2D9F A;  4IT6 A;  2O92 A;  3UQB A;  2ESC A;  1ZB5 A;  1F40 A;  1A7X A;  3O5R A;  4Q22 A;  5E5W A;  3ALF A;  1GPF A;  1NWT A;  3FS8 A;  4TX0 A;  2KO7 A;  2YSG A;  1TFV A;  3WL0 A;  2M3O W;  1YW5 A;  3WQV A;  4MNK A;  4DRJ A;  3WD0 A;  2AOS A;  2MLY A;  4MTV A;  5HW8 A;  2YSF A;  4JFL A;  4HBE A;  5DIV A;  3WD4 A;  3CNG A;  1O6I A;  1ZBC A;  1JNT A;  2L2S A;  1K9T A;  4FN2 A;  1FD9 A;  1YAT A;  4P8X A;  4ODN A;  1CTN A;  1HJW A;  2RSE A;  2WM0 A;  3G6M A;  3PRB A;  2WAE A;  2DT1 A;  1NSG A;  3ARP A;  3KZ7 A;  5D75 A;  4JFK A;  5E62 A;  3KAI A;  3LE4 A;  5HT1 A;  3RGC A;  2PPP A;  3B7X A;  1W9V A;  5E64 A;  3OOB A;  1FKF A;  4TW7 A;  3FXY A;  3PR9 A;  1SR0 A;  1LL6 A;  4QZV B;  1NWS A;  3KAH A;  1GUV A;  1J6Y A;  2PI6 A;  1FFR A;  1KT1 A;  2KR7 A;  2XP5 A;  4DWS B;  4A0U A;  1NH6 A;  3WIJ A;  2YSH A;  1WR7 A;  5DIU A;  1N1A A;  1FKI A;  1GOI A;  2PPO A;  1D7I A;  2IF4 A;  2IUZ A;  3BXW A;  2OFN A;  1R9H A;  4ODK A;  1HXV A;  5DEZ A;  3WL1 A;  1B6C A;  3O5I A;  1ROT A;  3ARV A;  1ZBK A;  3M85 A;  5HKG A;  4KR0 B;  2Y78 A;  3KAF A;  2N87 A;  1Y0O A;  4S3J A;  1FKT A;  3L4H A;  2PBC A;  2DT3 A;  4HBO A;  5HUA A;  2DK1 A;  3CH9 A;  5J6E A;  3LKX A;  1LG2 A;  2K8I A;  4ODO A;  4MNL A;  1QZ2 A;  4XAK A;  2DSV A;  2DSU A;  3B9A A;  1NWU A;  2YBT A;  3O5E A;  1F8A B;  4GIV A;  3ARO A;  1HJX A;  4A0T A;  1NMW A;  1BKF A;  1W9U A;  4WKA A;  3JXV A;  1FKJ A;  2DPE A;  3O5G A;  2XP8 A;  3W4R A;  2F4E A;  2XP9 A;  2FAP A;  1E6N A;  2PV1 A;  4O2T A;  1JMQ A;  2M08 A;  2DWV A;  1LL4 A;  1M5Y A;  4L72 B;  1W1T A;  1TK7 A;  3LKX B;  1W1Y A;  3O5P A;  3TDB A;  3O5M A;  2KXQ A;  1D7J A;  3MQH A;  2ZR5 A;  1BL4 A;  1J4R A;  3RM9 A;  2KE0 A;  1PBK A;  3ALG A;  5BXJ A;  3M7N A;  2FDM A;  2MLX A;  1ZCN A;  1Q6H A;  3KAD A;  1KFW A;  3CHE A;  1E6R A;  2EZ5 W;  2YSB A;  1EQ3 A;  3ARW A;  2MLZ A;  4GGQ A;  5HWB A;  3G6L A;  3B9E A;  5HWC A;  3I6C A;  3PRD A;  3KAG A;  2M2A A;  1FLC A;  3B8S A;  4W9Q A;  1D2K A;  1JND A;  5HW6 A;  2ZQS A;  1I5H W;  3O5D A;  2XPB A;  1OWQ A;  4QT3 A;  1FKD A;  2PV2 A;  4IQ2 A;  4TYO A;  4W9P A;  3CGM A;  4DRN A;  4Z2I A;  4NSB A;  3FSB A;  3IHZ A;  5GPG A;  1T11 A;  4FAP A;  1J4I A;  2DJY A;  4JYS A;  1EYM A;  3WD1 A;  4ML4 A;  3B9D A;  4R5E A;  1QPF A;  2DK7 A;  3UI6 A;  3PQH A;  2OWO A;  3PRA A;  4LAV A;  1C9H A;  1P5Q A;  4Z2L A;  2M8I A;  3O5Q A;  1X6N A;  1NMV A;  3AS1 A;  4W9O A;  2ZR6 A;  2DMV A;  5DIT A;  2OLH A;  1WMV A;  3VAW A;  4R0X A;  3CZ8 A;  3WD3 A;  4BF8 A;  1FAP A;  2WAD A;  4U86 A;  3UF8 A;  1EG3 A;  3O5F A;  5AHT A;  4NNR A;  1FJD A;  2LKN A;  4TW6 A;  4P8V A;  4S3K A;  3EY6 A;  3ARU A;  3O5L A;  2FKE A;  2MF9 A;  2VCD A;  4J4O A;  2L4J A;  1WNO A;  2DT2 A;  2JZV A;  2RQS A;  3RM4 A;  2MPH A;  1UR9 A;  3MQG A;  4ZPT R;  2QRV A;  3ARS A;  2Y8N B;  4QT2 A;  3O5J A;  5HBF A;  2WLZ A;  4LAX A;  4Z2J A;  2KFW A;  2A3C A;  1E9L A;  2DG9 A;  2DG3 A;  1ZU8 A;  4WJX A;  1FFQ A;  4W5U A;  1ZBV A;  2QF8 A;  2KI3 A;  3ARQ A;  1FKR A;  4GLX A;  1JVW A;  4IPX A;  4DH0 A;  4J4N A;  1EIB A;  2DSZ A;  2G41 A;  3RM8 A;  4HAR A;  1LQ0 A;  3NRK A;  5HW7 A;  2DSW A;  3ARX A;  1JNE A;  3WH0 A;  2XP4 A;  2M1I A;  3CGN A;  4L3N A;  4Z2H A;  2RUQ A;  1HJV A;  4G2P A;  4PTM A;  5JH8 A;  2AWG A;  3AS3 A;  3LUO A;  4DIP A;  1HKK A;  3ARR A;  3FY1 A;  1ITX A;  1W9P A;  2BA1 A;  4P8W A;  2YSI A;  4Z2G A;  4DWS C;  1FKB A;  2ZAJ A;  3CHC A;  1W26 A;  4JFI A;  2MDI A;  2RUD A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...