2ITKA

Human pin1 bound to d-peptide
Total Genus 45
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
45
sequence length
157
structure length
145
Chain Sequence
LPPGWEKAMSRSSGRVYYFNHITNASQWERPSEPARVRCSHLLVKHSQSRRPSSWRQEKITRTKEEALELINGYIQKIKSGEEDFESLASQFSDCSSAKARGDLGAFSRGQMQKPFEDASFALRTGEMSGPVFTDSGIHIILRTE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Peptidyl-prolyl cis-trans isomerase NIMA-interacting 1
publication title Structural basis for high-affinity peptide inhibition of human Pin1.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Isomerase/isomerase inhibitor
total genus 45
structure length 145
sequence length 157
ec nomenclature ec 5.2.1.8: Peptidylprolyl isomerase.
pdb deposition date 2006-10-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00397 WW WW domain
A PF00639 Rotamase PPIC-type PPIASE domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.20.70.10 Mainly Beta Single Sheet Ubiquitin Ligase Nedd4; Chain: W; Ubiquitin Ligase Nedd4; Chain: W; 2itkA01
3.10.50.40 Alpha Beta Roll Chitinase A; domain 3 Chitinase A; domain 3 2itkA02
2DWVA 4C02B 1JNTA 4LAWA 2F21A 2YSGA 2EZ5W 4DRPA 4FN2A 5HUAA 4J4NA 5I98A 4ODKA 2RE3A 3OOBA 5HT1A 5DIVA 4DRIA 4DROA 3UQIA 1YW5A 1C9HA 4ODLA 1PBKA 1FJDA 4ODMA 2LPVA 4GIVA 4DIPA 3B7XA 2ZR6A 3O5KA 4LAXA 3IK8A 2FAPA 1P5QA 1O6WA 1Q6IA 4QIBA 5D75A 4DZ2A 5B8IC 4JFMA 4JYSA 4TW7A 3UF8A 4TW8A 3O5LA 2F2DA 1J4HA 2M3OW 4ODNA 1JNSA 5DITA 1QPFA 1NMVA 4DRMA 2ZQTA 2DK7A 2K8IA 4JFJA 1NMWA 2JX8A 1W26A 2D9FA 2L4JA 4DZ3A 3PRBA 4QT2A 2PV2A 2ZAJA 4G2PA 2PPOA 1T11A 2MPHA 4NNRA 3JYJA 3CGMA 1B6CA 3I6CA 2RUCA 1N1AA 1PINA 2XP7A 3KAGA 1Q6UA 2RUQA 3TDBA 1Y0OA 4O2TA 4DH0A 2PPPA 5HTGA 2PV3A 2Y78A 2LAJA 1TCOC 3RFWA 2KXQA 2MLYA 5BXJA 2DK1A 1KT0A 3KAHA 4DRJA 5GPGA 1WMVA 1EYMA 2ITKA 2XPAA 2XP5A 1FKLA 2YSBA 4TX0A 4DRHA 2YSIA 3MDYB 1A7XA 3NI6A 4DRKA 4E5RA 1D7HA 3L4HA 1JMQA 2AWGA 5DIUA 3JYMA 1D7JA 1EQ3A 4TYOA 2PPNA 2YSHA 3KCEA 4IQ2A 5HW8A 4N19A 4IQCA 1L1PA 4JFLA 1Q1CA 1K9RA 2KGJA 4REXA 3RGCA 1WR7A 1FKSA 3GPKA 1NSGA 1QZ2A 3O5DA 3JXVA 3UI6A 2JXWA 2MLZA 2PBCA 3KZ7A 4LAYA 5HWCA 2ZR4A 4JFIA 1F8AB 2VCDA 5J6EA 1EG4A 3NTPA 3FAPA 1FD9A 1FKJA 2L2SA 5AHTA 2JZVA 4FAPA 5HWBA 3TCZA 3ODKA 2F4EA 1FKHA 4ODQA 3O5IA 2MNTA 2ZQVA 4ODRA 3O5GA 4ODPA 3O5MA 3UI4A 2M08A 2M8IA 1Q6HA 1ZCNA 4QT3A 1ZK6A 2UZ5A 2XPBA 1KT1A 2JV4A 3O5QA 4TW6A 5HW6A 2XP9A 2JMFA 2DG9A 3M85A 2Q5AA 1F40A 4ITZA 1M5YA 1FKDA 3O5RA 4DRQA 2LKNA 1FKRA 3UQBA 4LAVA 3O5FA 1J4RA 3KACA 2LJ4A 4U86A 4U85A 4U84A 3VAWA 4ODOA 3UI5A 4W9PA 2IF4A 3CNGA 2DG3A 2N87A 2M8JA 1D6OA 3H9RB 4IPXA 2ZQUA 2KI3A 4W9QA 1K9QA 1FAPA 3UQAA 2XP4A 3PA7A 4GGQA 2DG4A 4MSPA 4R0XA 3LUOA 2XP6A 3KABA 2MDIA 1R9HA 1J6YA 1FKFA 4W9OA 2E45A 2RSEA 1BKFA 3NRKA 2XP8A 3KAIA 1HXVA 1D7IA 4DRNA 3O5JA 3M7NA 1FKGA 2XP3A 2M1IA 2KFWA 4TNSA 1U79A 2KO7A 4DT4A 1QPLA 3EY6A 1FKBA 2RUDA 3O5PA 2FKEA 4BF8A 4G50A 5CQ2A 4MGVA 1FKTA 1ROUA 2BA1A 2M2AA 1FKKA 2DMVA 1ROTA 1JVWA 1TK7A 2RURA 3IHZA 1BL4A 2LGOA 3TC5A 2PV1A 5HW7A 1EG3A 2MF9A 3IKDA 3WH0A 3KADA 2KE0A 3KAFA 2RQSA 1J4IA 4J4OA 3LE4A 3O5EA 4JFKA 2OFNA 3IKGA 2KR7A 1FKIA 2ZR5A 5HKGA 2ZQSA 2DJYA 2VN1A 2YSFA 1I5HW 3O5OA 3CGNA 2MLXA 1YATA 3PRDA
chains in the Genus database with same CATH superfamily
2DWVA 3ALFA 4C02B 1JNTA 4LAWA 3CZ8A 2F21A 1E6PA 3QOKA 2YSGA 2EZ5W 4DWSA 4DRPA 1SYTA 2Y8NB 4FN2A 3FY1A 5HUAA 2DSUA 4J4NA 5I98A 3ARVA 4ODKA 2RE3A 3OOBA 5HT1A 5DIVA 4DRIA 1W9VA 2QRVA 4DROA 3UQIA 1YW5A 1C9HA 4MTVA 4ODLA 4AY1A 1PBKA 2A3BA 1FJDA 4ODMA 3GU0A 4Z2LA 2LPVA 4GIVA 4DIPA 3B7XA 4L72B 3CHEA 4HBOA 5DF0A 1JNEA 2ZR6A 3O5KA 3ARQA 4LAXA 5E62A 3IK8A 2FAPA 2G41A 1P5QA 1O6WA 1Q6IA 4KQZA 4QIBA 3LKXB 5E66A 5D75A 4DZ2A 2F23A 5B8IC 2OWOA 4JFMA 4JYSA 3FXYA 3WD3A 1JCHB 4TW7A 1O6IA 3UF8A 4TW8A 3O5LA 2F2DA 5HBFA 1J4HA 2M3OW 4ODNA 1JNSA 2PN0A 3AS2A 1E6ZA 5DITA 1QPFA 1W9UA 1E15A 1NMVA 4W5UA 1FFQA 4DRMA 2ZQTA 1NWTA 2DK7A 2K8IA 4JFJA 1NMWA 2ESCA 2JX8A 1W26A 2D9FA 2L4JA 3LKXA 3ALGA 3PRBA 4QT2A 4DZ3A 2PV2A 2ZAJA 4G2PA 2DT3A 3ARPA 2PPOA 1T11A 2MPHA 4NNRA 3JYJA 1D2KA 3CGMA 1FLCA 1NWUA 1B6CA 3I6CA 4LGXA 2RUCA 4ZPWR 2OLHA 1N1AA 1PINA 4MNJA 1H0IA 1UR8A 2PI6A 3AS3A 1IX5A 2XP7A 3CHFA 3KAGA 1VF8A 3B8SA 1Q6UA 2RUQA 3TDBA 1Y0OA 4O2TA 4DH0A 2PPPA 1W1VA 5HTGA 2PV3A 1EDQA 3ARZA 2Y78A 2LAJA 1TCOC 3B9EA 4KR0B 4P8XA 1X6LA 4Z2IA 1LL7A 3RFWA 2KXQA 2MLYA 5BXJA 2DT0A 2DK1A 1KT0A 3KAHA 1W1YA 4PTMA 4DRJA 5E5WA 1HJVA 5GPGA 3WKZA 4URIA 1WMVA 1EYMA 5GQBA 2ITKA 4Q7NA 2XPAA 3WIJA 2XP5A 1FKLA 2YSBA 3ARXA 4TX0A 3AQUA 3WL1A 3FSBA 4DRHA 2YSIA 1GPFA 3MDYB 1A7XA 1HKIA 3NI6A 4WKAA 4DRKA 4E5RA 4L3NA 1RD6A 1D7HA 3L4HA 1JMQA 1EHNA 2AWGA 1W9PA 3BMBA 1ZBCA 4XAKA 5DIUA 3JYMA 1D7JA 1EQ3A 4TYOA 2PPNA 1OGBA 2YSHA 2AOSA 2P4VA 4IT4A 2YAJB 3KCEA 3AROA 1ITXA 4IQ2A 5HW8A 1E44A 2G8ZA 4N19A 4IQCA 1L1PA 4A0UA 3MQHA 4JFLA 1Q1CA 3ARUA 1K9RA 2KGJA 4REXA 3RGCA 1WR7A 1E9LA 1FKSA 3CHDA 3B9DA 3RM8A 3GPKA 5JH8A 1NSGA 1QZ2A 4QZVB 3O5DA 3JXVA 4HARA 3UI6A 2JXWA 1HJWA 2MLZA 2WAEA 3ARTA 2PBCA 3KZ7A 2DT1A 4LAYA 3GTYX 4MNLA 2O9OA 2ZR4A 5HWCA 4JFIA 3ARWA 1F8AB 5GPRA 2VCDA 2WK2A 1JNDA 5J6EA 1EG4A 1X6NA 3NTPA 4P8WA 3FAPA 1FD9A 1FKJA 2L2SA 3CHCA 5AHTA 2JZVA 5E65A 4FAPA 5HWBA 3TCZA 3ODKA 2F4EA 1FKHA 4ODQA 3G6LA 3EIPA 3O5IA 4HBEA 2MNTA 1NWSA 2ZQVA 4IT6A 4ODRA 3O5GA 4ODPA 3RM4A 4MPKA 3O5MA 3UI4A 2YBUA 2M08A 4WKFA 2M8IA 1Q6HA 1ZCNA 4DWSC 1CTNA 1XHGA 4QT3A 1ZK6A 2UZ5A 2XPBA 2A3CA 1KT1A 2WLYA 2JV4A 3O5QA 4TW6A 5HW6A 2XP9A 2JMFA 1LJYA 2WLZA 3WQVA 2B5UB 2DG9A 4Z2GA 3M85A 2Q5AA 1F40A 4NZCA 4WIWA 4ITZA 1M5YA 1FKDA 3O5RA 1ZBWA 2WADA 2FDMA 1WNOA 2DSWA 1KFWA 4Z2HA 4DRQA 4Q22A 2LKNA 1FKRA 3UQBA 4LAVA 4ZS6A 1W1PA 1J4RA 3O5FA 3KACA 2LJ4A 4U86A 4DWSD 1LG1A 3PQHA 1SR0A 5U47A 4UDMA 4U85A 4P8UA 4U84A 3VAWA 1ZBKA 4NSBA 4ODOA 3BXWA 1ZB5A 3UI5A 4W9PA 2IF4A 2N87A 3CNGA 1WAWA 2DG3A 2M8JA 1D6OA 4ZPVR 4ZPTR 2A3EA 3H9RB 1UR9A 3PR9A 2ZQUA 4IPXA 2KI3A 1LL4A 3CH9A 1TFVA 4W9QA 1K9QA 1FAPA 4ML4A 3UQAA 2IUZA 2XP4A 4MNKA 2DPEA 3MQGA 2O92A 2WM0A 3ARRA 3PA7A 5DEZA 1E6NA 4GGQA 1FFRA 1ZBVA 1ZL1A 2DG4A 4R5EA 4Z2KA 4MSPA 4R0XA 3LUOA 2XP6A 2DT2A 1ZU8A 3KABA 2MDIA 1R9HA 1J6YA 1FKFA 4W9OA 2E45A 2RSEA 2ETNA 1BKFA 2B31A 4Z2JA 3NRKA 3WL0A 3AS1A 1K9TA 2XP8A 3KAIA 3WD1A 1HXVA 1D7IA 4DRNA 4GLXA 1HJXA 3O5JA 3M7NA 1FKGA 1LQ0A 2XP3A 2M1IA 4WJXA 2KFWA 4TNSA 4S3JA 1U79A 2KO7A 4DT4A 1QPLA 3EY6A 1H0GA 1RP5A 3WD4A 3MCBB 1FKBA 2RUDA 3O5PA 3ARSA 2FKEA 2YBTA 4BF8A 4G50A 1GOIA 5CQ2A 3OA5A 4MAVA 4MGVA 1FKTA 2DSZA 1ROUA 2A3AA 2BA1A 1EIBA 2M2AA 1FKKA 2DMVA 1ROTA 3B9AA 1LL6A 1JVWA 4S3KA 1TR8A 1TK7A 3RM9A 3WQWA 2RURA 5DO2A 1XRVA 3MCBA 3IHZA 1NWRA 1NH6A 2QF8A 1BL4A 2LGOA 3TC5A 1E6RA 2PV1A 2DSVA 3WD0A 3W4RA 5HW7A 3PRAA 4WKHA 1EG3A 3AS0A 1HKMA 2MF9A 3IKDA 1HKJA 3WH0A 1HKKA 3KADA 2KE0A 3KAFA 1WB0A 2EULA 2RQSA 4P8VA 1GUVA 5E64A 1J4IA 1W1TA 4J4OA 3LE4A 4MNMA 4WK9A 3FSCA 3O5EA 4JFKA 3WD2A 2OFNA 3ARYA 3IKGA 2KR7A 1FKIA 2ZR5A 5HKGA 2ZQSA 3FS8A 2DJYA 2VN1A 1OGGA 4A0TA 2YSFA 1I5HW 4DWSB 1LG2A 1OWQA 1GRJA 3O5OA 3CGNA 2MLXA 1YATA 3G6MA 3PRDA 3RMEA
chains in the Genus database with same CATH topology
2DWVA 3ALFA 4C02B 1JNTA 4LAWA 3CZ8A 2F21A 1E6PA 3QOKA 2YSGA 2EZ5W 4DWSA 4DRPA 1SYTA 2Y8NB 4FN2A 3FY1A 5HUAA 2DSUA 4J4NA 5I98A 3ARVA 4ODKA 2RE3A 3OOBA 5HT1A 5DIVA 4DRIA 1W9VA 2QRVA 4DROA 3UQIA 1YW5A 1C9HA 4MTVA 4ODLA 4AY1A 1PBKA 2A3BA 1FJDA 4ODMA 4Z2LA 2LPVA 4GIVA 4DIPA 3B7XA 4L72B 3CHEA 4HBOA 5DF0A 1JNEA 2ZR6A 3O5KA 3ARQA 4LAXA 5E62A 3IK8A 2FAPA 2G41A 1P5QA 1O6WA 1Q6IA 4KQZA 4QIBA 3LKXB 5E66A 5D75A 4DZ2A 5B8IC 2OWOA 4JFMA 4JYSA 3FXYA 3WD3A 4TW7A 1O6IA 3UF8A 4TW8A 3O5LA 2F2DA 5HBFA 1J4HA 2M3OW 4ODNA 1JNSA 3AS2A 1E6ZA 5DITA 1QPFA 1W9UA 1E15A 1NMVA 4W5UA 1FFQA 4DRMA 2ZQTA 1NWTA 2DK7A 2K8IA 4JFJA 1NMWA 2ESCA 2JX8A 1W26A 2D9FA 2L4JA 3LKXA 3ALGA 3PRBA 4QT2A 4DZ3A 2PV2A 2ZAJA 4G2PA 2DT3A 3ARPA 2PPOA 1T11A 2MPHA 4NNRA 3JYJA 1D2KA 3CGMA 1FLCA 1NWUA 1B6CA 3I6CA 4LGXA 2RUCA 4ZPWR 2OLHA 1N1AA 1PINA 4MNJA 1H0IA 1UR8A 2PI6A 3AS3A 1IX5A 2XP7A 3CHFA 3KAGA 1VF8A 3B8SA 1Q6UA 2RUQA 3TDBA 1Y0OA 4O2TA 4DH0A 2PPPA 1W1VA 5HTGA 2PV3A 1EDQA 3ARZA 2Y78A 2LAJA 1TCOC 3B9EA 4KR0B 4P8XA 1X6LA 4Z2IA 1LL7A 3RFWA 2KXQA 2MLYA 5BXJA 2DT0A 2DK1A 1KT0A 3KAHA 1W1YA 4PTMA 4DRJA 5E5WA 1HJVA 5GPGA 3WKZA 4URIA 1WMVA 1EYMA 5GQBA 2ITKA 4Q7NA 2XPAA 3WIJA 2XP5A 1FKLA 2YSBA 3ARXA 4TX0A 3AQUA 3WL1A 3FSBA 4DRHA 2YSIA 1GPFA 3MDYB 1A7XA 1HKIA 3NI6A 4WKAA 4DRKA 4E5RA 4L3NA 1RD6A 1D7HA 3L4HA 1JMQA 1EHNA 2AWGA 1W9PA 1ZBCA 4XAKA 5DIUA 3JYMA 1D7JA 1EQ3A 4TYOA 2PPNA 1OGBA 2YSHA 2AOSA 4IT4A 2YAJB 3KCEA 3AROA 1ITXA 4IQ2A 5HW8A 2G8ZA 4N19A 4IQCA 1L1PA 4A0UA 3MQHA 4JFLA 1Q1CA 3ARUA 1K9RA 2KGJA 4REXA 3RGCA 1WR7A 1E9LA 1FKSA 3CHDA 3B9DA 3RM8A 3GPKA 5JH8A 1NSGA 1QZ2A 4QZVB 3O5DA 3JXVA 4HARA 3UI6A 2JXWA 1HJWA 2MLZA 2WAEA 3ARTA 2PBCA 3KZ7A 2DT1A 4LAYA 4MNLA 2O9OA 2ZR4A 5HWCA 4JFIA 3ARWA 1F8AB 5GPRA 2VCDA 2WK2A 1JNDA 5J6EA 1EG4A 1X6NA 3NTPA 4P8WA 3FAPA 1FD9A 1FKJA 2L2SA 3CHCA 5AHTA 2JZVA 5E65A 4FAPA 5HWBA 3TCZA 3ODKA 2F4EA 1FKHA 4ODQA 3G6LA 3O5IA 4HBEA 2MNTA 1NWSA 2ZQVA 4IT6A 4ODRA 3O5GA 4ODPA 3RM4A 4MPKA 3O5MA 3UI4A 2YBUA 2M08A 4WKFA 2M8IA 1Q6HA 1ZCNA 4DWSC 1CTNA 1XHGA 4QT3A 1ZK6A 2UZ5A 2XPBA 2A3CA 1KT1A 2WLYA 2JV4A 3O5QA 4TW6A 5HW6A 2XP9A 2JMFA 1LJYA 2WLZA 3WQVA 2DG9A 4Z2GA 3M85A 2Q5AA 1F40A 4NZCA 4WIWA 4ITZA 1M5YA 1FKDA 3O5RA 1ZBWA 2WADA 2FDMA 1WNOA 2DSWA 1KFWA 4Z2HA 4DRQA 4Q22A 2LKNA 1FKRA 3UQBA 4LAVA 4ZS6A 1W1PA 1J4RA 3O5FA 3KACA 2LJ4A 4U86A 4DWSD 1LG1A 3PQHA 1SR0A 5U47A 4U85A 4P8UA 4U84A 3VAWA 1ZBKA 4NSBA 4ODOA 3BXWA 1ZB5A 3UI5A 4W9PA 2IF4A 2N87A 3CNGA 1WAWA 2DG3A 2M8JA 1D6OA 4ZPVR 4ZPTR 2A3EA 3H9RB 1UR9A 3PR9A 2ZQUA 4IPXA 2KI3A 1LL4A 3CH9A 1TFVA 4W9QA 1K9QA 1FAPA 4ML4A 3UQAA 2IUZA 2XP4A 4MNKA 2DPEA 3MQGA 2O92A 2WM0A 3ARRA 3PA7A 5DEZA 1E6NA 4GGQA 1FFRA 1ZBVA 1ZL1A 2DG4A 4R5EA 4Z2KA 4MSPA 4R0XA 3LUOA 2XP6A 2DT2A 1ZU8A 3KABA 2MDIA 1R9HA 1J6YA 1FKFA 4W9OA 2E45A 2RSEA 1BKFA 2B31A 4Z2JA 3NRKA 3WL0A 3AS1A 1K9TA 2XP8A 3KAIA 3WD1A 1HXVA 1D7IA 4DRNA 4GLXA 1HJXA 3O5JA 3M7NA 1FKGA 1LQ0A 2XP3A 2M1IA 4WJXA 2KFWA 4TNSA 4S3JA 1U79A 2KO7A 4DT4A 1QPLA 3EY6A 1H0GA 1RP5A 3WD4A 3MCBB 1FKBA 2RUDA 3O5PA 3ARSA 2FKEA 2YBTA 4BF8A 4G50A 1GOIA 5CQ2A 3OA5A 4MAVA 4MGVA 1FKTA 2DSZA 1ROUA 2A3AA 2BA1A 1EIBA 2M2AA 1FKKA 2DMVA 1ROTA 3B9AA 1LL6A 1JVWA 4S3KA 1TR8A 1TK7A 3RM9A 3WQWA 2RURA 5DO2A 1XRVA 3MCBA 3IHZA 1NWRA 1NH6A 2QF8A 1BL4A 2LGOA 3TC5A 1E6RA 2PV1A 2DSVA 3WD0A 3W4RA 5HW7A 3PRAA 4WKHA 1EG3A 3AS0A 1HKMA 2MF9A 3IKDA 1HKJA 3WH0A 1HKKA 3KADA 2KE0A 3KAFA 1WB0A 2RQSA 4P8VA 1GUVA 5E64A 1J4IA 1W1TA 4J4OA 3LE4A 4MNMA 4WK9A 3FSCA 3O5EA 4JFKA 3WD2A 2OFNA 3ARYA 3IKGA 2KR7A 1FKIA 2ZR5A 5HKGA 2ZQSA 3FS8A 2DJYA 2VN1A 1OGGA 4A0TA 2YSFA 1I5HW 4DWSB 1LG2A 1OWQA 3O5OA 3CGNA 2MLXA 1YATA 3G6MA 3PRDA 3RMEA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2DWV A;  4C02 B;  1JNT A;  4LAW A;  2F21 A;  2YSG A;  2EZ5 W;  4DRP A;  4FN2 A;  5HUA A;  4J4N A;  5I98 A;  4ODK A;  2RE3 A;  3OOB A;  5HT1 A;  5DIV A;  4DRI A;  4DRO A;  3UQI A;  1YW5 A;  1C9H A;  4ODL A;  1PBK A;  1FJD A;  4ODM A;  2LPV A;  4GIV A;  4DIP A;  3B7X A;  2ZR6 A;  3O5K A;  4LAX A;  3IK8 A;  2FAP A;  1P5Q A;  1O6W A;  1Q6I A;  4QIB A;  5D75 A;  4DZ2 A;  5B8I C;  4JFM A;  4JYS A;  4TW7 A;  3UF8 A;  4TW8 A;  3O5L A;  2F2D A;  1J4H A;  2M3O W;  4ODN A;  1JNS A;  5DIT A;  1QPF A;  1NMV A;  4DRM A;  2ZQT A;  2DK7 A;  2K8I A;  4JFJ A;  1NMW A;  2JX8 A;  1W26 A;  2D9F A;  2L4J A;  4DZ3 A;  3PRB A;  4QT2 A;  2PV2 A;  2ZAJ A;  4G2P A;  2PPO A;  1T11 A;  2MPH A;  4NNR A;  3JYJ A;  3CGM A;  1B6C A;  3I6C A;  2RUC A;  1N1A A;  1PIN A;  2XP7 A;  3KAG A;  1Q6U A;  2RUQ A;  3TDB A;  1Y0O A;  4O2T A;  4DH0 A;  2PPP A;  5HTG A;  2PV3 A;  2Y78 A;  2LAJ A;  1TCO C;  3RFW A;  2KXQ A;  2MLY A;  5BXJ A;  2DK1 A;  1KT0 A;  3KAH A;  4DRJ A;  5GPG A;  1WMV A;  1EYM A;  2ITK A;  2XPA A;  2XP5 A;  1FKL A;  2YSB A;  4TX0 A;  4DRH A;  2YSI A;  3MDY B;  1A7X A;  3NI6 A;  4DRK A;  4E5R A;  1D7H A;  3L4H A;  1JMQ A;  2AWG A;  5DIU A;  3JYM A;  1D7J A;  1EQ3 A;  4TYO A;  2PPN A;  2YSH A;  3KCE A;  4IQ2 A;  5HW8 A;  4N19 A;  4IQC A;  1L1P A;  4JFL A;  1Q1C A;  1K9R A;  2KGJ A;  4REX A;  3RGC A;  1WR7 A;  1FKS A;  3GPK A;  1NSG A;  1QZ2 A;  3O5D A;  3JXV A;  3UI6 A;  2JXW A;  2MLZ A;  2PBC A;  3KZ7 A;  4LAY A;  5HWC A;  2ZR4 A;  4JFI A;  1F8A B;  2VCD A;  5J6E A;  1EG4 A;  3NTP A;  3FAP A;  1FD9 A;  1FKJ A;  2L2S A;  5AHT A;  2JZV A;  4FAP A;  5HWB A;  3TCZ A;  3ODK A;  2F4E A;  1FKH A;  4ODQ A;  3O5I A;  2MNT A;  2ZQV A;  4ODR A;  3O5G A;  4ODP A;  3O5M A;  3UI4 A;  2M08 A;  2M8I A;  1Q6H A;  1ZCN A;  4QT3 A;  1ZK6 A;  2UZ5 A;  2XPB A;  1KT1 A;  2JV4 A;  3O5Q A;  4TW6 A;  5HW6 A;  2XP9 A;  2JMF A;  2DG9 A;  3M85 A;  2Q5A A;  1F40 A;  4ITZ A;  1M5Y A;  1FKD A;  3O5R A;  4DRQ A;  2LKN A;  1FKR A;  3UQB A;  4LAV A;  3O5F A;  1J4R A;  3KAC A;  2LJ4 A;  4U86 A;  4U85 A;  4U84 A;  3VAW A;  4ODO A;  3UI5 A;  4W9P A;  2IF4 A;  3CNG A;  2DG3 A;  2N87 A;  2M8J A;  1D6O A;  3H9R B;  4IPX A;  2ZQU A;  2KI3 A;  4W9Q A;  1K9Q A;  1FAP A;  3UQA A;  2XP4 A;  3PA7 A;  4GGQ A;  2DG4 A;  4MSP A;  4R0X A;  3LUO A;  2XP6 A;  3KAB A;  2MDI A;  1R9H A;  1J6Y A;  1FKF A;  4W9O A;  2E45 A;  2RSE A;  1BKF A;  3NRK A;  2XP8 A;  3KAI A;  1HXV A;  1D7I A;  4DRN A;  3O5J A;  3M7N A;  1FKG A;  2XP3 A;  2M1I A;  2KFW A;  4TNS A;  1U79 A;  2KO7 A;  4DT4 A;  1QPL A;  3EY6 A;  1FKB A;  2RUD A;  3O5P A;  2FKE A;  4BF8 A;  4G50 A;  5CQ2 A;  4MGV A;  1FKT A;  1ROU A;  2BA1 A;  2M2A A;  1FKK A;  2DMV A;  1ROT A;  1JVW A;  1TK7 A;  2RUR A;  3IHZ A;  1BL4 A;  2LGO A;  3TC5 A;  2PV1 A;  5HW7 A;  1EG3 A;  2MF9 A;  3IKD A;  3WH0 A;  3KAD A;  2KE0 A;  3KAF A;  2RQS A;  1J4I A;  4J4O A;  3LE4 A;  3O5E A;  4JFK A;  2OFN A;  3IKG A;  2KR7 A;  1FKI A;  2ZR5 A;  5HKG A;  2ZQS A;  2DJY A;  2VN1 A;  2YSF A;  1I5H W;  3O5O A;  3CGN A;  2MLX A;  1YAT A;  3PRD A; 
#chains in the Genus database with same CATH topology
 2DWV A;  3ALF A;  4C02 B;  1JNT A;  4LAW A;  3CZ8 A;  2F21 A;  1E6P A;  3QOK A;  2YSG A;  2EZ5 W;  4DWS A;  4DRP A;  1SYT A;  2Y8N B;  4FN2 A;  3FY1 A;  5HUA A;  2DSU A;  4J4N A;  5I98 A;  3ARV A;  4ODK A;  2RE3 A;  3OOB A;  5HT1 A;  5DIV A;  4DRI A;  1W9V A;  2QRV A;  4DRO A;  3UQI A;  1YW5 A;  1C9H A;  4MTV A;  4ODL A;  4AY1 A;  1PBK A;  2A3B A;  1FJD A;  4ODM A;  3GU0 A;  4Z2L A;  2LPV A;  4GIV A;  4DIP A;  3B7X A;  4L72 B;  3CHE A;  4HBO A;  5DF0 A;  1JNE A;  2ZR6 A;  3O5K A;  3ARQ A;  4LAX A;  5E62 A;  3IK8 A;  2FAP A;  2G41 A;  1P5Q A;  1O6W A;  1Q6I A;  4KQZ A;  4QIB A;  3LKX B;  5E66 A;  5D75 A;  4DZ2 A;  2F23 A;  5B8I C;  2OWO A;  4JFM A;  4JYS A;  3FXY A;  3WD3 A;  1JCH B;  4TW7 A;  1O6I A;  3UF8 A;  4TW8 A;  3O5L A;  2F2D A;  5HBF A;  1J4H A;  2M3O W;  4ODN A;  1JNS A;  2PN0 A;  3AS2 A;  1E6Z A;  5DIT A;  1QPF A;  1W9U A;  1E15 A;  1NMV A;  4W5U A;  1FFQ A;  4DRM A;  2ZQT A;  1NWT A;  2DK7 A;  2K8I A;  4JFJ A;  1NMW A;  2ESC A;  2JX8 A;  1W26 A;  2D9F A;  2L4J A;  3LKX A;  3ALG A;  3PRB A;  4QT2 A;  4DZ3 A;  2PV2 A;  2ZAJ A;  4G2P A;  2DT3 A;  3ARP A;  2PPO A;  1T11 A;  2MPH A;  4NNR A;  3JYJ A;  1D2K A;  3CGM A;  1FLC A;  1NWU A;  1B6C A;  3I6C A;  4LGX A;  2RUC A;  4ZPW R;  2OLH A;  1N1A A;  1PIN A;  4MNJ A;  1H0I A;  1UR8 A;  2PI6 A;  3AS3 A;  1IX5 A;  2XP7 A;  3CHF A;  3KAG A;  1VF8 A;  3B8S A;  1Q6U A;  2RUQ A;  3TDB A;  1Y0O A;  4O2T A;  4DH0 A;  2PPP A;  1W1V A;  5HTG A;  2PV3 A;  1EDQ A;  3ARZ A;  2Y78 A;  2LAJ A;  1TCO C;  3B9E A;  4KR0 B;  4P8X A;  1X6L A;  4Z2I A;  1LL7 A;  3RFW A;  2KXQ A;  2MLY A;  5BXJ A;  2DT0 A;  2DK1 A;  1KT0 A;  3KAH A;  1W1Y A;  4PTM A;  4DRJ A;  5E5W A;  1HJV A;  5GPG A;  3WKZ A;  4URI A;  1WMV A;  1EYM A;  5GQB A;  2ITK A;  4Q7N A;  2XPA A;  3WIJ A;  2XP5 A;  1FKL A;  2YSB A;  3ARX A;  4TX0 A;  3AQU A;  3WL1 A;  3FSB A;  4DRH A;  2YSI A;  1GPF A;  3MDY B;  1A7X A;  1HKI A;  3NI6 A;  4WKA A;  4DRK A;  4E5R A;  4L3N A;  1RD6 A;  1D7H A;  3L4H A;  1JMQ A;  1EHN A;  2AWG A;  1W9P A;  3BMB A;  1ZBC A;  4XAK A;  5DIU A;  3JYM A;  1D7J A;  1EQ3 A;  4TYO A;  2PPN A;  1OGB A;  2YSH A;  2AOS A;  2P4V A;  4IT4 A;  2YAJ B;  3KCE A;  3ARO A;  1ITX A;  4IQ2 A;  5HW8 A;  1E44 A;  2G8Z A;  4N19 A;  4IQC A;  1L1P A;  4A0U A;  3MQH A;  4JFL A;  1Q1C A;  3ARU A;  1K9R A;  2KGJ A;  4REX A;  3RGC A;  1WR7 A;  1E9L A;  1FKS A;  3CHD A;  3B9D A;  3RM8 A;  3GPK A;  5JH8 A;  1NSG A;  1QZ2 A;  4QZV B;  3O5D A;  3JXV A;  4HAR A;  3UI6 A;  2JXW A;  1HJW A;  2MLZ A;  2WAE A;  3ART A;  2PBC A;  3KZ7 A;  2DT1 A;  4LAY A;  3GTY X;  4MNL A;  2O9O A;  2ZR4 A;  5HWC A;  4JFI A;  3ARW A;  1F8A B;  5GPR A;  2VCD A;  2WK2 A;  1JND A;  5J6E A;  1EG4 A;  1X6N A;  3NTP A;  4P8W A;  3FAP A;  1FD9 A;  1FKJ A;  2L2S A;  3CHC A;  5AHT A;  2JZV A;  5E65 A;  4FAP A;  5HWB A;  3TCZ A;  3ODK A;  2F4E A;  1FKH A;  4ODQ A;  3G6L A;  3EIP A;  3O5I A;  4HBE A;  2MNT A;  1NWS A;  2ZQV A;  4IT6 A;  4ODR A;  3O5G A;  4ODP A;  3RM4 A;  4MPK A;  3O5M A;  3UI4 A;  2YBU A;  2M08 A;  4WKF A;  2M8I A;  1Q6H A;  1ZCN A;  4DWS C;  1CTN A;  1XHG A;  4QT3 A;  1ZK6 A;  2UZ5 A;  2XPB A;  2A3C A;  1KT1 A;  2WLY A;  2JV4 A;  3O5Q A;  4TW6 A;  5HW6 A;  2XP9 A;  2JMF A;  1LJY A;  2WLZ A;  3WQV A;  2B5U B;  2DG9 A;  4Z2G A;  3M85 A;  2Q5A A;  1F40 A;  4NZC A;  4WIW A;  4ITZ A;  1M5Y A;  1FKD A;  3O5R A;  1ZBW A;  2WAD A;  2FDM A;  1WNO A;  2DSW A;  1KFW A;  4Z2H A;  4DRQ A;  4Q22 A;  2LKN A;  1FKR A;  3UQB A;  4LAV A;  4ZS6 A;  1W1P A;  1J4R A;  3O5F A;  3KAC A;  2LJ4 A;  4U86 A;  4DWS D;  1LG1 A;  3PQH A;  1SR0 A;  5U47 A;  4UDM A;  4U85 A;  4P8U A;  4U84 A;  3VAW A;  1ZBK A;  4NSB A;  4ODO A;  3BXW A;  1ZB5 A;  3UI5 A;  4W9P A;  2IF4 A;  2N87 A;  3CNG A;  1WAW A;  2DG3 A;  2M8J A;  1D6O A;  4ZPV R;  4ZPT R;  2A3E A;  3H9R B;  1UR9 A;  3PR9 A;  2ZQU A;  4IPX A;  2KI3 A;  1LL4 A;  3CH9 A;  1TFV A;  4W9Q A;  1K9Q A;  1FAP A;  4ML4 A;  3UQA A;  2IUZ A;  2XP4 A;  4MNK A;  2DPE A;  3MQG A;  2O92 A;  2WM0 A;  3ARR A;  3PA7 A;  5DEZ A;  1E6N A;  4GGQ A;  1FFR A;  1ZBV A;  1ZL1 A;  2DG4 A;  4R5E A;  4Z2K A;  4MSP A;  4R0X A;  3LUO A;  2XP6 A;  2DT2 A;  1ZU8 A;  3KAB A;  2MDI A;  1R9H A;  1J6Y A;  1FKF A;  4W9O A;  2E45 A;  2RSE A;  2ETN A;  1BKF A;  2B31 A;  4Z2J A;  3NRK A;  3WL0 A;  3AS1 A;  1K9T A;  2XP8 A;  3KAI A;  3WD1 A;  1HXV A;  1D7I A;  4DRN A;  4GLX A;  1HJX A;  3O5J A;  3M7N A;  1FKG A;  1LQ0 A;  2XP3 A;  2M1I A;  4WJX A;  2KFW A;  4TNS A;  4S3J A;  1U79 A;  2KO7 A;  4DT4 A;  1QPL A;  3EY6 A;  1H0G A;  1RP5 A;  3WD4 A;  3MCB B;  1FKB A;  2RUD A;  3O5P A;  3ARS A;  2FKE A;  2YBT A;  4BF8 A;  4G50 A;  1GOI A;  5CQ2 A;  3OA5 A;  4MAV A;  4MGV A;  1FKT A;  2DSZ A;  1ROU A;  2A3A A;  2BA1 A;  1EIB A;  2M2A A;  1FKK A;  2DMV A;  1ROT A;  3B9A A;  1LL6 A;  1JVW A;  4S3K A;  1TR8 A;  1TK7 A;  3RM9 A;  3WQW A;  2RUR A;  5DO2 A;  1XRV A;  3MCB A;  3IHZ A;  1NWR A;  1NH6 A;  2QF8 A;  1BL4 A;  2LGO A;  3TC5 A;  1E6R A;  2PV1 A;  2DSV A;  3WD0 A;  3W4R A;  5HW7 A;  3PRA A;  4WKH A;  1EG3 A;  3AS0 A;  1HKM A;  2MF9 A;  3IKD A;  1HKJ A;  3WH0 A;  1HKK A;  3KAD A;  2KE0 A;  3KAF A;  1WB0 A;  2EUL A;  2RQS A;  4P8V A;  1GUV A;  5E64 A;  1J4I A;  1W1T A;  4J4O A;  3LE4 A;  4MNM A;  4WK9 A;  3FSC A;  3O5E A;  4JFK A;  3WD2 A;  2OFN A;  3ARY A;  3IKG A;  2KR7 A;  1FKI A;  2ZR5 A;  5HKG A;  2ZQS A;  3FS8 A;  2DJY A;  2VN1 A;  1OGG A;  4A0T A;  2YSF A;  1I5H W;  4DWS B;  1LG2 A;  1OWQ A;  1GRJ A;  3O5O A;  3CGN A;  2MLX A;  1YAT A;  3G6M A;  3PRD A;  3RME A; 
#chains in the Genus database with same CATH homology
 2DWV A;  3ALF A;  4C02 B;  1JNT A;  4LAW A;  3CZ8 A;  2F21 A;  1E6P A;  3QOK A;  2YSG A;  2EZ5 W;  4DWS A;  4DRP A;  1SYT A;  2Y8N B;  4FN2 A;  3FY1 A;  5HUA A;  2DSU A;  4J4N A;  5I98 A;  3ARV A;  4ODK A;  2RE3 A;  3OOB A;  5HT1 A;  5DIV A;  4DRI A;  1W9V A;  2QRV A;  4DRO A;  3UQI A;  1YW5 A;  1C9H A;  4MTV A;  4ODL A;  4AY1 A;  1PBK A;  2A3B A;  1FJD A;  4ODM A;  4Z2L A;  2LPV A;  4GIV A;  4DIP A;  3B7X A;  4L72 B;  3CHE A;  4HBO A;  5DF0 A;  1JNE A;  2ZR6 A;  3O5K A;  3ARQ A;  4LAX A;  5E62 A;  3IK8 A;  2FAP A;  2G41 A;  1P5Q A;  1O6W A;  1Q6I A;  4KQZ A;  4QIB A;  3LKX B;  5E66 A;  5D75 A;  4DZ2 A;  5B8I C;  2OWO A;  4JFM A;  4JYS A;  3FXY A;  3WD3 A;  4TW7 A;  1O6I A;  3UF8 A;  4TW8 A;  3O5L A;  2F2D A;  5HBF A;  1J4H A;  2M3O W;  4ODN A;  1JNS A;  3AS2 A;  1E6Z A;  5DIT A;  1QPF A;  1W9U A;  1E15 A;  1NMV A;  4W5U A;  1FFQ A;  4DRM A;  2ZQT A;  1NWT A;  2DK7 A;  2K8I A;  4JFJ A;  1NMW A;  2ESC A;  2JX8 A;  1W26 A;  2D9F A;  2L4J A;  3LKX A;  3ALG A;  3PRB A;  4QT2 A;  4DZ3 A;  2PV2 A;  2ZAJ A;  4G2P A;  2DT3 A;  3ARP A;  2PPO A;  1T11 A;  2MPH A;  4NNR A;  3JYJ A;  1D2K A;  3CGM A;  1FLC A;  1NWU A;  1B6C A;  3I6C A;  4LGX A;  2RUC A;  4ZPW R;  2OLH A;  1N1A A;  1PIN A;  4MNJ A;  1H0I A;  1UR8 A;  2PI6 A;  3AS3 A;  1IX5 A;  2XP7 A;  3CHF A;  3KAG A;  1VF8 A;  3B8S A;  1Q6U A;  2RUQ A;  3TDB A;  1Y0O A;  4O2T A;  4DH0 A;  2PPP A;  1W1V A;  5HTG A;  2PV3 A;  1EDQ A;  3ARZ A;  2Y78 A;  2LAJ A;  1TCO C;  3B9E A;  4KR0 B;  4P8X A;  1X6L A;  4Z2I A;  1LL7 A;  3RFW A;  2KXQ A;  2MLY A;  5BXJ A;  2DT0 A;  2DK1 A;  1KT0 A;  3KAH A;  1W1Y A;  4PTM A;  4DRJ A;  5E5W A;  1HJV A;  5GPG A;  3WKZ A;  4URI A;  1WMV A;  1EYM A;  5GQB A;  2ITK A;  4Q7N A;  2XPA A;  3WIJ A;  2XP5 A;  1FKL A;  2YSB A;  3ARX A;  4TX0 A;  3AQU A;  3WL1 A;  3FSB A;  4DRH A;  2YSI A;  1GPF A;  3MDY B;  1A7X A;  1HKI A;  3NI6 A;  4WKA A;  4DRK A;  4E5R A;  4L3N A;  1RD6 A;  1D7H A;  3L4H A;  1JMQ A;  1EHN A;  2AWG A;  1W9P A;  1ZBC A;  4XAK A;  5DIU A;  3JYM A;  1D7J A;  1EQ3 A;  4TYO A;  2PPN A;  1OGB A;  2YSH A;  2AOS A;  4IT4 A;  2YAJ B;  3KCE A;  3ARO A;  1ITX A;  4IQ2 A;  5HW8 A;  2G8Z A;  4N19 A;  4IQC A;  1L1P A;  4A0U A;  3MQH A;  4JFL A;  1Q1C A;  3ARU A;  1K9R A;  2KGJ A;  4REX A;  3RGC A;  1WR7 A;  1E9L A;  1FKS A;  3CHD A;  3B9D A;  3RM8 A;  3GPK A;  5JH8 A;  1NSG A;  1QZ2 A;  4QZV B;  3O5D A;  3JXV A;  4HAR A;  3UI6 A;  2JXW A;  1HJW A;  2MLZ A;  2WAE A;  3ART A;  2PBC A;  3KZ7 A;  2DT1 A;  4LAY A;  4MNL A;  2O9O A;  2ZR4 A;  5HWC A;  4JFI A;  3ARW A;  1F8A B;  5GPR A;  2VCD A;  2WK2 A;  1JND A;  5J6E A;  1EG4 A;  1X6N A;  3NTP A;  4P8W A;  3FAP A;  1FD9 A;  1FKJ A;  2L2S A;  3CHC A;  5AHT A;  2JZV A;  5E65 A;  4FAP A;  5HWB A;  3TCZ A;  3ODK A;  2F4E A;  1FKH A;  4ODQ A;  3G6L A;  3O5I A;  4HBE A;  2MNT A;  1NWS A;  2ZQV A;  4IT6 A;  4ODR A;  3O5G A;  4ODP A;  3RM4 A;  4MPK A;  3O5M A;  3UI4 A;  2YBU A;  2M08 A;  4WKF A;  2M8I A;  1Q6H A;  1ZCN A;  4DWS C;  1CTN A;  1XHG A;  4QT3 A;  1ZK6 A;  2UZ5 A;  2XPB A;  2A3C A;  1KT1 A;  2WLY A;  2JV4 A;  3O5Q A;  4TW6 A;  5HW6 A;  2XP9 A;  2JMF A;  1LJY A;  2WLZ A;  3WQV A;  2DG9 A;  4Z2G A;  3M85 A;  2Q5A A;  1F40 A;  4NZC A;  4WIW A;  4ITZ A;  1M5Y A;  1FKD A;  3O5R A;  1ZBW A;  2WAD A;  2FDM A;  1WNO A;  2DSW A;  1KFW A;  4Z2H A;  4DRQ A;  4Q22 A;  2LKN A;  1FKR A;  3UQB A;  4LAV A;  4ZS6 A;  1W1P A;  1J4R A;  3O5F A;  3KAC A;  2LJ4 A;  4U86 A;  4DWS D;  1LG1 A;  3PQH A;  1SR0 A;  5U47 A;  4U85 A;  4P8U A;  4U84 A;  3VAW A;  1ZBK A;  4NSB A;  4ODO A;  3BXW A;  1ZB5 A;  3UI5 A;  4W9P A;  2IF4 A;  2N87 A;  3CNG A;  1WAW A;  2DG3 A;  2M8J A;  1D6O A;  4ZPV R;  4ZPT R;  2A3E A;  3H9R B;  1UR9 A;  3PR9 A;  2ZQU A;  4IPX A;  2KI3 A;  1LL4 A;  3CH9 A;  1TFV A;  4W9Q A;  1K9Q A;  1FAP A;  4ML4 A;  3UQA A;  2IUZ A;  2XP4 A;  4MNK A;  2DPE A;  3MQG A;  2O92 A;  2WM0 A;  3ARR A;  3PA7 A;  5DEZ A;  1E6N A;  4GGQ A;  1FFR A;  1ZBV A;  1ZL1 A;  2DG4 A;  4R5E A;  4Z2K A;  4MSP A;  4R0X A;  3LUO A;  2XP6 A;  2DT2 A;  1ZU8 A;  3KAB A;  2MDI A;  1R9H A;  1J6Y A;  1FKF A;  4W9O A;  2E45 A;  2RSE A;  1BKF A;  2B31 A;  4Z2J A;  3NRK A;  3WL0 A;  3AS1 A;  1K9T A;  2XP8 A;  3KAI A;  3WD1 A;  1HXV A;  1D7I A;  4DRN A;  4GLX A;  1HJX A;  3O5J A;  3M7N A;  1FKG A;  1LQ0 A;  2XP3 A;  2M1I A;  4WJX A;  2KFW A;  4TNS A;  4S3J A;  1U79 A;  2KO7 A;  4DT4 A;  1QPL A;  3EY6 A;  1H0G A;  1RP5 A;  3WD4 A;  3MCB B;  1FKB A;  2RUD A;  3O5P A;  3ARS A;  2FKE A;  2YBT A;  4BF8 A;  4G50 A;  1GOI A;  5CQ2 A;  3OA5 A;  4MAV A;  4MGV A;  1FKT A;  2DSZ A;  1ROU A;  2A3A A;  2BA1 A;  1EIB A;  2M2A A;  1FKK A;  2DMV A;  1ROT A;  3B9A A;  1LL6 A;  1JVW A;  4S3K A;  1TR8 A;  1TK7 A;  3RM9 A;  3WQW A;  2RUR A;  5DO2 A;  1XRV A;  3MCB A;  3IHZ A;  1NWR A;  1NH6 A;  2QF8 A;  1BL4 A;  2LGO A;  3TC5 A;  1E6R A;  2PV1 A;  2DSV A;  3WD0 A;  3W4R A;  5HW7 A;  3PRA A;  4WKH A;  1EG3 A;  3AS0 A;  1HKM A;  2MF9 A;  3IKD A;  1HKJ A;  3WH0 A;  1HKK A;  3KAD A;  2KE0 A;  3KAF A;  1WB0 A;  2RQS A;  4P8V A;  1GUV A;  5E64 A;  1J4I A;  1W1T A;  4J4O A;  3LE4 A;  4MNM A;  4WK9 A;  3FSC A;  3O5E A;  4JFK A;  3WD2 A;  2OFN A;  3ARY A;  3IKG A;  2KR7 A;  1FKI A;  2ZR5 A;  5HKG A;  2ZQS A;  3FS8 A;  2DJY A;  2VN1 A;  1OGG A;  4A0T A;  2YSF A;  1I5H W;  4DWS B;  1LG2 A;  1OWQ A;  3O5O A;  3CGN A;  2MLX A;  1YAT A;  3G6M A;  3PRD A;  3RME A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...