2ITKA

Human pin1 bound to d-peptide
Total Genus 45
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
45
sequence length
157
structure length
145
Chain Sequence
LPPGWEKAMSRSSGRVYYFNHITNASQWERPSEPARVRCSHLLVKHSQSRRPSSWRQEKITRTKEEALELINGYIQKIKSGEEDFESLASQFSDCSSAKARGDLGAFSRGQMQKPFEDASFALRTGEMSGPVFTDSGIHIILRTE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural basis for high-affinity peptide inhibition of human Pin1.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Isomerase/isomerase inhibitor
molecule keywords Peptidyl-prolyl cis-trans isomerase NIMA-interacting 1
total genus 45
structure length 145
sequence length 157
ec nomenclature ec 5.2.1.8: Peptidylprolyl isomerase.
pdb deposition date 2006-10-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00397 WW WW domain
A PF00639 Rotamase PPIC-type PPIASE domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.20.70.10 Mainly Beta Single Sheet Ubiquitin Ligase Nedd4; Chain: W; Ubiquitin Ligase Nedd4; Chain: W; 2itkA01
3.10.50.40 Alpha Beta Roll Chitinase A; domain 3 Chitinase A; domain 3 2itkA02
2MPHA 4LAVA 1FKLA 1O6WA 5HWBA 1B6CA 2XP5A 2MLZA 2KO7A 4J4NA 1QPFA 1EG3A 3KZ7A 3NRKA 3O5RA 2PPNA 4R0XA 4JFIA 5HW7A 2MDIA 4ODRA 2ZQVA 3NI6A 2ZAJA 5HKGA 2KXQA 2JMFA 4U86A 1NSGA 2DG3A 3O5EA 2DJYA 1D7JA 1FD9A 3TC5A 2DK1A 2OFNA 5DIUA 4G2PA 4ODQA 4MGVA 4ODNA 4C02B 3O5PA 3OOBA 1PINA 1R9HA 4TX0A 4NNRA 1U79A 2F4EA 2XP9A 1K9QA 1J6YA 4IQCA 4JYSA 3UI4A 2RE3A 2RUCA 2YSHA 4DH0A 3FAPA 2M8JA 2DG9A 2LAJA 2RURA 4JFKA 3O5FA 3CNGA 1Q6IA 2RSEA 2RUQA 2JXWA 4IQ2A 1FKGA 2PV2A 4GGQA 4E5RA 1I5HW 2IF4A 2KI3A 2LKNA 4QIBA 2LPVA 2L2SA 1WMVA 2AWGA 2PBCA 3CGMA 3PRDA 4ODOA 4U84A 2M1IA 1FKKA 1QPLA 4TYOA 2M8IA 3JYMA 2YSFA 1FKTA 2L4JA 5I98A 2JZVA 3IKGA 2VCDA 5HWCA 1FKJA 2YSGA 3PRBA 1F8AB 4TNSA 2KGJA 1NMVA 3IHZA 5J6EA 1P5QA 2FKEA 3LE4A 2PV1A 4ITZA 1J4IA 4JFJA 4TW7A 2D9FA 4DIPA 1QZ2A 2RUDA 3IKDA 2RQSA 4REXA 3KAHA 2YSBA 2DK7A 2VN1A 3O5OA 1N1AA 3O5IA 3UF8A 2EZ5W 3B7XA 4ODMA 1JVWA 2DWVA 2Y78A 4BF8A 4DRNA 1W26A 3GPKA 3O5KA 3O5MA 3KABA 4LAWA 2XP8A 3M7NA 5GPGA 4DRQA 4DT4A 4FAPA 5B8IC 1FJDA 2MLXA 1YW5A 3O5LA 3NTPA 3UI6A 2YSIA 1JMQA 3UQIA 2JX8A 4DRIA 3L4HA 1FKBA 1EYMA 4J4OA 1M5YA 3ODKA 4O2TA 2K8IA 1BL4A 1FKSA 1KT1A 1Q6HA 2M08A 1D6OA 1D7HA 3O5JA 4QT2A 4JFLA 2LGOA 2F21A 4DRJA 1BKFA 2KE0A 2XPBA 2ITKA 3KACA 4TW6A 4DZ2A 2PPOA 3CGNA 3JYJA 3KADA 3TDBA 1FKIA 1K9RA 4TW8A 4FN2A 4G50A 2ZR4A 1TK7A 4ODPA 1ZK6A 2DG4A 2ZQUA 3UQAA 2MF9A 3TCZA 4JFMA 3O5QA 3H9RB 3JXVA 3PA7A 5DIVA 1Q6UA 1Y0OA 4GIVA 4DRMA 4DRKA 3KAIA 3UQBA 2M2AA 1EG4A 1ROUA 1J4HA 1L1PA 2N87A 1F40A 1EQ3A 1D7IA 4DRHA 1TCOC 2LJ4A 2ZQTA 1A7XA 1YATA 1PBKA 2MLYA 2XP7A 2ZQSA 2F2DA 1KT0A 1FAPA 1T11A 4N19A 3M85A 2Q5AA 2KR7A 1FKFA 3RFWA 2ZR5A 5CQ2A 2JV4A 1ROTA 5HUAA 1J4RA 2E45A 5AHTA 2UZ5A 5D75A 3RGCA 3VAWA 1JNTA 1WR7A 2XP4A 3KCEA 4W9QA 3IK8A 3UI5A 5BXJA 3LUOA 1JNSA 3KAFA 5HTGA 5HW6A 2XP3A 4U85A 4QT3A 5HT1A 4DROA 5HW8A 4MSPA 1FKRA 4IPXA 2BA1A 2ZR6A 4LAYA 1FKHA 1ZCNA 3WH0A 2M3OW 4DRPA 2XPAA 2XP6A 4DZ3A 5DITA 1HXVA 2KFWA 4ODKA 4W9OA 1Q1CA 4ODLA 4W9PA 3I6CA 2DMVA 2MNTA 2PPPA 3EY6A 3KAGA 3O5DA 4LAXA 2PV3A 1FKDA 1NMWA 3MDYB 1C9HA 3O5GA 2FAPA
chains in the Genus database with same CATH superfamily
1O6WA 2MLZA 4DWSB 3WD0A 2KO7A 4J4NA 2PN0A 1EHNA 3FY1A 5DF0A 2KXQA 2JMFA 5GQBA 2DJYA 1FD9A 3TC5A 4MGVA 3O5PA 1R9HA 4TX0A 4DWSA 1U79A 3AS1A 4NSBA 1K9QA 2P4VA 3B8SA 3UI4A 1NWUA 2M8JA 3MCBB 1RD6A 2LAJA 1E6ZA 4WKFA 2A3CA 3O5FA 3CNGA 2RSEA 2WLYA 4LAYA 4NNRA 4ZPWR 4Z2JA 2LKNA 2PBCA 1LG1A 1FFRA 1LL7A 3PRDA 1EDQA 1ZU8A 2JZVA 4Z2GA 5E64A 2VCDA 2YSGA 1F8AB 1HKKA 4TNSA 2KGJA 1NMVA 3CHCA 1UR8A 2EULA 4JFJA 4TW7A 4DRPA 1JNSA 3KAHA 2VN1A 3UF8A 2DSVA 2EZ5W 2DWVA 2Y78A 4DWSC 1W1TA 5GPGA 1HJVA 3M7NA 1FJDA 1YW5A 3UI6A 1JMQA 3ARRA 2JX8A 4AY1A 3EIPA 3ODKA 1BL4A 1FKSA 1D6OA 4Q22A 2YAJB 2LGOA 2A3EA 1BKFA 3KACA 4PTMA 3ARSA 3MCBA 3TDBA 1FKIA 3WIJA 4G50A 4ML4A 4ODPA 1ZK6A 2DG4A 1KFWA 5DIVA 4DRKA 4GIVA 3OA5A 3KAIA 3UQBA 2M2AA 1EG4A 3FS8A 2LJ4A 2ZQTA 1A7XA 2MLYA 1PBKA 4XAKA 4HARA 1T11A 4LGXA 1LG2A 5E62A 3ARVA 3ARYA 1JNDA 1X6NA 3WL0A 5D75A 1W9VA 3IK8A 2DT0A 1XHGA 3WQWA 1FKRA 2ZR6A 1ZCNA 3ARXA 4ODKA 4WKHA 1Q1CA 4ODLA 4R5EA 2MNTA 3O5DA 1GOIA 3AS3A 3CHFA 1FKLA 5HWBA 2XP5A 4Z2IA 1NWRA 3B9DA 3O5RA 3WD4A 2YBTA 4JFIA 4ODRA 2O92A 3NI6A 1FLCA 4DT4A 3O5EA 2DK1A 5DIUA 4HBOA 1E6RA 4ODQA 3AS2A 4MAVA 1J6YA 4IQCA 1NWSA 2RE3A 1LJYA 1W9UA 1JNEA 2PV2A 4E5RA 1I5HW 5HW6A 3WQVA 3MQGA 4U84A 1QPLA 5I98A 3IKGA 3CHEA 4NZCA 2DT3A 2PV1A 4DIPA 3FSBA 3IKDA 2OLHA 5HT1A 2YSBA 2DK7A 2DT2A 4ODMA 4ZPTR 4BF8A 1W26A 3GPKA 3O5KA 3AS0A 4LAWA 5B8IC 2ETNA 1XRVA 4DRIA 1EIBA 1FKBA 4J4OA 1M5YA 4URIA 4TYOA 2M08A 1GPFA 1H0GA 4JFLA 1RP5A 3WKZA 1ZBKA 2XPBA 2ITKA 4TW6A 4DZ2A 1E6PA 2PPOA 3JYJA 2DT1A 3ARUA 4KR0B 1E15A 3O5QA 3RM8A 1Y0OA 3RMEA 4S3JA 2G8ZA 1ZBVA 1GRJA 1EQ3A 4DRHA 2WLZA 3CZ8A 4KQZA 1YATA 3ARZA 2XP7A 1KT0A 1FAPA 3WD3A 3FXYA 2DSWA 3M85A 1FFQA 2KR7A 4QZVB 2JV4A 1J4RA 4L72B 4Z2HA 3VAWA 2QF8A 2XP4A 4W9QA 3ARPA 3UI5A 2XP3A 4MSPA 1NH6A 4IPXA 2BA1A 5HBFA 4A0TA 5DITA 1OGGA 3I6CA 2DPEA 2PPPA 5E65A 5U47A 1FKDA 3MDYB 2QRVA 3O5GA 2MPHA 4LAVA 1E44A 3KZ7A 4R0XA 2PPNA 3BMBA 1W9PA 2ZAJA 5HKGA 1NSGA 2DG3A 4P8WA 3MQHA 4G2PA 3ALGA 4ODNA 4GLXA 3OOBA 2F4EA 3WL1A 2XP9A 1K9TA 4JYSA 4DH0A 4MNMA 2DG9A 1WNOA 3RM9A 2RUQA 2JXWA 1FKGA 2IF4A 2KI3A 1WMVA 2AWGA 1JCHB 3CGMA 2M1IA 1FKKA 2M8IA 3JYMA 1FKTA 2L4JA 5HWCA 5DO2A 3ARTA 3PRBA 1WAWA 3IHZA 2WADA 4P8XA 5J6EA 1P5QA 2FKEA 3LE4A 2O9OA 1J4IA 2D9FA 1QZ2A 1W1PA 4REXA 1N1AA 3B7XA 1HJWA 1VF8A 3RM4A 1HKIA 4DRQA 2MLXA 3NTPA 1OWQA 3L4HA 1EYMA 3QOKA 1Q6HA 5BXJA 2WAEA 3CHDA 1D7HA 1IX5A 4QT2A 4DRJA 2F21A 2WM0A 2KE0A 1LQ0A 4TW8A 3KADA 1K9RA 2ZR4A 2ZQUA 3TCZA 4JFMA 3PA7A 1Q6UA 4DRMA 3B9EA 2AOSA 1H0IA 1TFVA 1ROUA 1SYTA 1J4HA 1L1PA 2N87A 1NWTA 4P8UA 5E5WA 4MPKA 3ARQA 4HBEA 2F2DA 3GU0A 2ESCA 4N19A 1FKFA 3RFWA 5CQ2A 5AHTA 3PR9A 1JNTA 5GPRA 3LUOA 1HJXA 5HTGA 4U85A 1O6IA 4DROA 1HKJA 4Q7NA 3GTYX 3FSCA 4DZ3A 1HKMA 1ZB5A 2B5UB 4W9PA 2DMVA 3CH9A 3EY6A 3KAGA 4IT6A 1NMWA 4MNJA 1LL4A 1B6CA 1OGBA 1ZBCA 1QPFA 1EG3A 3NRKA 3G6MA 5HW7A 2MDIA 2ZQVA 2Y8NB 4U86A 4L3NA 1D7JA 2OFNA 3WD2A 4W5UA 2IUZA 4C02B 2FDMA 4WIWA 3PQHA 1PINA 1X6LA 4UDMA 1LL6A 1CTNA 5E66A 4Z2LA 1E9LA 2A3AA 2RUCA 2YSHA 3FAPA 1GUVA 2DSUA 2RURA 4JFKA 1Q6IA 4IQ2A 4WK9A 4GGQA 4ODOA 2LPVA 3AQUA 4QIBA 2L2SA 4QT3A 3BXWA 4MNLA 3WD1A 4WJXA 4A0UA 2A3BA 2YSFA 3PRAA 1FKJA 1ITXA 4ITZA 3LKXA 3AROA 2RUDA 3O5OA 2RQSA 4Z2KA 3O5IA 4DRNA 2DSZA 1JVWA 2B31A 2OWOA 3O5MA 3KABA 4FAPA 2XP8A 4MNKA 1W1VA 3B9AA 3O5LA 3UQIA 2YSIA 1SR0A 4ZS6A 1W1YA 4IT4A 4DWSD 4O2TA 2K8IA 1KT1A 3O5JA 1TR8A 3W4RA 3CGNA 1ZBWA 2F23A 4FN2A 1TK7A 1ZL1A 3UQAA 2MF9A 3ARWA 3H9RB 2PI6A 3JXVA 2WK2A 2G41A 4P8VA 1UR9A 1F40A 1D7IA 1TCOC 3LKXB 4ZPVR 2ZQSA 5DEZA 4WKAA 1WB0A 2Q5AA 5HUAA 2ZR5A 1ROTA 3G6LA 2E45A 2UZ5A 1E6NA 3RGCA 1WR7A 3KCEA 3KAFA 5HW8A 5JH8A 1FKHA 2YBUA 3WH0A 1D2KA 2M3OW 4S3KA 2XPAA 2XP6A 3ALFA 1HXVA 2KFWA 4W9OA 4MTVA 4LAXA 2PV3A 1C9HA 2FAPA
chains in the Genus database with same CATH topology
1O6WA 2MLZA 4DWSB 3WD0A 2KO7A 4J4NA 1EHNA 3FY1A 5DF0A 2KXQA 2JMFA 5GQBA 2DJYA 1FD9A 3TC5A 4MGVA 3O5PA 1R9HA 4TX0A 4DWSA 1U79A 3AS1A 4NSBA 1K9QA 3B8SA 3UI4A 1NWUA 2M8JA 3MCBB 1RD6A 2LAJA 1E6ZA 4WKFA 2A3CA 3O5FA 3CNGA 2RSEA 2WLYA 4LAYA 4NNRA 4ZPWR 4Z2JA 2LKNA 2PBCA 1LG1A 1FFRA 1LL7A 3PRDA 1EDQA 1ZU8A 2JZVA 4Z2GA 5E64A 2VCDA 2YSGA 1F8AB 1HKKA 4TNSA 2KGJA 1NMVA 3CHCA 1UR8A 4JFJA 4TW7A 4DRPA 1JNSA 3KAHA 2VN1A 3UF8A 2DSVA 2EZ5W 2DWVA 2Y78A 4DWSC 1W1TA 5GPGA 1HJVA 3M7NA 1FJDA 1YW5A 3UI6A 1JMQA 3ARRA 2JX8A 4AY1A 3ODKA 1BL4A 1FKSA 1D6OA 4Q22A 2YAJB 2LGOA 2A3EA 1BKFA 3KACA 4PTMA 3ARSA 3MCBA 3TDBA 1FKIA 3WIJA 4G50A 4ML4A 4ODPA 1ZK6A 2DG4A 1KFWA 5DIVA 4DRKA 4GIVA 3OA5A 3KAIA 3UQBA 2M2AA 1EG4A 3FS8A 2LJ4A 2ZQTA 1A7XA 2MLYA 1PBKA 4XAKA 4HARA 1T11A 4LGXA 1LG2A 5E62A 3ARVA 3ARYA 1JNDA 1X6NA 3WL0A 5D75A 1W9VA 3IK8A 2DT0A 1XHGA 3WQWA 1FKRA 2ZR6A 1ZCNA 3ARXA 4ODKA 4WKHA 1Q1CA 4ODLA 4R5EA 2MNTA 3O5DA 1GOIA 3AS3A 3CHFA 1FKLA 5HWBA 2XP5A 4Z2IA 1NWRA 3B9DA 3O5RA 3WD4A 2YBTA 4JFIA 4ODRA 2O92A 3NI6A 1FLCA 4DT4A 3O5EA 2DK1A 5DIUA 4HBOA 1E6RA 4ODQA 3AS2A 4MAVA 1J6YA 4IQCA 1NWSA 2RE3A 1LJYA 1W9UA 1JNEA 2PV2A 4E5RA 1I5HW 5HW6A 3WQVA 3MQGA 4U84A 1QPLA 5I98A 3IKGA 3CHEA 4NZCA 2DT3A 2PV1A 4DIPA 3FSBA 3IKDA 2OLHA 5HT1A 2YSBA 2DK7A 2DT2A 4ODMA 4ZPTR 4BF8A 1W26A 3GPKA 3O5KA 3AS0A 4LAWA 5B8IC 1XRVA 4DRIA 1EIBA 1FKBA 4J4OA 1M5YA 4URIA 4TYOA 2M08A 1GPFA 1H0GA 4JFLA 1RP5A 3WKZA 1ZBKA 2XPBA 2ITKA 4TW6A 4DZ2A 1E6PA 2PPOA 3JYJA 2DT1A 3ARUA 4KR0B 1E15A 3O5QA 3RM8A 1Y0OA 3RMEA 4S3JA 2G8ZA 1ZBVA 1EQ3A 4DRHA 2WLZA 3CZ8A 4KQZA 3ARZA 1YATA 2XP7A 1KT0A 1FAPA 3WD3A 3FXYA 2DSWA 3M85A 1FFQA 2KR7A 4QZVB 2JV4A 1J4RA 4L72B 4Z2HA 3VAWA 2QF8A 2XP4A 4W9QA 3ARPA 3UI5A 2XP3A 4MSPA 1NH6A 4IPXA 2BA1A 5HBFA 4A0TA 5DITA 1OGGA 3I6CA 2DPEA 2PPPA 5E65A 5U47A 1FKDA 3MDYB 2QRVA 3O5GA 2MPHA 4LAVA 3KZ7A 4R0XA 2PPNA 1W9PA 2ZAJA 5HKGA 1NSGA 2DG3A 4P8WA 3MQHA 4G2PA 3ALGA 4ODNA 4GLXA 3OOBA 2F4EA 3WL1A 2XP9A 1K9TA 4JYSA 4DH0A 4MNMA 2DG9A 1WNOA 3RM9A 2RUQA 2JXWA 1FKGA 2IF4A 2KI3A 1WMVA 2AWGA 3CGMA 2M1IA 1FKKA 2M8IA 3JYMA 1FKTA 2L4JA 5HWCA 5DO2A 3ARTA 3PRBA 1WAWA 3IHZA 2WADA 4P8XA 5J6EA 1P5QA 2FKEA 3LE4A 2O9OA 1J4IA 2D9FA 1QZ2A 1W1PA 4REXA 1N1AA 3B7XA 1HJWA 1VF8A 3RM4A 1HKIA 4DRQA 2MLXA 3NTPA 1OWQA 3L4HA 1EYMA 3QOKA 1Q6HA 5BXJA 2WAEA 3CHDA 1D7HA 1IX5A 4QT2A 4DRJA 2F21A 2WM0A 2KE0A 1LQ0A 4TW8A 3KADA 1K9RA 2ZR4A 2ZQUA 3TCZA 4JFMA 3PA7A 1Q6UA 4DRMA 3B9EA 2AOSA 1H0IA 1TFVA 1ROUA 1SYTA 1J4HA 1L1PA 2N87A 1NWTA 4P8UA 5E5WA 4MPKA 3ARQA 4HBEA 2F2DA 2ESCA 4N19A 1FKFA 3RFWA 5CQ2A 5AHTA 3PR9A 1JNTA 5GPRA 3LUOA 1HJXA 5HTGA 4U85A 1O6IA 4DROA 1HKJA 4Q7NA 3FSCA 4DZ3A 1HKMA 1ZB5A 4W9PA 2DMVA 3CH9A 3EY6A 3KAGA 4IT6A 1NMWA 4MNJA 1LL4A 1B6CA 1OGBA 1ZBCA 1QPFA 1EG3A 3NRKA 3G6MA 5HW7A 2MDIA 2ZQVA 2Y8NB 4U86A 4L3NA 1D7JA 2OFNA 3WD2A 4W5UA 2IUZA 4C02B 2FDMA 4WIWA 3PQHA 1PINA 1X6LA 1LL6A 1CTNA 5E66A 4Z2LA 1E9LA 2A3AA 2RUCA 2YSHA 3FAPA 1GUVA 2DSUA 2RURA 4JFKA 1Q6IA 4IQ2A 4WK9A 4GGQA 4ODOA 2LPVA 3AQUA 4QIBA 2L2SA 4QT3A 3BXWA 4MNLA 3WD1A 4WJXA 4A0UA 2A3BA 2YSFA 3PRAA 1FKJA 1ITXA 4ITZA 3LKXA 3AROA 2RUDA 3O5OA 2RQSA 4Z2KA 3O5IA 4DRNA 2DSZA 1JVWA 2B31A 2OWOA 3O5MA 3KABA 4FAPA 2XP8A 4MNKA 1W1VA 3B9AA 3O5LA 3UQIA 2YSIA 1SR0A 4ZS6A 1W1YA 4IT4A 4DWSD 4O2TA 2K8IA 1KT1A 3O5JA 1TR8A 3W4RA 3CGNA 1ZBWA 4FN2A 1TK7A 1ZL1A 3UQAA 2MF9A 3ARWA 3H9RB 2PI6A 3JXVA 2WK2A 2G41A 4P8VA 1UR9A 1F40A 1D7IA 1TCOC 3LKXB 4ZPVR 2ZQSA 5DEZA 4WKAA 1WB0A 2Q5AA 5HUAA 2ZR5A 1ROTA 3G6LA 2E45A 2UZ5A 1E6NA 3RGCA 1WR7A 3KCEA 3KAFA 5HW8A 5JH8A 1FKHA 2YBUA 3WH0A 1D2KA 2M3OW 4S3KA 2XPAA 2XP6A 3ALFA 1HXVA 2KFWA 4W9OA 4MTVA 4LAXA 2PV3A 1C9HA 2FAPA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2MPH A;  4LAV A;  1FKL A;  1O6W A;  5HWB A;  1B6C A;  2XP5 A;  2MLZ A;  2KO7 A;  4J4N A;  1QPF A;  1EG3 A;  3KZ7 A;  3NRK A;  3O5R A;  2PPN A;  4R0X A;  4JFI A;  5HW7 A;  2MDI A;  4ODR A;  2ZQV A;  3NI6 A;  2ZAJ A;  5HKG A;  2KXQ A;  2JMF A;  4U86 A;  1NSG A;  2DG3 A;  3O5E A;  2DJY A;  1D7J A;  1FD9 A;  3TC5 A;  2DK1 A;  2OFN A;  5DIU A;  4G2P A;  4ODQ A;  4MGV A;  4ODN A;  4C02 B;  3O5P A;  3OOB A;  1PIN A;  1R9H A;  4TX0 A;  4NNR A;  1U79 A;  2F4E A;  2XP9 A;  1K9Q A;  1J6Y A;  4IQC A;  4JYS A;  3UI4 A;  2RE3 A;  2RUC A;  2YSH A;  4DH0 A;  3FAP A;  2M8J A;  2DG9 A;  2LAJ A;  2RUR A;  4JFK A;  3O5F A;  3CNG A;  1Q6I A;  2RSE A;  2RUQ A;  2JXW A;  4IQ2 A;  1FKG A;  2PV2 A;  4GGQ A;  4E5R A;  1I5H W;  2IF4 A;  2KI3 A;  2LKN A;  4QIB A;  2LPV A;  2L2S A;  1WMV A;  2AWG A;  2PBC A;  3CGM A;  3PRD A;  4ODO A;  4U84 A;  2M1I A;  1FKK A;  1QPL A;  4TYO A;  2M8I A;  3JYM A;  2YSF A;  1FKT A;  2L4J A;  5I98 A;  2JZV A;  3IKG A;  2VCD A;  5HWC A;  1FKJ A;  2YSG A;  3PRB A;  1F8A B;  4TNS A;  2KGJ A;  1NMV A;  3IHZ A;  5J6E A;  1P5Q A;  2FKE A;  3LE4 A;  2PV1 A;  4ITZ A;  1J4I A;  4JFJ A;  4TW7 A;  2D9F A;  4DIP A;  1QZ2 A;  2RUD A;  3IKD A;  2RQS A;  4REX A;  3KAH A;  2YSB A;  2DK7 A;  2VN1 A;  3O5O A;  1N1A A;  3O5I A;  3UF8 A;  2EZ5 W;  3B7X A;  4ODM A;  1JVW A;  2DWV A;  2Y78 A;  4BF8 A;  4DRN A;  1W26 A;  3GPK A;  3O5K A;  3O5M A;  3KAB A;  4LAW A;  2XP8 A;  3M7N A;  5GPG A;  4DRQ A;  4DT4 A;  4FAP A;  5B8I C;  1FJD A;  2MLX A;  1YW5 A;  3O5L A;  3NTP A;  3UI6 A;  2YSI A;  1JMQ A;  3UQI A;  2JX8 A;  4DRI A;  3L4H A;  1FKB A;  1EYM A;  4J4O A;  1M5Y A;  3ODK A;  4O2T A;  2K8I A;  1BL4 A;  1FKS A;  1KT1 A;  1Q6H A;  2M08 A;  1D6O A;  1D7H A;  3O5J A;  4QT2 A;  4JFL A;  2LGO A;  2F21 A;  4DRJ A;  1BKF A;  2KE0 A;  2XPB A;  2ITK A;  3KAC A;  4TW6 A;  4DZ2 A;  2PPO A;  3CGN A;  3JYJ A;  3KAD A;  3TDB A;  1FKI A;  1K9R A;  4TW8 A;  4FN2 A;  4G50 A;  2ZR4 A;  1TK7 A;  4ODP A;  1ZK6 A;  2DG4 A;  2ZQU A;  3UQA A;  2MF9 A;  3TCZ A;  4JFM A;  3O5Q A;  3H9R B;  3JXV A;  3PA7 A;  5DIV A;  1Q6U A;  1Y0O A;  4GIV A;  4DRM A;  4DRK A;  3KAI A;  3UQB A;  2M2A A;  1EG4 A;  1ROU A;  1J4H A;  1L1P A;  2N87 A;  1F40 A;  1EQ3 A;  1D7I A;  4DRH A;  1TCO C;  2LJ4 A;  2ZQT A;  1A7X A;  1YAT A;  1PBK A;  2MLY A;  2XP7 A;  2ZQS A;  2F2D A;  1KT0 A;  1FAP A;  1T11 A;  4N19 A;  3M85 A;  2Q5A A;  2KR7 A;  1FKF A;  3RFW A;  2ZR5 A;  5CQ2 A;  2JV4 A;  1ROT A;  5HUA A;  1J4R A;  2E45 A;  5AHT A;  2UZ5 A;  5D75 A;  3RGC A;  3VAW A;  1JNT A;  1WR7 A;  2XP4 A;  3KCE A;  4W9Q A;  3IK8 A;  3UI5 A;  5BXJ A;  3LUO A;  1JNS A;  3KAF A;  5HTG A;  5HW6 A;  2XP3 A;  4U85 A;  4QT3 A;  5HT1 A;  4DRO A;  5HW8 A;  4MSP A;  1FKR A;  4IPX A;  2BA1 A;  2ZR6 A;  4LAY A;  1FKH A;  1ZCN A;  3WH0 A;  2M3O W;  4DRP A;  2XPA A;  2XP6 A;  4DZ3 A;  5DIT A;  1HXV A;  2KFW A;  4ODK A;  4W9O A;  1Q1C A;  4ODL A;  4W9P A;  3I6C A;  2DMV A;  2MNT A;  2PPP A;  3EY6 A;  3KAG A;  3O5D A;  4LAX A;  2PV3 A;  1FKD A;  1NMW A;  3MDY B;  1C9H A;  3O5G A;  2FAP A; 
#chains in the Genus database with same CATH topology
 1O6W A;  2MLZ A;  4DWS B;  3WD0 A;  2KO7 A;  4J4N A;  2PN0 A;  1EHN A;  3FY1 A;  5DF0 A;  2KXQ A;  2JMF A;  5GQB A;  2DJY A;  1FD9 A;  3TC5 A;  4MGV A;  3O5P A;  1R9H A;  4TX0 A;  4DWS A;  1U79 A;  3AS1 A;  4NSB A;  1K9Q A;  2P4V A;  3B8S A;  3UI4 A;  1NWU A;  2M8J A;  3MCB B;  1RD6 A;  2LAJ A;  1E6Z A;  4WKF A;  2A3C A;  3O5F A;  3CNG A;  2RSE A;  2WLY A;  4LAY A;  4NNR A;  4ZPW R;  4Z2J A;  2LKN A;  2PBC A;  1LG1 A;  1FFR A;  1LL7 A;  3PRD A;  1EDQ A;  1ZU8 A;  2JZV A;  4Z2G A;  5E64 A;  2VCD A;  2YSG A;  1F8A B;  1HKK A;  4TNS A;  2KGJ A;  1NMV A;  3CHC A;  1UR8 A;  2EUL A;  4JFJ A;  4TW7 A;  4DRP A;  1JNS A;  3KAH A;  2VN1 A;  3UF8 A;  2DSV A;  2EZ5 W;  2DWV A;  2Y78 A;  4DWS C;  1W1T A;  5GPG A;  1HJV A;  3M7N A;  1FJD A;  1YW5 A;  3UI6 A;  1JMQ A;  3ARR A;  2JX8 A;  4AY1 A;  3EIP A;  3ODK A;  1BL4 A;  1FKS A;  1D6O A;  4Q22 A;  2YAJ B;  2LGO A;  2A3E A;  1BKF A;  3KAC A;  4PTM A;  3ARS A;  3MCB A;  3TDB A;  1FKI A;  3WIJ A;  4G50 A;  4ML4 A;  4ODP A;  1ZK6 A;  2DG4 A;  1KFW A;  5DIV A;  4DRK A;  4GIV A;  3OA5 A;  3KAI A;  3UQB A;  2M2A A;  1EG4 A;  3FS8 A;  2LJ4 A;  2ZQT A;  1A7X A;  2MLY A;  1PBK A;  4XAK A;  4HAR A;  1T11 A;  4LGX A;  1LG2 A;  5E62 A;  3ARV A;  3ARY A;  1JND A;  1X6N A;  3WL0 A;  5D75 A;  1W9V A;  3IK8 A;  2DT0 A;  1XHG A;  3WQW A;  1FKR A;  2ZR6 A;  1ZCN A;  3ARX A;  4ODK A;  4WKH A;  1Q1C A;  4ODL A;  4R5E A;  2MNT A;  3O5D A;  1GOI A;  3AS3 A;  3CHF A;  1FKL A;  5HWB A;  2XP5 A;  4Z2I A;  1NWR A;  3B9D A;  3O5R A;  3WD4 A;  2YBT A;  4JFI A;  4ODR A;  2O92 A;  3NI6 A;  1FLC A;  4DT4 A;  3O5E A;  2DK1 A;  5DIU A;  4HBO A;  1E6R A;  4ODQ A;  3AS2 A;  4MAV A;  1J6Y A;  4IQC A;  1NWS A;  2RE3 A;  1LJY A;  1W9U A;  1JNE A;  2PV2 A;  4E5R A;  1I5H W;  5HW6 A;  3WQV A;  3MQG A;  4U84 A;  1QPL A;  5I98 A;  3IKG A;  3CHE A;  4NZC A;  2DT3 A;  2PV1 A;  4DIP A;  3FSB A;  3IKD A;  2OLH A;  5HT1 A;  2YSB A;  2DK7 A;  2DT2 A;  4ODM A;  4ZPT R;  4BF8 A;  1W26 A;  3GPK A;  3O5K A;  3AS0 A;  4LAW A;  5B8I C;  2ETN A;  1XRV A;  4DRI A;  1EIB A;  1FKB A;  4J4O A;  1M5Y A;  4URI A;  4TYO A;  2M08 A;  1GPF A;  1H0G A;  4JFL A;  1RP5 A;  3WKZ A;  1ZBK A;  2XPB A;  2ITK A;  4TW6 A;  4DZ2 A;  1E6P A;  2PPO A;  3JYJ A;  2DT1 A;  3ARU A;  4KR0 B;  1E15 A;  3O5Q A;  3RM8 A;  1Y0O A;  3RME A;  4S3J A;  2G8Z A;  1ZBV A;  1GRJ A;  1EQ3 A;  4DRH A;  2WLZ A;  3CZ8 A;  4KQZ A;  1YAT A;  3ARZ A;  2XP7 A;  1KT0 A;  1FAP A;  3WD3 A;  3FXY A;  2DSW A;  3M85 A;  1FFQ A;  2KR7 A;  4QZV B;  2JV4 A;  1J4R A;  4L72 B;  4Z2H A;  3VAW A;  2QF8 A;  2XP4 A;  4W9Q A;  3ARP A;  3UI5 A;  2XP3 A;  4MSP A;  1NH6 A;  4IPX A;  2BA1 A;  5HBF A;  4A0T A;  5DIT A;  1OGG A;  3I6C A;  2DPE A;  2PPP A;  5E65 A;  5U47 A;  1FKD A;  3MDY B;  2QRV A;  3O5G A;  2MPH A;  4LAV A;  1E44 A;  3KZ7 A;  4R0X A;  2PPN A;  3BMB A;  1W9P A;  2ZAJ A;  5HKG A;  1NSG A;  2DG3 A;  4P8W A;  3MQH A;  4G2P A;  3ALG A;  4ODN A;  4GLX A;  3OOB A;  2F4E A;  3WL1 A;  2XP9 A;  1K9T A;  4JYS A;  4DH0 A;  4MNM A;  2DG9 A;  1WNO A;  3RM9 A;  2RUQ A;  2JXW A;  1FKG A;  2IF4 A;  2KI3 A;  1WMV A;  2AWG A;  1JCH B;  3CGM A;  2M1I A;  1FKK A;  2M8I A;  3JYM A;  1FKT A;  2L4J A;  5HWC A;  5DO2 A;  3ART A;  3PRB A;  1WAW A;  3IHZ A;  2WAD A;  4P8X A;  5J6E A;  1P5Q A;  2FKE A;  3LE4 A;  2O9O A;  1J4I A;  2D9F A;  1QZ2 A;  1W1P A;  4REX A;  1N1A A;  3B7X A;  1HJW A;  1VF8 A;  3RM4 A;  1HKI A;  4DRQ A;  2MLX A;  3NTP A;  1OWQ A;  3L4H A;  1EYM A;  3QOK A;  1Q6H A;  5BXJ A;  2WAE A;  3CHD A;  1D7H A;  1IX5 A;  4QT2 A;  4DRJ A;  2F21 A;  2WM0 A;  2KE0 A;  1LQ0 A;  4TW8 A;  3KAD A;  1K9R A;  2ZR4 A;  2ZQU A;  3TCZ A;  4JFM A;  3PA7 A;  1Q6U A;  4DRM A;  3B9E A;  2AOS A;  1H0I A;  1TFV A;  1ROU A;  1SYT A;  1J4H A;  1L1P A;  2N87 A;  1NWT A;  4P8U A;  5E5W A;  4MPK A;  3ARQ A;  4HBE A;  2F2D A;  3GU0 A;  2ESC A;  4N19 A;  1FKF A;  3RFW A;  5CQ2 A;  5AHT A;  3PR9 A;  1JNT A;  5GPR A;  3LUO A;  1HJX A;  5HTG A;  4U85 A;  1O6I A;  4DRO A;  1HKJ A;  4Q7N A;  3GTY X;  3FSC A;  4DZ3 A;  1HKM A;  1ZB5 A;  2B5U B;  4W9P A;  2DMV A;  3CH9 A;  3EY6 A;  3KAG A;  4IT6 A;  1NMW A;  4MNJ A;  1LL4 A;  1B6C A;  1OGB A;  1ZBC A;  1QPF A;  1EG3 A;  3NRK A;  3G6M A;  5HW7 A;  2MDI A;  2ZQV A;  2Y8N B;  4U86 A;  4L3N A;  1D7J A;  2OFN A;  3WD2 A;  4W5U A;  2IUZ A;  4C02 B;  2FDM A;  4WIW A;  3PQH A;  1PIN A;  1X6L A;  4UDM A;  1LL6 A;  1CTN A;  5E66 A;  4Z2L A;  1E9L A;  2A3A A;  2RUC A;  2YSH A;  3FAP A;  1GUV A;  2DSU A;  2RUR A;  4JFK A;  1Q6I A;  4IQ2 A;  4WK9 A;  4GGQ A;  4ODO A;  2LPV A;  3AQU A;  4QIB A;  2L2S A;  4QT3 A;  3BXW A;  4MNL A;  3WD1 A;  4WJX A;  4A0U A;  2A3B A;  2YSF A;  3PRA A;  1FKJ A;  1ITX A;  4ITZ A;  3LKX A;  3ARO A;  2RUD A;  3O5O A;  2RQS A;  4Z2K A;  3O5I A;  4DRN A;  2DSZ A;  1JVW A;  2B31 A;  2OWO A;  3O5M A;  3KAB A;  4FAP A;  2XP8 A;  4MNK A;  1W1V A;  3B9A A;  3O5L A;  3UQI A;  2YSI A;  1SR0 A;  4ZS6 A;  1W1Y A;  4IT4 A;  4DWS D;  4O2T A;  2K8I A;  1KT1 A;  3O5J A;  1TR8 A;  3W4R A;  3CGN A;  1ZBW A;  2F23 A;  4FN2 A;  1TK7 A;  1ZL1 A;  3UQA A;  2MF9 A;  3ARW A;  3H9R B;  2PI6 A;  3JXV A;  2WK2 A;  2G41 A;  4P8V A;  1UR9 A;  1F40 A;  1D7I A;  1TCO C;  3LKX B;  4ZPV R;  2ZQS A;  5DEZ A;  4WKA A;  1WB0 A;  2Q5A A;  5HUA A;  2ZR5 A;  1ROT A;  3G6L A;  2E45 A;  2UZ5 A;  1E6N A;  3RGC A;  1WR7 A;  3KCE A;  3KAF A;  5HW8 A;  5JH8 A;  1FKH A;  2YBU A;  3WH0 A;  1D2K A;  2M3O W;  4S3K A;  2XPA A;  2XP6 A;  3ALF A;  1HXV A;  2KFW A;  4W9O A;  4MTV A;  4LAX A;  2PV3 A;  1C9H A;  2FAP A; 
#chains in the Genus database with same CATH homology
 1O6W A;  2MLZ A;  4DWS B;  3WD0 A;  2KO7 A;  4J4N A;  1EHN A;  3FY1 A;  5DF0 A;  2KXQ A;  2JMF A;  5GQB A;  2DJY A;  1FD9 A;  3TC5 A;  4MGV A;  3O5P A;  1R9H A;  4TX0 A;  4DWS A;  1U79 A;  3AS1 A;  4NSB A;  1K9Q A;  3B8S A;  3UI4 A;  1NWU A;  2M8J A;  3MCB B;  1RD6 A;  2LAJ A;  1E6Z A;  4WKF A;  2A3C A;  3O5F A;  3CNG A;  2RSE A;  2WLY A;  4LAY A;  4NNR A;  4ZPW R;  4Z2J A;  2LKN A;  2PBC A;  1LG1 A;  1FFR A;  1LL7 A;  3PRD A;  1EDQ A;  1ZU8 A;  2JZV A;  4Z2G A;  5E64 A;  2VCD A;  2YSG A;  1F8A B;  1HKK A;  4TNS A;  2KGJ A;  1NMV A;  3CHC A;  1UR8 A;  4JFJ A;  4TW7 A;  4DRP A;  1JNS A;  3KAH A;  2VN1 A;  3UF8 A;  2DSV A;  2EZ5 W;  2DWV A;  2Y78 A;  4DWS C;  1W1T A;  5GPG A;  1HJV A;  3M7N A;  1FJD A;  1YW5 A;  3UI6 A;  1JMQ A;  3ARR A;  2JX8 A;  4AY1 A;  3ODK A;  1BL4 A;  1FKS A;  1D6O A;  4Q22 A;  2YAJ B;  2LGO A;  2A3E A;  1BKF A;  3KAC A;  4PTM A;  3ARS A;  3MCB A;  3TDB A;  1FKI A;  3WIJ A;  4G50 A;  4ML4 A;  4ODP A;  1ZK6 A;  2DG4 A;  1KFW A;  5DIV A;  4DRK A;  4GIV A;  3OA5 A;  3KAI A;  3UQB A;  2M2A A;  1EG4 A;  3FS8 A;  2LJ4 A;  2ZQT A;  1A7X A;  2MLY A;  1PBK A;  4XAK A;  4HAR A;  1T11 A;  4LGX A;  1LG2 A;  5E62 A;  3ARV A;  3ARY A;  1JND A;  1X6N A;  3WL0 A;  5D75 A;  1W9V A;  3IK8 A;  2DT0 A;  1XHG A;  3WQW A;  1FKR A;  2ZR6 A;  1ZCN A;  3ARX A;  4ODK A;  4WKH A;  1Q1C A;  4ODL A;  4R5E A;  2MNT A;  3O5D A;  1GOI A;  3AS3 A;  3CHF A;  1FKL A;  5HWB A;  2XP5 A;  4Z2I A;  1NWR A;  3B9D A;  3O5R A;  3WD4 A;  2YBT A;  4JFI A;  4ODR A;  2O92 A;  3NI6 A;  1FLC A;  4DT4 A;  3O5E A;  2DK1 A;  5DIU A;  4HBO A;  1E6R A;  4ODQ A;  3AS2 A;  4MAV A;  1J6Y A;  4IQC A;  1NWS A;  2RE3 A;  1LJY A;  1W9U A;  1JNE A;  2PV2 A;  4E5R A;  1I5H W;  5HW6 A;  3WQV A;  3MQG A;  4U84 A;  1QPL A;  5I98 A;  3IKG A;  3CHE A;  4NZC A;  2DT3 A;  2PV1 A;  4DIP A;  3FSB A;  3IKD A;  2OLH A;  5HT1 A;  2YSB A;  2DK7 A;  2DT2 A;  4ODM A;  4ZPT R;  4BF8 A;  1W26 A;  3GPK A;  3O5K A;  3AS0 A;  4LAW A;  5B8I C;  1XRV A;  4DRI A;  1EIB A;  1FKB A;  4J4O A;  1M5Y A;  4URI A;  4TYO A;  2M08 A;  1GPF A;  1H0G A;  4JFL A;  1RP5 A;  3WKZ A;  1ZBK A;  2XPB A;  2ITK A;  4TW6 A;  4DZ2 A;  1E6P A;  2PPO A;  3JYJ A;  2DT1 A;  3ARU A;  4KR0 B;  1E15 A;  3O5Q A;  3RM8 A;  1Y0O A;  3RME A;  4S3J A;  2G8Z A;  1ZBV A;  1EQ3 A;  4DRH A;  2WLZ A;  3CZ8 A;  4KQZ A;  3ARZ A;  1YAT A;  2XP7 A;  1KT0 A;  1FAP A;  3WD3 A;  3FXY A;  2DSW A;  3M85 A;  1FFQ A;  2KR7 A;  4QZV B;  2JV4 A;  1J4R A;  4L72 B;  4Z2H A;  3VAW A;  2QF8 A;  2XP4 A;  4W9Q A;  3ARP A;  3UI5 A;  2XP3 A;  4MSP A;  1NH6 A;  4IPX A;  2BA1 A;  5HBF A;  4A0T A;  5DIT A;  1OGG A;  3I6C A;  2DPE A;  2PPP A;  5E65 A;  5U47 A;  1FKD A;  3MDY B;  2QRV A;  3O5G A;  2MPH A;  4LAV A;  3KZ7 A;  4R0X A;  2PPN A;  1W9P A;  2ZAJ A;  5HKG A;  1NSG A;  2DG3 A;  4P8W A;  3MQH A;  4G2P A;  3ALG A;  4ODN A;  4GLX A;  3OOB A;  2F4E A;  3WL1 A;  2XP9 A;  1K9T A;  4JYS A;  4DH0 A;  4MNM A;  2DG9 A;  1WNO A;  3RM9 A;  2RUQ A;  2JXW A;  1FKG A;  2IF4 A;  2KI3 A;  1WMV A;  2AWG A;  3CGM A;  2M1I A;  1FKK A;  2M8I A;  3JYM A;  1FKT A;  2L4J A;  5HWC A;  5DO2 A;  3ART A;  3PRB A;  1WAW A;  3IHZ A;  2WAD A;  4P8X A;  5J6E A;  1P5Q A;  2FKE A;  3LE4 A;  2O9O A;  1J4I A;  2D9F A;  1QZ2 A;  1W1P A;  4REX A;  1N1A A;  3B7X A;  1HJW A;  1VF8 A;  3RM4 A;  1HKI A;  4DRQ A;  2MLX A;  3NTP A;  1OWQ A;  3L4H A;  1EYM A;  3QOK A;  1Q6H A;  5BXJ A;  2WAE A;  3CHD A;  1D7H A;  1IX5 A;  4QT2 A;  4DRJ A;  2F21 A;  2WM0 A;  2KE0 A;  1LQ0 A;  4TW8 A;  3KAD A;  1K9R A;  2ZR4 A;  2ZQU A;  3TCZ A;  4JFM A;  3PA7 A;  1Q6U A;  4DRM A;  3B9E A;  2AOS A;  1H0I A;  1TFV A;  1ROU A;  1SYT A;  1J4H A;  1L1P A;  2N87 A;  1NWT A;  4P8U A;  5E5W A;  4MPK A;  3ARQ A;  4HBE A;  2F2D A;  2ESC A;  4N19 A;  1FKF A;  3RFW A;  5CQ2 A;  5AHT A;  3PR9 A;  1JNT A;  5GPR A;  3LUO A;  1HJX A;  5HTG A;  4U85 A;  1O6I A;  4DRO A;  1HKJ A;  4Q7N A;  3FSC A;  4DZ3 A;  1HKM A;  1ZB5 A;  4W9P A;  2DMV A;  3CH9 A;  3EY6 A;  3KAG A;  4IT6 A;  1NMW A;  4MNJ A;  1LL4 A;  1B6C A;  1OGB A;  1ZBC A;  1QPF A;  1EG3 A;  3NRK A;  3G6M A;  5HW7 A;  2MDI A;  2ZQV A;  2Y8N B;  4U86 A;  4L3N A;  1D7J A;  2OFN A;  3WD2 A;  4W5U A;  2IUZ A;  4C02 B;  2FDM A;  4WIW A;  3PQH A;  1PIN A;  1X6L A;  1LL6 A;  1CTN A;  5E66 A;  4Z2L A;  1E9L A;  2A3A A;  2RUC A;  2YSH A;  3FAP A;  1GUV A;  2DSU A;  2RUR A;  4JFK A;  1Q6I A;  4IQ2 A;  4WK9 A;  4GGQ A;  4ODO A;  2LPV A;  3AQU A;  4QIB A;  2L2S A;  4QT3 A;  3BXW A;  4MNL A;  3WD1 A;  4WJX A;  4A0U A;  2A3B A;  2YSF A;  3PRA A;  1FKJ A;  1ITX A;  4ITZ A;  3LKX A;  3ARO A;  2RUD A;  3O5O A;  2RQS A;  4Z2K A;  3O5I A;  4DRN A;  2DSZ A;  1JVW A;  2B31 A;  2OWO A;  3O5M A;  3KAB A;  4FAP A;  2XP8 A;  4MNK A;  1W1V A;  3B9A A;  3O5L A;  3UQI A;  2YSI A;  1SR0 A;  4ZS6 A;  1W1Y A;  4IT4 A;  4DWS D;  4O2T A;  2K8I A;  1KT1 A;  3O5J A;  1TR8 A;  3W4R A;  3CGN A;  1ZBW A;  4FN2 A;  1TK7 A;  1ZL1 A;  3UQA A;  2MF9 A;  3ARW A;  3H9R B;  2PI6 A;  3JXV A;  2WK2 A;  2G41 A;  4P8V A;  1UR9 A;  1F40 A;  1D7I A;  1TCO C;  3LKX B;  4ZPV R;  2ZQS A;  5DEZ A;  4WKA A;  1WB0 A;  2Q5A A;  5HUA A;  2ZR5 A;  1ROT A;  3G6L A;  2E45 A;  2UZ5 A;  1E6N A;  3RGC A;  1WR7 A;  3KCE A;  3KAF A;  5HW8 A;  5JH8 A;  1FKH A;  2YBU A;  3WH0 A;  1D2K A;  2M3O W;  4S3K A;  2XPA A;  2XP6 A;  3ALF A;  1HXV A;  2KFW A;  4W9O A;  4MTV A;  4LAX A;  2PV3 A;  1C9H A;  2FAP A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...