1NMVA

Solution structure of human pin1
Total Genus 30
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
30
sequence length
163
structure length
163
Chain Sequence
MADEEKLPPGWEKRMSRSSGRVYYFNHITNASQWERPSGNSSSGGKNGQGEPARVRCSHLLVKHSQSRRPSSWRQEKITRTKEEALELINGYIQKIKSGEEDFESLASQFSDCSSAKARGDLGAFSRGQMQKPFEDASFALRTGEMSGPVFTDSGIHIILRTE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Isomerase
molecule keywords Peptidyl-prolyl cis-trans isomerase NIMA-interacting 1
publication title Structural Analysis of the Mitotic Regulator hPin1 in Solution: INSIGHTS INTO DOMAIN ARCHITECTURE AND SUBSTRATE BINDING.
pubmed doi rcsb
source organism Homo sapiens
total genus 30
structure length 163
sequence length 163
ec nomenclature ec 5.2.1.8: Peptidylprolyl isomerase.
pdb deposition date 2003-01-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00397 WW WW domain
A PF00639 Rotamase PPIC-type PPIASE domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.20.70.10 Mainly Beta Single Sheet Ubiquitin Ligase Nedd4; Chain: W; Ubiquitin Ligase Nedd4; Chain: W; 1nmvA01
3.10.50.40 Alpha Beta Roll Chitinase A; domain 3 Chitinase A; domain 3 1nmvA02
2PBCA 2M8IA 1J4HA 2DK7A 3KZ7A 4ITZA 1ZK6A 1D7IA 3UQBA 2MLXA 3LE4A 4DRIA 4FAPA 4IQ2A 3UI4A 2RSEA 1U79A 2K8IA 1JNSA 1N1AA 4U84A 1ROUA 4DT4A 1ROTA 4U85A 2XP4A 2ZR6A 1K9QA 4ODOA 4TNSA 4DROA 2LGOA 1D7JA 2YSGA 5HT1A 3UQIA 2LPVA 3TCZA 1WR7A 3MDYB 3FAPA 2KGJA 3KCEA 4U86A 2VN1A 3NRKA 3TDBA 2F4EA 2DG9A 3NI6A 2ZR5A 4ODRA 3O5FA 3IHZA 4ODMA 2FAPA 4MSPA 5HTGA 2KE0A 4E5RA 4IQCA 1FKTA 4DRNA 2LKNA 1WMVA 1FD9A 5D75A 3O5PA 4DRQA 1EG3A 1J4RA 4ODQA 1HXVA 4DZ3A 3KABA 5B8IC 1EQ3A 1FAPA 2EZ5W 4JFKA 3IKGA 2XP3A 1K9RA 3O5MA 1PINA 2XP8A 1FKFA 3JXVA 2DWVA 5HW8A 1J4IA 4DIPA 1FKIA 2M08A 2E45A 1A7XA 2ZR4A 2XPAA 3GPKA 1P5QA 5DIUA 1ZCNA 2RURA 5BXJA 2RUDA 4QT3A 4TW8A 1Q6HA 5I98A 1F40A 2PPNA 4J4NA 2ZQTA 1QPFA 1NSGA 1B6CA 5DIVA 1F8AB 4MGVA 3O5LA 3PRBA 2ZQSA 2MPHA 1C9HA 2MDIA 1L1PA 2XPBA 2M1IA 1EYMA 2YSHA 2KO7A 4G50A 2PV1A 2F21A 3VAWA 2DK1A 5HW6A 5HW7A 2FKEA 1NMWA 2DG3A 1FKLA 3O5KA 4DRHA 1D7HA 2RQSA 2M3OW 4TW7A 2ZAJA 3ODKA 1W26A 3UF8A 2YSIA 2OFNA 3O5OA 3O5QA 1J6YA 4LAYA 3IK8A 3EY6A 2DMVA 3JYJA 1FKKA 2MLZA 2N87A 3OOBA 2XP9A 2JXWA 3H9RB 2DG4A 1NMVA 3PRDA 4LAVA 2XP6A 5J6EA 1FKDA 1JNTA 2RUCA 3M85A 1BKFA 3LUOA 2M2AA 4TX0A 3O5EA 1Q6UA 2LJ4A 4ODLA 2MF9A 2KR7A 1QZ2A 2VCDA 2KI3A 3RFWA 4BF8A 4DRPA 3CGNA 2LAJA 4LAXA 2AWGA 4IPXA 2RE3A 2Y78A 1FJDA 2PPOA 4C02B 3CGMA 4ODPA 4JFMA 1JVWA 1KT0A 4J4OA 4GIVA 3KAIA 4W9QA 4DH0A 5HWCA 3JYMA 3IKDA 2XP7A 3KAGA 2F2DA 1FKSA 2D9FA 3UQAA 2Q5AA 1FKBA 1FKJA 1D6OA 4N19A 2PV3A 1EG4A 4FN2A 4GGQA 4JFLA 4W9OA 4NNRA 2YSBA 2ZQUA 4ODNA 4DRJA 5CQ2A 4W9PA 4TYOA 4R0XA 4QIBA 2ZQVA 1BL4A 4DRMA 2PV2A 4LAWA 4DRKA 5GPGA 2JZVA 2UZ5A 3KAFA 2ITKA 3CNGA 4G2PA 3O5JA 1Q1CA 1FKRA 1Q6IA 5HUAA 1I5HW 1YATA 2BA1A 2XP5A 1R9HA 3O5IA 3NTPA 1FKHA 3RGCA 4TW6A 1PBKA 3UI5A 3KAHA 1YW5A 2L4JA 3O5RA 4JFIA 3PA7A 3UI6A 2YSFA 1T11A 2MNTA 2MLYA 4O2TA 1KT1A 2DJYA 4JFJA 1JMQA 3TC5A 2IF4A 1TK7A 2RUQA 2L2SA 4ODKA 1Y0OA 3KADA 4REXA 4JYSA 1QPLA 1FKGA 3L4HA 3KACA 5HWBA 3M7NA 2PPPA 4DZ2A 3O5DA 2JV4A 2JX8A 2KFWA 5DITA 1M5YA 3B7XA 3I6CA 4QT2A 2KXQA 2M8JA 1TCOC 3O5GA 5HKGA 1O6WA 3WH0A 2JMFA 5AHTA
chains in the Genus database with same CATH superfamily
2PBCA 1LL4A 2WLYA 2M8IA 2PN0A 1J4HA 3WQVA 2IUZA 2DK7A 2EULA 3KZ7A 1ZB5A 4ITZA 5DO2A 1ZK6A 1D7IA 3UQBA 2MLXA 3LE4A 4DRIA 3FSBA 4FAPA 4IQ2A 4MNKA 4Q22A 2WADA 3UI4A 2RSEA 4Z2KA 3MQGA 1U79A 5DF0A 1ZBKA 4MNLA 1X6NA 1ZBVA 2K8IA 1JNSA 3B9EA 3ARVA 1N1AA 4A0UA 1GOIA 4U84A 1ROUA 4DT4A 1ROTA 4U85A 2XP4A 1W9PA 2ZR6A 1K9QA 4ODOA 4TNSA 4GLXA 2DSWA 4DROA 2LGOA 1D7JA 1E6ZA 1GUVA 3ARQA 2YSGA 2WLZA 5HT1A 3UQIA 2LPVA 4NZCA 5E66A 5DEZA 1JNEA 3TCZA 2FDMA 1WR7A 3MDYB 4ZPVR 4Q7NA 1ZBWA 3FAPA 2KGJA 3BXWA 3KCEA 1UR8A 4U86A 2G8ZA 2VN1A 2DT3A 1NWTA 3CH9A 1H0IA 3NRKA 4L72B 2ETNA 2WM0A 3TDBA 2F4EA 2DG9A 3NI6A 2ZR5A 3WD4A 4ODRA 3O5FA 3IHZA 4DWSD 4ODMA 1NH6A 2FAPA 3CHCA 4MSPA 5HTGA 2KE0A 1XRVA 4E5RA 4IQCA 3AROA 1JNDA 2DSUA 1FKTA 2B31A 1H0GA 4HBOA 3PR9A 5GQBA 3PRAA 5GPRA 5JH8A 1NWSA 4QZVB 4DRNA 2LKNA 4Z2LA 1WMVA 1FD9A 5D75A 3O5PA 1EG3A 1J4RA 4DRQA 4ODQA 4L3NA 1OGBA 1HXVA 4DZ3A 3KABA 1EHNA 5B8IC 1OGGA 1EQ3A 1FAPA 4WKHA 2EZ5W 4MPKA 4JFKA 3IKGA 3RM9A 2XP3A 1K9RA 3O5MA 3W4RA 1PINA 2XP8A 1FKFA 4ML4A 1FFRA 4DWSB 3AQUA 3JXVA 2DWVA 4HBEA 1UR9A 1K9TA 5HW8A 1J4IA 4DIPA 1FKIA 1HKJA 2G41A 2M08A 2E45A 1A7XA 2ZR4A 4P8UA 2XPAA 3GPKA 2DSVA 4S3JA 1P5QA 5DIUA 1ZCNA 2RURA 3CHDA 4WJXA 5BXJA 3CHEA 2RUDA 1LQ0A 5E64A 1RD6A 4QT3A 4TW8A 1Q6HA 2OWOA 1KFWA 5I98A 1F40A 2PPNA 2YBTA 4IT6A 4J4NA 3RMEA 2ZQTA 1QPFA 1NSGA 2DPEA 3ARYA 3WD3A 1B6CA 5DIVA 1F8AB 4MGVA 3O5LA 3PRBA 2ZQSA 2MPHA 1C9HA 2MDIA 3B9AA 1E44A 1L1PA 3WD2A 2XPBA 2M1IA 1EYMA 2YSHA 2KO7A 4G50A 4P8WA 2PV1A 2F21A 3VAWA 2DK1A 2F23A 5HW6A 3AS1A 5HW7A 2FKEA 1NMWA 2DG3A 1FKLA 3O5KA 4DRHA 3ARWA 1D7HA 4MNJA 4HARA 2WAEA 1HJWA 2RQSA 4R5EA 4WKFA 2M3OW 4TW7A 2ZAJA 3ODKA 1W26A 3UF8A 2OLHA 2YSIA 2OFNA 3O5OA 3O5QA 1HKMA 1ITXA 1J6YA 4LAYA 3FSCA 2P4VA 3IK8A 3EY6A 2DMVA 1JCHB 3JYJA 2DT0A 1FKKA 2MLZA 2N87A 5E62A 3OOBA 2PI6A 4W5UA 2XP9A 2JXWA 2A3CA 3H9RB 3BMBA 2Y8NB 1W1PA 1VF8A 4DWSA 2DG4A 1NMVA 3LKXB 3FXYA 3PRDA 4LAVA 2XP6A 5J6EA 1FKDA 2YAJB 1FFQA 1JNTA 3AS3A 3G6LA 2O9OA 1LJYA 2RUCA 3M85A 4DWSC 3GU0A 1BKFA 3RM4A 3ARZA 4AY1A 4PTMA 3WQWA 3LUOA 1NWRA 2M2AA 4TX0A 4ZS6A 3O5EA 2AOSA 1Q6UA 2LJ4A 4ODLA 2MF9A 1WAWA 3ARUA 1W9VA 3PQHA 3ARTA 2KR7A 1QZ2A 1D2KA 4WK9A 2VCDA 1WNOA 2A3AA 2ESCA 2KI3A 3RFWA 4BF8A 4DRPA 2QF8A 3CGNA 2LAJA 3MQHA 4LAXA 2AWGA 1TR8A 4IPXA 2RE3A 2Y78A 1FJDA 1LL6A 1OWQA 4ZPTR 1IX5A 4KR0B 2PPOA 4C02B 1E15A 3CGMA 4URIA 1GPFA 4ODPA 3ARRA 4JFMA 1JVWA 1KT0A 4J4OA 3WKZA 4GIVA 3KAIA 1E6PA 4W9QA 4DH0A 5HWCA 3JYMA 3IKDA 3GTYX 2XP7A 3ARXA 3KAGA 3WD0A 2F2DA 1SYTA 1CTNA 1FKSA 2D9FA 3EIPA 2WK2A 3UQAA 1E9LA 2Q5AA 1LG1A 4MAVA 1FKBA 3LKXA 1EDQA 1FKJA 4P8XA 1D6OA 2YBUA 4N19A 4A0TA 2PV3A 3MCBB 3CZ8A 4KQZA 1EG4A 4FN2A 4GGQA 1LG2A 4JFLA 1LL7A 4W9OA 4NNRA 3FS8A 2YSBA 2ZQUA 3AS2A 1EIBA 4ODNA 4DRJA 2B5UB 5CQ2A 4W9PA 4TYOA 3G6MA 1SR0A 3ALGA 4R0XA 4Z2HA 4QIBA 4Z2IA 1HJXA 4NSBA 4P8VA 2ZQVA 1BL4A 4DRMA 2PV2A 1E6RA 4LAWA 4DRKA 1RP5A 5GPGA 3AS0A 3WL0A 2JZVA 2UZ5A 3KAFA 4XAKA 2QRVA 2ITKA 3CNGA 3WIJA 4G2PA 3O5JA 1Q1CA 1FKRA 3WD1A 1Q6IA 2A3EA 5HUAA 3B8SA 1I5HW 1YATA 2BA1A 1HKIA 2XP5A 4MNMA 1R9HA 3O5IA 3NTPA 1FKHA 2O92A 4ZPWR 3RGCA 4TW6A 1W1TA 2A3BA 3B9DA 4UDMA 1PBKA 3UI5A 3KAHA 1YW5A 3RM8A 2L4JA 1TFVA 1XHGA 1NWUA 1HJVA 3O5RA 4JFIA 4S3KA 2DT2A 3WL1A 1HKKA 5E5WA 3PA7A 3UI6A 2YSFA 1T11A 2MNTA 2MLYA 4O2TA 1KT1A 2DJYA 4JFJA 1JMQA 3TC5A 2IF4A 1TK7A 2RUQA 1FLCA 2L2SA 2DT1A 4ODKA 3MCBA 3ARSA 4WKAA 1Y0OA 5HBFA 3KADA 1ZL1A 3FY1A 4REXA 4JYSA 5U47A 1QPLA 4IT4A 4Z2JA 1ZBCA 1FKGA 3L4HA 3KACA 5HWBA 4Z2GA 3M7NA 3ARPA 2PPPA 2DSZA 3OA5A 1W1VA 3CHFA 1ZU8A 4DZ2A 3O5DA 2JV4A 2JX8A 1O6IA 1W1YA 2KFWA 3ALFA 5DITA 1M5YA 3B7XA 3I6CA 4QT2A 2KXQA 5E65A 3QOKA 2M8JA 1TCOC 4WIWA 1GRJA 3O5GA 1W9UA 4LGXA 5HKGA 1WB0A 1O6WA 3WH0A 4MTVA 2JMFA 5AHTA 1E6NA 1X6LA
chains in the Genus database with same CATH topology
2PBCA 1LL4A 2WLYA 2M8IA 1J4HA 3WQVA 2IUZA 2DK7A 3KZ7A 1ZB5A 4ITZA 5DO2A 1ZK6A 1D7IA 3UQBA 2MLXA 3LE4A 4DRIA 3FSBA 4FAPA 4IQ2A 4MNKA 4Q22A 2WADA 3UI4A 2RSEA 4Z2KA 3MQGA 1U79A 5DF0A 1ZBKA 4MNLA 1X6NA 1ZBVA 2K8IA 1JNSA 3B9EA 3ARVA 1N1AA 4A0UA 1GOIA 4U84A 1ROUA 4DT4A 1ROTA 4U85A 2XP4A 1W9PA 2ZR6A 1K9QA 4ODOA 4TNSA 4GLXA 2DSWA 4DROA 2LGOA 1D7JA 1E6ZA 1GUVA 3ARQA 2YSGA 2WLZA 5HT1A 3UQIA 2LPVA 4NZCA 5E66A 5DEZA 1JNEA 3TCZA 2FDMA 1WR7A 3MDYB 4ZPVR 4Q7NA 1ZBWA 3FAPA 2KGJA 3BXWA 3KCEA 1UR8A 4U86A 2G8ZA 2VN1A 2DT3A 1NWTA 3CH9A 1H0IA 3NRKA 4L72B 2WM0A 3TDBA 2F4EA 2DG9A 3NI6A 2ZR5A 3WD4A 4ODRA 3O5FA 3IHZA 4DWSD 4ODMA 1NH6A 2FAPA 3CHCA 4MSPA 5HTGA 2KE0A 1XRVA 4E5RA 4IQCA 3AROA 1JNDA 2DSUA 1FKTA 2B31A 1H0GA 4HBOA 3PR9A 5GQBA 3PRAA 5GPRA 5JH8A 1NWSA 4QZVB 4DRNA 2LKNA 4Z2LA 1WMVA 1FD9A 5D75A 3O5PA 1EG3A 1J4RA 4DRQA 4ODQA 4L3NA 1OGBA 1HXVA 4DZ3A 3KABA 1EHNA 5B8IC 1OGGA 1EQ3A 1FAPA 4WKHA 2EZ5W 4MPKA 4JFKA 3IKGA 3RM9A 2XP3A 1K9RA 3O5MA 3W4RA 1PINA 2XP8A 1FKFA 4ML4A 1FFRA 4DWSB 3AQUA 3JXVA 2DWVA 4HBEA 1UR9A 1K9TA 5HW8A 1J4IA 4DIPA 1FKIA 1HKJA 2G41A 2M08A 2E45A 1A7XA 2ZR4A 4P8UA 2XPAA 3GPKA 2DSVA 4S3JA 1P5QA 5DIUA 1ZCNA 2RURA 3CHDA 4WJXA 5BXJA 3CHEA 2RUDA 1LQ0A 5E64A 1RD6A 4QT3A 4TW8A 1Q6HA 2OWOA 1KFWA 5I98A 1F40A 2PPNA 2YBTA 4IT6A 4J4NA 3RMEA 2ZQTA 1QPFA 1NSGA 2DPEA 3ARYA 3WD3A 1B6CA 5DIVA 1F8AB 4MGVA 3O5LA 3PRBA 2ZQSA 2MPHA 1C9HA 2MDIA 3B9AA 1L1PA 3WD2A 2XPBA 2M1IA 1EYMA 2YSHA 2KO7A 4G50A 4P8WA 2PV1A 2F21A 3VAWA 2DK1A 5HW6A 5HW7A 3AS1A 2FKEA 1NMWA 2DG3A 1FKLA 3O5KA 4DRHA 3ARWA 1D7HA 4MNJA 4HARA 2WAEA 1HJWA 2RQSA 4R5EA 4WKFA 2M3OW 4TW7A 2ZAJA 3ODKA 1W26A 3UF8A 2OLHA 2YSIA 2OFNA 3O5OA 3O5QA 1HKMA 1ITXA 1J6YA 4LAYA 3FSCA 3IK8A 3EY6A 2DMVA 3JYJA 2DT0A 1FKKA 2MLZA 2N87A 5E62A 3OOBA 2PI6A 4W5UA 2XP9A 2JXWA 2A3CA 3H9RB 2Y8NB 1W1PA 1VF8A 4DWSA 2DG4A 1NMVA 3LKXB 3FXYA 3PRDA 4LAVA 2XP6A 5J6EA 1FKDA 2YAJB 1FFQA 1JNTA 3AS3A 3G6LA 2O9OA 1LJYA 2RUCA 3M85A 4DWSC 1BKFA 3RM4A 3ARZA 4AY1A 4PTMA 3WQWA 3LUOA 1NWRA 2M2AA 4TX0A 4ZS6A 3O5EA 2AOSA 1Q6UA 2LJ4A 4ODLA 2MF9A 1WAWA 3ARUA 1W9VA 3PQHA 3ARTA 2KR7A 1QZ2A 1D2KA 4WK9A 2VCDA 1WNOA 2A3AA 2ESCA 2KI3A 3RFWA 4BF8A 4DRPA 2QF8A 3CGNA 2LAJA 3MQHA 4LAXA 2AWGA 1TR8A 4IPXA 2RE3A 2Y78A 1FJDA 1LL6A 1OWQA 4ZPTR 1IX5A 4KR0B 2PPOA 4C02B 1E15A 3CGMA 4URIA 1GPFA 4ODPA 3ARRA 4JFMA 1JVWA 1KT0A 4J4OA 3WKZA 4GIVA 3KAIA 1E6PA 4W9QA 4DH0A 5HWCA 3JYMA 3IKDA 2XP7A 3ARXA 3KAGA 3WD0A 2F2DA 1SYTA 1CTNA 1FKSA 2D9FA 2WK2A 3UQAA 1E9LA 2Q5AA 1LG1A 4MAVA 1FKBA 3LKXA 1EDQA 1FKJA 4P8XA 1D6OA 2YBUA 4N19A 4A0TA 2PV3A 3MCBB 3CZ8A 4KQZA 1EG4A 4FN2A 4GGQA 1LG2A 4JFLA 1LL7A 4W9OA 4NNRA 3FS8A 2YSBA 2ZQUA 3AS2A 1EIBA 4ODNA 4DRJA 5CQ2A 4W9PA 4TYOA 3G6MA 1SR0A 3ALGA 4R0XA 4Z2HA 4QIBA 4Z2IA 1HJXA 4NSBA 4P8VA 2ZQVA 1BL4A 4DRMA 2PV2A 1E6RA 4LAWA 4DRKA 1RP5A 5GPGA 3AS0A 3WL0A 2JZVA 2UZ5A 3KAFA 4XAKA 2QRVA 2ITKA 3CNGA 3WIJA 4G2PA 3O5JA 1Q1CA 1FKRA 3WD1A 1Q6IA 2A3EA 5HUAA 3B8SA 1I5HW 1YATA 2BA1A 1HKIA 2XP5A 4MNMA 1R9HA 3O5IA 3NTPA 1FKHA 2O92A 4ZPWR 3RGCA 4TW6A 1W1TA 2A3BA 3B9DA 1PBKA 3UI5A 3KAHA 1YW5A 3RM8A 2L4JA 1TFVA 1XHGA 1NWUA 1HJVA 3O5RA 4JFIA 4S3KA 2DT2A 3WL1A 1HKKA 5E5WA 3PA7A 3UI6A 2YSFA 1T11A 2MNTA 2MLYA 4O2TA 1KT1A 2DJYA 4JFJA 1JMQA 3TC5A 2IF4A 1TK7A 2RUQA 1FLCA 2L2SA 2DT1A 4ODKA 3MCBA 3ARSA 4WKAA 1Y0OA 5HBFA 3KADA 1ZL1A 3FY1A 4REXA 4JYSA 5U47A 1QPLA 4IT4A 4Z2JA 1ZBCA 1FKGA 3L4HA 3KACA 5HWBA 4Z2GA 3M7NA 3ARPA 2PPPA 2DSZA 3OA5A 1W1VA 3CHFA 1ZU8A 4DZ2A 3O5DA 2JV4A 2JX8A 1O6IA 1W1YA 2KFWA 3ALFA 5DITA 1M5YA 3B7XA 3I6CA 4QT2A 2KXQA 5E65A 3QOKA 2M8JA 1TCOC 4WIWA 3O5GA 1W9UA 4LGXA 5HKGA 1WB0A 1O6WA 3WH0A 4MTVA 2JMFA 5AHTA 1E6NA 1X6LA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2PBC A;  2M8I A;  1J4H A;  2DK7 A;  3KZ7 A;  4ITZ A;  1ZK6 A;  1D7I A;  3UQB A;  2MLX A;  3LE4 A;  4DRI A;  4FAP A;  4IQ2 A;  3UI4 A;  2RSE A;  1U79 A;  2K8I A;  1JNS A;  1N1A A;  4U84 A;  1ROU A;  4DT4 A;  1ROT A;  4U85 A;  2XP4 A;  2ZR6 A;  1K9Q A;  4ODO A;  4TNS A;  4DRO A;  2LGO A;  1D7J A;  2YSG A;  5HT1 A;  3UQI A;  2LPV A;  3TCZ A;  1WR7 A;  3MDY B;  3FAP A;  2KGJ A;  3KCE A;  4U86 A;  2VN1 A;  3NRK A;  3TDB A;  2F4E A;  2DG9 A;  3NI6 A;  2ZR5 A;  4ODR A;  3O5F A;  3IHZ A;  4ODM A;  2FAP A;  4MSP A;  5HTG A;  2KE0 A;  4E5R A;  4IQC A;  1FKT A;  4DRN A;  2LKN A;  1WMV A;  1FD9 A;  5D75 A;  3O5P A;  4DRQ A;  1EG3 A;  1J4R A;  4ODQ A;  1HXV A;  4DZ3 A;  3KAB A;  5B8I C;  1EQ3 A;  1FAP A;  2EZ5 W;  4JFK A;  3IKG A;  2XP3 A;  1K9R A;  3O5M A;  1PIN A;  2XP8 A;  1FKF A;  3JXV A;  2DWV A;  5HW8 A;  1J4I A;  4DIP A;  1FKI A;  2M08 A;  2E45 A;  1A7X A;  2ZR4 A;  2XPA A;  3GPK A;  1P5Q A;  5DIU A;  1ZCN A;  2RUR A;  5BXJ A;  2RUD A;  4QT3 A;  4TW8 A;  1Q6H A;  5I98 A;  1F40 A;  2PPN A;  4J4N A;  2ZQT A;  1QPF A;  1NSG A;  1B6C A;  5DIV A;  1F8A B;  4MGV A;  3O5L A;  3PRB A;  2ZQS A;  2MPH A;  1C9H A;  2MDI A;  1L1P A;  2XPB A;  2M1I A;  1EYM A;  2YSH A;  2KO7 A;  4G50 A;  2PV1 A;  2F21 A;  3VAW A;  2DK1 A;  5HW6 A;  5HW7 A;  2FKE A;  1NMW A;  2DG3 A;  1FKL A;  3O5K A;  4DRH A;  1D7H A;  2RQS A;  2M3O W;  4TW7 A;  2ZAJ A;  3ODK A;  1W26 A;  3UF8 A;  2YSI A;  2OFN A;  3O5O A;  3O5Q A;  1J6Y A;  4LAY A;  3IK8 A;  3EY6 A;  2DMV A;  3JYJ A;  1FKK A;  2MLZ A;  2N87 A;  3OOB A;  2XP9 A;  2JXW A;  3H9R B;  2DG4 A;  1NMV A;  3PRD A;  4LAV A;  2XP6 A;  5J6E A;  1FKD A;  1JNT A;  2RUC A;  3M85 A;  1BKF A;  3LUO A;  2M2A A;  4TX0 A;  3O5E A;  1Q6U A;  2LJ4 A;  4ODL A;  2MF9 A;  2KR7 A;  1QZ2 A;  2VCD A;  2KI3 A;  3RFW A;  4BF8 A;  4DRP A;  3CGN A;  2LAJ A;  4LAX A;  2AWG A;  4IPX A;  2RE3 A;  2Y78 A;  1FJD A;  2PPO A;  4C02 B;  3CGM A;  4ODP A;  4JFM A;  1JVW A;  1KT0 A;  4J4O A;  4GIV A;  3KAI A;  4W9Q A;  4DH0 A;  5HWC A;  3JYM A;  3IKD A;  2XP7 A;  3KAG A;  2F2D A;  1FKS A;  2D9F A;  3UQA A;  2Q5A A;  1FKB A;  1FKJ A;  1D6O A;  4N19 A;  2PV3 A;  1EG4 A;  4FN2 A;  4GGQ A;  4JFL A;  4W9O A;  4NNR A;  2YSB A;  2ZQU A;  4ODN A;  4DRJ A;  5CQ2 A;  4W9P A;  4TYO A;  4R0X A;  4QIB A;  2ZQV A;  1BL4 A;  4DRM A;  2PV2 A;  4LAW A;  4DRK A;  5GPG A;  2JZV A;  2UZ5 A;  3KAF A;  2ITK A;  3CNG A;  4G2P A;  3O5J A;  1Q1C A;  1FKR A;  1Q6I A;  5HUA A;  1I5H W;  1YAT A;  2BA1 A;  2XP5 A;  1R9H A;  3O5I A;  3NTP A;  1FKH A;  3RGC A;  4TW6 A;  1PBK A;  3UI5 A;  3KAH A;  1YW5 A;  2L4J A;  3O5R A;  4JFI A;  3PA7 A;  3UI6 A;  2YSF A;  1T11 A;  2MNT A;  2MLY A;  4O2T A;  1KT1 A;  2DJY A;  4JFJ A;  1JMQ A;  3TC5 A;  2IF4 A;  1TK7 A;  2RUQ A;  2L2S A;  4ODK A;  1Y0O A;  3KAD A;  4REX A;  4JYS A;  1QPL A;  1FKG A;  3L4H A;  3KAC A;  5HWB A;  3M7N A;  2PPP A;  4DZ2 A;  3O5D A;  2JV4 A;  2JX8 A;  2KFW A;  5DIT A;  1M5Y A;  3B7X A;  3I6C A;  4QT2 A;  2KXQ A;  2M8J A;  1TCO C;  3O5G A;  5HKG A;  1O6W A;  3WH0 A;  2JMF A;  5AHT A; 
#chains in the Genus database with same CATH topology
 2PBC A;  1LL4 A;  2WLY A;  2M8I A;  2PN0 A;  1J4H A;  3WQV A;  2IUZ A;  2DK7 A;  2EUL A;  3KZ7 A;  1ZB5 A;  4ITZ A;  5DO2 A;  1ZK6 A;  1D7I A;  3UQB A;  2MLX A;  3LE4 A;  4DRI A;  3FSB A;  4FAP A;  4IQ2 A;  4MNK A;  4Q22 A;  2WAD A;  3UI4 A;  2RSE A;  4Z2K A;  3MQG A;  1U79 A;  5DF0 A;  1ZBK A;  4MNL A;  1X6N A;  1ZBV A;  2K8I A;  1JNS A;  3B9E A;  3ARV A;  1N1A A;  4A0U A;  1GOI A;  4U84 A;  1ROU A;  4DT4 A;  1ROT A;  4U85 A;  2XP4 A;  1W9P A;  2ZR6 A;  1K9Q A;  4ODO A;  4TNS A;  4GLX A;  2DSW A;  4DRO A;  2LGO A;  1D7J A;  1E6Z A;  1GUV A;  3ARQ A;  2YSG A;  2WLZ A;  5HT1 A;  3UQI A;  2LPV A;  4NZC A;  5E66 A;  5DEZ A;  1JNE A;  3TCZ A;  2FDM A;  1WR7 A;  3MDY B;  4ZPV R;  4Q7N A;  1ZBW A;  3FAP A;  2KGJ A;  3BXW A;  3KCE A;  1UR8 A;  4U86 A;  2G8Z A;  2VN1 A;  2DT3 A;  1NWT A;  3CH9 A;  1H0I A;  3NRK A;  4L72 B;  2ETN A;  2WM0 A;  3TDB A;  2F4E A;  2DG9 A;  3NI6 A;  2ZR5 A;  3WD4 A;  4ODR A;  3O5F A;  3IHZ A;  4DWS D;  4ODM A;  1NH6 A;  2FAP A;  3CHC A;  4MSP A;  5HTG A;  2KE0 A;  1XRV A;  4E5R A;  4IQC A;  3ARO A;  1JND A;  2DSU A;  1FKT A;  2B31 A;  1H0G A;  4HBO A;  3PR9 A;  5GQB A;  3PRA A;  5GPR A;  5JH8 A;  1NWS A;  4QZV B;  4DRN A;  2LKN A;  4Z2L A;  1WMV A;  1FD9 A;  5D75 A;  3O5P A;  1EG3 A;  1J4R A;  4DRQ A;  4ODQ A;  4L3N A;  1OGB A;  1HXV A;  4DZ3 A;  3KAB A;  1EHN A;  5B8I C;  1OGG A;  1EQ3 A;  1FAP A;  4WKH A;  2EZ5 W;  4MPK A;  4JFK A;  3IKG A;  3RM9 A;  2XP3 A;  1K9R A;  3O5M A;  3W4R A;  1PIN A;  2XP8 A;  1FKF A;  4ML4 A;  1FFR A;  4DWS B;  3AQU A;  3JXV A;  2DWV A;  4HBE A;  1UR9 A;  1K9T A;  5HW8 A;  1J4I A;  4DIP A;  1FKI A;  1HKJ A;  2G41 A;  2M08 A;  2E45 A;  1A7X A;  2ZR4 A;  4P8U A;  2XPA A;  3GPK A;  2DSV A;  4S3J A;  1P5Q A;  5DIU A;  1ZCN A;  2RUR A;  3CHD A;  4WJX A;  5BXJ A;  3CHE A;  2RUD A;  1LQ0 A;  5E64 A;  1RD6 A;  4QT3 A;  4TW8 A;  1Q6H A;  2OWO A;  1KFW A;  5I98 A;  1F40 A;  2PPN A;  2YBT A;  4IT6 A;  4J4N A;  3RME A;  2ZQT A;  1QPF A;  1NSG A;  2DPE A;  3ARY A;  3WD3 A;  1B6C A;  5DIV A;  1F8A B;  4MGV A;  3O5L A;  3PRB A;  2ZQS A;  2MPH A;  1C9H A;  2MDI A;  3B9A A;  1E44 A;  1L1P A;  3WD2 A;  2XPB A;  2M1I A;  1EYM A;  2YSH A;  2KO7 A;  4G50 A;  4P8W A;  2PV1 A;  2F21 A;  3VAW A;  2DK1 A;  2F23 A;  5HW6 A;  3AS1 A;  5HW7 A;  2FKE A;  1NMW A;  2DG3 A;  1FKL A;  3O5K A;  4DRH A;  3ARW A;  1D7H A;  4MNJ A;  4HAR A;  2WAE A;  1HJW A;  2RQS A;  4R5E A;  4WKF A;  2M3O W;  4TW7 A;  2ZAJ A;  3ODK A;  1W26 A;  3UF8 A;  2OLH A;  2YSI A;  2OFN A;  3O5O A;  3O5Q A;  1HKM A;  1ITX A;  1J6Y A;  4LAY A;  3FSC A;  2P4V A;  3IK8 A;  3EY6 A;  2DMV A;  1JCH B;  3JYJ A;  2DT0 A;  1FKK A;  2MLZ A;  2N87 A;  5E62 A;  3OOB A;  2PI6 A;  4W5U A;  2XP9 A;  2JXW A;  2A3C A;  3H9R B;  3BMB A;  2Y8N B;  1W1P A;  1VF8 A;  4DWS A;  2DG4 A;  1NMV A;  3LKX B;  3FXY A;  3PRD A;  4LAV A;  2XP6 A;  5J6E A;  1FKD A;  2YAJ B;  1FFQ A;  1JNT A;  3AS3 A;  3G6L A;  2O9O A;  1LJY A;  2RUC A;  3M85 A;  4DWS C;  3GU0 A;  1BKF A;  3RM4 A;  3ARZ A;  4AY1 A;  4PTM A;  3WQW A;  3LUO A;  1NWR A;  2M2A A;  4TX0 A;  4ZS6 A;  3O5E A;  2AOS A;  1Q6U A;  2LJ4 A;  4ODL A;  2MF9 A;  1WAW A;  3ARU A;  1W9V A;  3PQH A;  3ART A;  2KR7 A;  1QZ2 A;  1D2K A;  4WK9 A;  2VCD A;  1WNO A;  2A3A A;  2ESC A;  2KI3 A;  3RFW A;  4BF8 A;  4DRP A;  2QF8 A;  3CGN A;  2LAJ A;  3MQH A;  4LAX A;  2AWG A;  1TR8 A;  4IPX A;  2RE3 A;  2Y78 A;  1FJD A;  1LL6 A;  1OWQ A;  4ZPT R;  1IX5 A;  4KR0 B;  2PPO A;  4C02 B;  1E15 A;  3CGM A;  4URI A;  1GPF A;  4ODP A;  3ARR A;  4JFM A;  1JVW A;  1KT0 A;  4J4O A;  3WKZ A;  4GIV A;  3KAI A;  1E6P A;  4W9Q A;  4DH0 A;  5HWC A;  3JYM A;  3IKD A;  3GTY X;  2XP7 A;  3ARX A;  3KAG A;  3WD0 A;  2F2D A;  1SYT A;  1CTN A;  1FKS A;  2D9F A;  3EIP A;  2WK2 A;  3UQA A;  1E9L A;  2Q5A A;  1LG1 A;  4MAV A;  1FKB A;  3LKX A;  1EDQ A;  1FKJ A;  4P8X A;  1D6O A;  2YBU A;  4N19 A;  4A0T A;  2PV3 A;  3MCB B;  3CZ8 A;  4KQZ A;  1EG4 A;  4FN2 A;  4GGQ A;  1LG2 A;  4JFL A;  1LL7 A;  4W9O A;  4NNR A;  3FS8 A;  2YSB A;  2ZQU A;  3AS2 A;  1EIB A;  4ODN A;  4DRJ A;  2B5U B;  5CQ2 A;  4W9P A;  4TYO A;  3G6M A;  1SR0 A;  3ALG A;  4R0X A;  4Z2H A;  4QIB A;  4Z2I A;  1HJX A;  4NSB A;  4P8V A;  2ZQV A;  1BL4 A;  4DRM A;  2PV2 A;  1E6R A;  4LAW A;  4DRK A;  1RP5 A;  5GPG A;  3AS0 A;  3WL0 A;  2JZV A;  2UZ5 A;  3KAF A;  4XAK A;  2QRV A;  2ITK A;  3CNG A;  3WIJ A;  4G2P A;  3O5J A;  1Q1C A;  1FKR A;  3WD1 A;  1Q6I A;  2A3E A;  5HUA A;  3B8S A;  1I5H W;  1YAT A;  2BA1 A;  1HKI A;  2XP5 A;  4MNM A;  1R9H A;  3O5I A;  3NTP A;  1FKH A;  2O92 A;  4ZPW R;  3RGC A;  4TW6 A;  1W1T A;  2A3B A;  3B9D A;  4UDM A;  1PBK A;  3UI5 A;  3KAH A;  1YW5 A;  3RM8 A;  2L4J A;  1TFV A;  1XHG A;  1NWU A;  1HJV A;  3O5R A;  4JFI A;  4S3K A;  2DT2 A;  3WL1 A;  1HKK A;  5E5W A;  3PA7 A;  3UI6 A;  2YSF A;  1T11 A;  2MNT A;  2MLY A;  4O2T A;  1KT1 A;  2DJY A;  4JFJ A;  1JMQ A;  3TC5 A;  2IF4 A;  1TK7 A;  2RUQ A;  1FLC A;  2L2S A;  2DT1 A;  4ODK A;  3MCB A;  3ARS A;  4WKA A;  1Y0O A;  5HBF A;  3KAD A;  1ZL1 A;  3FY1 A;  4REX A;  4JYS A;  5U47 A;  1QPL A;  4IT4 A;  4Z2J A;  1ZBC A;  1FKG A;  3L4H A;  3KAC A;  5HWB A;  4Z2G A;  3M7N A;  3ARP A;  2PPP A;  2DSZ A;  3OA5 A;  1W1V A;  3CHF A;  1ZU8 A;  4DZ2 A;  3O5D A;  2JV4 A;  2JX8 A;  1O6I A;  1W1Y A;  2KFW A;  3ALF A;  5DIT A;  1M5Y A;  3B7X A;  3I6C A;  4QT2 A;  2KXQ A;  5E65 A;  3QOK A;  2M8J A;  1TCO C;  4WIW A;  1GRJ A;  3O5G A;  1W9U A;  4LGX A;  5HKG A;  1WB0 A;  1O6W A;  3WH0 A;  4MTV A;  2JMF A;  5AHT A;  1E6N A;  1X6L A; 
#chains in the Genus database with same CATH homology
 2PBC A;  1LL4 A;  2WLY A;  2M8I A;  1J4H A;  3WQV A;  2IUZ A;  2DK7 A;  3KZ7 A;  1ZB5 A;  4ITZ A;  5DO2 A;  1ZK6 A;  1D7I A;  3UQB A;  2MLX A;  3LE4 A;  4DRI A;  3FSB A;  4FAP A;  4IQ2 A;  4MNK A;  4Q22 A;  2WAD A;  3UI4 A;  2RSE A;  4Z2K A;  3MQG A;  1U79 A;  5DF0 A;  1ZBK A;  4MNL A;  1X6N A;  1ZBV A;  2K8I A;  1JNS A;  3B9E A;  3ARV A;  1N1A A;  4A0U A;  1GOI A;  4U84 A;  1ROU A;  4DT4 A;  1ROT A;  4U85 A;  2XP4 A;  1W9P A;  2ZR6 A;  1K9Q A;  4ODO A;  4TNS A;  4GLX A;  2DSW A;  4DRO A;  2LGO A;  1D7J A;  1E6Z A;  1GUV A;  3ARQ A;  2YSG A;  2WLZ A;  5HT1 A;  3UQI A;  2LPV A;  4NZC A;  5E66 A;  5DEZ A;  1JNE A;  3TCZ A;  2FDM A;  1WR7 A;  3MDY B;  4ZPV R;  4Q7N A;  1ZBW A;  3FAP A;  2KGJ A;  3BXW A;  3KCE A;  1UR8 A;  4U86 A;  2G8Z A;  2VN1 A;  2DT3 A;  1NWT A;  3CH9 A;  1H0I A;  3NRK A;  4L72 B;  2WM0 A;  3TDB A;  2F4E A;  2DG9 A;  3NI6 A;  2ZR5 A;  3WD4 A;  4ODR A;  3O5F A;  3IHZ A;  4DWS D;  4ODM A;  1NH6 A;  2FAP A;  3CHC A;  4MSP A;  5HTG A;  2KE0 A;  1XRV A;  4E5R A;  4IQC A;  3ARO A;  1JND A;  2DSU A;  1FKT A;  2B31 A;  1H0G A;  4HBO A;  3PR9 A;  5GQB A;  3PRA A;  5GPR A;  5JH8 A;  1NWS A;  4QZV B;  4DRN A;  2LKN A;  4Z2L A;  1WMV A;  1FD9 A;  5D75 A;  3O5P A;  1EG3 A;  1J4R A;  4DRQ A;  4ODQ A;  4L3N A;  1OGB A;  1HXV A;  4DZ3 A;  3KAB A;  1EHN A;  5B8I C;  1OGG A;  1EQ3 A;  1FAP A;  4WKH A;  2EZ5 W;  4MPK A;  4JFK A;  3IKG A;  3RM9 A;  2XP3 A;  1K9R A;  3O5M A;  3W4R A;  1PIN A;  2XP8 A;  1FKF A;  4ML4 A;  1FFR A;  4DWS B;  3AQU A;  3JXV A;  2DWV A;  4HBE A;  1UR9 A;  1K9T A;  5HW8 A;  1J4I A;  4DIP A;  1FKI A;  1HKJ A;  2G41 A;  2M08 A;  2E45 A;  1A7X A;  2ZR4 A;  4P8U A;  2XPA A;  3GPK A;  2DSV A;  4S3J A;  1P5Q A;  5DIU A;  1ZCN A;  2RUR A;  3CHD A;  4WJX A;  5BXJ A;  3CHE A;  2RUD A;  1LQ0 A;  5E64 A;  1RD6 A;  4QT3 A;  4TW8 A;  1Q6H A;  2OWO A;  1KFW A;  5I98 A;  1F40 A;  2PPN A;  2YBT A;  4IT6 A;  4J4N A;  3RME A;  2ZQT A;  1QPF A;  1NSG A;  2DPE A;  3ARY A;  3WD3 A;  1B6C A;  5DIV A;  1F8A B;  4MGV A;  3O5L A;  3PRB A;  2ZQS A;  2MPH A;  1C9H A;  2MDI A;  3B9A A;  1L1P A;  3WD2 A;  2XPB A;  2M1I A;  1EYM A;  2YSH A;  2KO7 A;  4G50 A;  4P8W A;  2PV1 A;  2F21 A;  3VAW A;  2DK1 A;  5HW6 A;  5HW7 A;  3AS1 A;  2FKE A;  1NMW A;  2DG3 A;  1FKL A;  3O5K A;  4DRH A;  3ARW A;  1D7H A;  4MNJ A;  4HAR A;  2WAE A;  1HJW A;  2RQS A;  4R5E A;  4WKF A;  2M3O W;  4TW7 A;  2ZAJ A;  3ODK A;  1W26 A;  3UF8 A;  2OLH A;  2YSI A;  2OFN A;  3O5O A;  3O5Q A;  1HKM A;  1ITX A;  1J6Y A;  4LAY A;  3FSC A;  3IK8 A;  3EY6 A;  2DMV A;  3JYJ A;  2DT0 A;  1FKK A;  2MLZ A;  2N87 A;  5E62 A;  3OOB A;  2PI6 A;  4W5U A;  2XP9 A;  2JXW A;  2A3C A;  3H9R B;  2Y8N B;  1W1P A;  1VF8 A;  4DWS A;  2DG4 A;  1NMV A;  3LKX B;  3FXY A;  3PRD A;  4LAV A;  2XP6 A;  5J6E A;  1FKD A;  2YAJ B;  1FFQ A;  1JNT A;  3AS3 A;  3G6L A;  2O9O A;  1LJY A;  2RUC A;  3M85 A;  4DWS C;  1BKF A;  3RM4 A;  3ARZ A;  4AY1 A;  4PTM A;  3WQW A;  3LUO A;  1NWR A;  2M2A A;  4TX0 A;  4ZS6 A;  3O5E A;  2AOS A;  1Q6U A;  2LJ4 A;  4ODL A;  2MF9 A;  1WAW A;  3ARU A;  1W9V A;  3PQH A;  3ART A;  2KR7 A;  1QZ2 A;  1D2K A;  4WK9 A;  2VCD A;  1WNO A;  2A3A A;  2ESC A;  2KI3 A;  3RFW A;  4BF8 A;  4DRP A;  2QF8 A;  3CGN A;  2LAJ A;  3MQH A;  4LAX A;  2AWG A;  1TR8 A;  4IPX A;  2RE3 A;  2Y78 A;  1FJD A;  1LL6 A;  1OWQ A;  4ZPT R;  1IX5 A;  4KR0 B;  2PPO A;  4C02 B;  1E15 A;  3CGM A;  4URI A;  1GPF A;  4ODP A;  3ARR A;  4JFM A;  1JVW A;  1KT0 A;  4J4O A;  3WKZ A;  4GIV A;  3KAI A;  1E6P A;  4W9Q A;  4DH0 A;  5HWC A;  3JYM A;  3IKD A;  2XP7 A;  3ARX A;  3KAG A;  3WD0 A;  2F2D A;  1SYT A;  1CTN A;  1FKS A;  2D9F A;  2WK2 A;  3UQA A;  1E9L A;  2Q5A A;  1LG1 A;  4MAV A;  1FKB A;  3LKX A;  1EDQ A;  1FKJ A;  4P8X A;  1D6O A;  2YBU A;  4N19 A;  4A0T A;  2PV3 A;  3MCB B;  3CZ8 A;  4KQZ A;  1EG4 A;  4FN2 A;  4GGQ A;  1LG2 A;  4JFL A;  1LL7 A;  4W9O A;  4NNR A;  3FS8 A;  2YSB A;  2ZQU A;  3AS2 A;  1EIB A;  4ODN A;  4DRJ A;  5CQ2 A;  4W9P A;  4TYO A;  3G6M A;  1SR0 A;  3ALG A;  4R0X A;  4Z2H A;  4QIB A;  4Z2I A;  1HJX A;  4NSB A;  4P8V A;  2ZQV A;  1BL4 A;  4DRM A;  2PV2 A;  1E6R A;  4LAW A;  4DRK A;  1RP5 A;  5GPG A;  3AS0 A;  3WL0 A;  2JZV A;  2UZ5 A;  3KAF A;  4XAK A;  2QRV A;  2ITK A;  3CNG A;  3WIJ A;  4G2P A;  3O5J A;  1Q1C A;  1FKR A;  3WD1 A;  1Q6I A;  2A3E A;  5HUA A;  3B8S A;  1I5H W;  1YAT A;  2BA1 A;  1HKI A;  2XP5 A;  4MNM A;  1R9H A;  3O5I A;  3NTP A;  1FKH A;  2O92 A;  4ZPW R;  3RGC A;  4TW6 A;  1W1T A;  2A3B A;  3B9D A;  1PBK A;  3UI5 A;  3KAH A;  1YW5 A;  3RM8 A;  2L4J A;  1TFV A;  1XHG A;  1NWU A;  1HJV A;  3O5R A;  4JFI A;  4S3K A;  2DT2 A;  3WL1 A;  1HKK A;  5E5W A;  3PA7 A;  3UI6 A;  2YSF A;  1T11 A;  2MNT A;  2MLY A;  4O2T A;  1KT1 A;  2DJY A;  4JFJ A;  1JMQ A;  3TC5 A;  2IF4 A;  1TK7 A;  2RUQ A;  1FLC A;  2L2S A;  2DT1 A;  4ODK A;  3MCB A;  3ARS A;  4WKA A;  1Y0O A;  5HBF A;  3KAD A;  1ZL1 A;  3FY1 A;  4REX A;  4JYS A;  5U47 A;  1QPL A;  4IT4 A;  4Z2J A;  1ZBC A;  1FKG A;  3L4H A;  3KAC A;  5HWB A;  4Z2G A;  3M7N A;  3ARP A;  2PPP A;  2DSZ A;  3OA5 A;  1W1V A;  3CHF A;  1ZU8 A;  4DZ2 A;  3O5D A;  2JV4 A;  2JX8 A;  1O6I A;  1W1Y A;  2KFW A;  3ALF A;  5DIT A;  1M5Y A;  3B7X A;  3I6C A;  4QT2 A;  2KXQ A;  5E65 A;  3QOK A;  2M8J A;  1TCO C;  4WIW A;  3O5G A;  1W9U A;  4LGX A;  5HKG A;  1WB0 A;  1O6W A;  3WH0 A;  4MTV A;  2JMF A;  5AHT A;  1E6N A;  1X6L A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...