2ITKA

Human pin1 bound to d-peptide
Total Genus 45
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
45
sequence length
157
structure length
145
Chain Sequence
LPPGWEKAMSRSSGRVYYFNHITNASQWERPSEPARVRCSHLLVKHSQSRRPSSWRQEKITRTKEEALELINGYIQKIKSGEEDFESLASQFSDCSSAKARGDLGAFSRGQMQKPFEDASFALRTGEMSGPVFTDSGIHIILRTE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Isomerase/isomerase inhibitor
molecule keywords Peptidyl-prolyl cis-trans isomerase NIMA-interacting 1
publication title Structural basis for high-affinity peptide inhibition of human Pin1.
pubmed doi rcsb
source organism Homo sapiens
total genus 45
structure length 145
sequence length 157
ec nomenclature ec 5.2.1.8: Peptidylprolyl isomerase.
pdb deposition date 2006-10-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00397 WW WW domain
A PF00639 Rotamase PPIC-type PPIASE domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.20.70.10 Mainly Beta Single Sheet Ubiquitin Ligase Nedd4; Chain: W; Ubiquitin Ligase Nedd4; Chain: W; 2itkA01
3.10.50.40 Alpha Beta Roll Chitinase A; domain 3 Chitinase A; domain 3 2itkA02
2XP4A 4DRHA 1JNTA 1FKSA 2ZR6A 1JVWA 4G2PA 2XP9A 3TC5A 1FKTA 2OFNA 4W9QA 1JNSA 3PRDA 4JFKA 4DRMA 3UQBA 2UZ5A 2M8IA 4ODRA 3UI5A 2KO7A 2M2AA 1ROUA 2IF4A 2RUCA 3NTPA 1FJDA 3ODKA 1Q1CA 2PPOA 2E45A 4G50A 4DRPA 2YSGA 1QZ2A 1A7XA 1J4RA 2JXWA 4JFJA 3M85A 3IKDA 3O5MA 3KCEA 3CGNA 2YSBA 2YSIA 3KAIA 5HTGA 2ZQVA 1Y0OA 2D9FA 2BA1A 3NRKA 4JFLA 5HW6A 2DG9A 4DT4A 2M08A 2LAJA 2XP8A 1QPLA 4TYOA 1JMQA 4DRNA 1EG4A 2LGOA 5D75A 4QT2A 4DROA 5HT1A 4FN2A 3UQAA 3O5OA 5CQ2A 1R9HA 1T11A 1FKDA 2JX8A 3O5DA 1F8AB 3O5IA 1QPFA 2ITKA 2F2DA 2MNTA 1NSGA 2YSFA 4IQCA 2MLYA 2MF9A 2XP7A 2AWGA 1FKKA 3IKGA 2KFWA 2PPNA 3O5PA 3UI4A 4J4OA 2DK7A 4JYSA 3GPKA 4E5RA 1C9HA 1NMWA 2DJYA 1J4HA 2XPBA 5DIVA 2KGJA 2PV1A 1D6OA 1FD9A 5HWBA 1D7IA 3IK8A 3UQIA 1YW5A 3L4HA 1J6YA 4QIBA 3NI6A 4U86A 4LAXA 2RUDA 3FAPA 4BF8A 3MDYB 2RE3A 2XP5A 2JMFA 1TCOC 2PPPA 1FKFA 2ZQUA 4DRIA 2RSEA 5J6EA 2KI3A 1Q6UA 5GPGA 3PRBA 4LAVA 1FKBA 4DRKA 4DZ2A 2K8IA 4TW7A 4LAWA 3KZ7A 4REXA 2LJ4A 2PBCA 4JFIA 1L1PA 1P5QA 3JXVA 1YATA 2KE0A 2ZAJA 1FKLA 3O5QA 3KAHA 3I6CA 1FKGA 3RFWA 1FKRA 5HW8A 1U79A 1J4IA 1O6WA 3OOBA 5HKGA 1N1AA 2RUQA 4U85A 3UI6A 1K9QA 2ZQTA 2N87A 2M1IA 2YSHA 4W9OA 4DZ3A 1I5HW 2JZVA 4DIPA 1FAPA 3JYMA 4R0XA 3KAGA 2MLZA 2ZR5A 4GIVA 2PV3A 1K9RA 4ODOA 5HW7A 1BKFA 4U84A 2KR7A 3VAWA 2DG3A 3H9RB 1WR7A 3KABA 2Q5AA 1TK7A 2RURA 3O5KA 4C02B 4DRJA 5I98A 3KADA 3TDBA 2RQSA 1EG3A 4W9PA 5DITA 2FAPA 2ZR4A 4IPXA 1BL4A 3UF8A 2PV2A 1D7HA 2ZQSA 4TX0A 1ROTA 1Q6IA 3O5FA 3CNGA 1PBKA 3O5JA 1D7JA 4JFMA 1Q6HA 4ODLA 2LPVA 5DIUA 3M7NA 1F40A 5AHTA 1KT1A 3CGMA 4ITZA 2VN1A 2F4EA 5B8IC 4GGQA 1B6CA 1HXVA 2DK1A 1FKIA 2DG4A 4TW8A 3RGCA 2Y78A 2F21A 3KAFA 3O5RA 3WH0A 3O5LA 1FKHA 1W26A 2VCDA 4QT3A 5HWCA 1WMVA 2M3OW 2LKNA 2MLXA 2L2SA 1PINA 3JYJA 4ODKA 1M5YA 2XPAA 4ODPA 4LAYA 3B7XA 4J4NA 3O5EA 5BXJA 4N19A 1KT0A 4ODQA 3TCZA 5HUAA 4ODMA 2XP3A 4FAPA 4DRQA 3KACA 1ZCNA 2EZ5W 4MSPA 1EQ3A 2MDIA 1NMVA 1EYMA 1FKJA 2MPHA 3O5GA 4MGVA 2DMVA 2KXQA 2L4JA 4TW6A 3IHZA 3LE4A 3LUOA 2DWVA 2FKEA 4O2TA 2XP6A 3PA7A 4DH0A 2M8JA 4TNSA 4ODNA 4IQ2A 3EY6A 1ZK6A 4NNRA 2JV4A
chains in the Genus database with same CATH superfamily
1HKMA 2XP4A 2OWOA 1ITXA 4DRHA 2PI6A 3MCBB 1JNTA 1FKSA 2ZR6A 1JVWA 4G2PA 3ARRA 1LL6A 3CHCA 4HBOA 2XP9A 3TC5A 1FKTA 4W5UA 2FDMA 2OFNA 1HKIA 2G41A 4W9QA 1JNSA 3QOKA 4KR0B 1W1TA 3PRDA 4JFKA 5DO2A 1ZBCA 4DRMA 1ZBVA 1XHGA 4MPKA 3UQBA 1NWUA 2UZ5A 2M8IA 1ZU8A 1LL4A 4ODRA 3UI5A 2KO7A 2M2AA 2AOSA 1ROUA 3FSBA 4R5EA 5E66A 2IF4A 2RUCA 3NTPA 1FJDA 1SYTA 3PQHA 1WB0A 3FXYA 3ODKA 1Q1CA 2PPOA 2E45A 4G50A 4DRPA 2YSGA 1ZB5A 1VF8A 1QZ2A 4ZPVR 4Z2KA 3FSCA 1A7XA 4URIA 1J4RA 4MAVA 2OLHA 2JXWA 1OGGA 3M85A 1E6NA 3IKDA 4HARA 4JFJA 1EHNA 3O5MA 3KCEA 3CGNA 2YSBA 2YSIA 3KAIA 3ARSA 5HTGA 2ZQVA 1Y0OA 4MNKA 1E9LA 2D9FA 2BA1A 3NRKA 4JFLA 5HW6A 2DG9A 4DT4A 2M08A 3GTYX 2LAJA 2XP8A 3ARYA 1LG2A 1QPLA 2DT3A 4TYOA 1JMQA 1XRVA 4DRNA 3ARVA 2EULA 1NWTA 1EG4A 2LGOA 4Z2LA 5D75A 4QT2A 4PTMA 5HT1A 4DROA 4FN2A 4L72B 3UQAA 3MCBA 3O5OA 1OWQA 1H0GA 5CQ2A 1R9HA 1T11A 1FKDA 5E64A 2JX8A 3O5DA 4NZCA 2DT0A 1F8AB 2ITKA 1QPFA 3O5IA 3GU0A 2A3EA 2F2DA 3CH9A 3RM4A 2MNTA 4LGXA 1NSGA 2IUZA 2YSFA 4IQCA 2MLYA 3LKXB 2DSWA 3OA5A 2MF9A 3AROA 2XP7A 1FFQA 2YAJB 2AWGA 2DSVA 1FKKA 3IKGA 2KFWA 4DWSD 2PPNA 1K9TA 3O5PA 1D2KA 3UI4A 4HBEA 4J4OA 2DK7A 4Z2GA 1KFWA 4JYSA 4MTVA 3GPKA 1LL7A 4E5RA 1C9HA 1NMWA 4IT6A 1GOIA 2DJYA 1J4HA 5E62A 2XPBA 5DIVA 2KGJA 3CHFA 3WD0A 2PV1A 3FS8A 1D6OA 1FD9A 2DSUA 2WLZA 1WAWA 5HWBA 4KQZA 1D7IA 3IK8A 3AQUA 2WADA 3UQIA 1ZBKA 3BXWA 4ZS6A 1YW5A 3L4HA 2WM0A 1J6YA 4QIBA 3NI6A 4U86A 1FFRA 1LQ0A 2Y8NB 3ARUA 4LAXA 1RP5A 1GUVA 4MNLA 2RUDA 1E6PA 3EIPA 3FAPA 4BF8A 3MDYB 2RE3A 2XP5A 2JMFA 1TCOC 2PPPA 1GRJA 1FKFA 4Z2JA 2ZQUA 4DRIA 3WKZA 3WIJA 2RSEA 5J6EA 2KI3A 1Q6UA 4MNMA 5GPGA 1HKJA 3PRBA 4LAVA 1FKBA 4DRKA 4DZ2A 2K8IA 4TW7A 4ZPTR 4LAWA 1E6ZA 4P8WA 5GQBA 4S3KA 3AS2A 4DWSB 1E6RA 3KZ7A 1HJVA 4REXA 1UR9A 2LJ4A 2PBCA 4JFIA 1L1PA 4QZVB 3B8SA 3LKXA 1P5QA 2WAEA 1GPFA 1LG1A 1UR8A 5GPRA 3JXVA 3WD2A 1YATA 2KE0A 2ZAJA 1FKLA 3O5QA 3KAHA 4Q22A 1TFVA 3AS3A 4WIWA 3I6CA 1FKGA 1W9UA 3RFWA 1W1VA 3RMEA 1FKRA 5HW8A 1U79A 1RD6A 2B31A 4AY1A 1J4IA 3AS0A 1JNEA 1O6WA 3OOBA 5HKGA 4WK9A 1N1AA 1ZL1A 1TR8A 2RUQA 4U85A 3PRAA 3UI6A 4Z2IA 3PR9A 4S3JA 3WD1A 1K9QA 2ZQTA 3ARWA 3BMBA 1HJXA 2N87A 2M1IA 3B9AA 2YSHA 4W9OA 4DZ3A 1E15A 4Q7NA 1I5HW 2ESCA 2JZVA 1FAPA 4DIPA 3ARTA 3JYMA 4R0XA 4WKAA 3KAGA 2MLZA 2ZR5A 4MNJA 4GIVA 2PV3A 1K9RA 3RM8A 3G6MA 1NH6A 2G8ZA 2A3BA 4DWSA 4ODOA 3MQHA 5HW7A 1BKFA 4U84A 5E65A 1EIBA 2DT1A 2KR7A 3VAWA 2PN0A 1O6IA 2DG3A 3H9RB 1W9PA 1WR7A 3KABA 1HKKA 3WQVA 2Q5AA 1TK7A 2RURA 3O5KA 4L3NA 1H0IA 2YBTA 4C02B 4DRJA 2DSZA 4GLXA 5I98A 3KADA 3RM9A 3TDBA 2RQSA 1EG3A 4W9PA 5DITA 2FAPA 3WD4A 1ZBWA 3ARXA 2ZR4A 4IPXA 1BL4A 3UF8A 4A0TA 4ML4A 3G6LA 1D7HA 2PV2A 2ZQSA 4TX0A 1ROTA 1Q6IA 3O5FA 3CNGA 1PBKA 3O5JA 5E5WA 5HBFA 1NWSA 1D7JA 3CHEA 1HJWA 4JFMA 1Q6HA 5U47A 4ODLA 2YBUA 3AS1A 4P8UA 3WL0A 4WKHA 4NSBA 2LPVA 4P8VA 3B9DA 1FLCA 1EDQA 3M7NA 5DIUA 4IT4A 1F40A 5AHTA 5JH8A 3ARQA 4Z2HA 1KT1A 4ZPWR 5DEZA 3CGMA 4ITZA 2VN1A 3CHDA 4UDMA 2F4EA 5B8IC 1E44A 3B9EA 1WNOA 4GGQA 1B6CA 2WLYA 1HXVA 2O9OA 3ALFA 2DK1A 1FKIA 2DG4A 4TW8A 3RGCA 3CZ8A 2WK2A 2P4VA 2Y78A 2F21A 3KAFA 3O5RA 3WH0A 3O5LA 1FKHA 1W1PA 1W26A 2VCDA 4QT3A 1W9VA 3WD3A 5HWCA 1WMVA 2M3OW 5DF0A 2LKNA 2MLXA 2ETNA 2L2SA 1PINA 3JYJA 4XAKA 2QRVA 1LJYA 1M5YA 4ODKA 2XPAA 4A0UA 4ODPA 4LAYA 1JCHB 3B7XA 4J4NA 4P8XA 3O5EA 5BXJA 4DWSC 1JNDA 1KT0A 4N19A 4ODQA 3TCZA 3FY1A 5HUAA 1X6NA 2DT2A 4ODMA 1SR0A 2XP3A 1W1YA 3ARPA 4FAPA 1IX5A 2O92A 4WJXA 3KACA 4DRQA 1ZCNA 2EZ5W 4MSPA 1EQ3A 2MDIA 1NMVA 1NWRA 1EYMA 1FKJA 1CTNA 3WL1A 2MPHA 3O5GA 4MGVA 3ALGA 2DMVA 2A3AA 2KXQA 3W4RA 2L4JA 4TW6A 3MQGA 1X6LA 3IHZA 2B5UB 3LE4A 4WKFA 3LUOA 2DWVA 3ARZA 2FKEA 4O2TA 2XP6A 3PA7A 4DH0A 2DPEA 2M8JA 2F23A 2A3CA 4TNSA 4ODNA 3WQWA 4IQ2A 1OGBA 3EY6A 1ZK6A 2QF8A 4NNRA 2JV4A
chains in the Genus database with same CATH topology
1HKMA 2XP4A 2OWOA 1ITXA 4DRHA 2PI6A 3MCBB 1JNTA 1FKSA 2ZR6A 1JVWA 4G2PA 3ARRA 1LL6A 3CHCA 4HBOA 2XP9A 3TC5A 1FKTA 4W5UA 2FDMA 2OFNA 1HKIA 2G41A 4W9QA 1JNSA 3QOKA 4KR0B 1W1TA 3PRDA 4JFKA 5DO2A 1ZBCA 4DRMA 1ZBVA 1XHGA 4MPKA 3UQBA 1NWUA 2UZ5A 2M8IA 1ZU8A 1LL4A 4ODRA 3UI5A 2KO7A 2M2AA 2AOSA 1ROUA 3FSBA 4R5EA 5E66A 2IF4A 2RUCA 3NTPA 1FJDA 1SYTA 3PQHA 1WB0A 3FXYA 3ODKA 1Q1CA 2PPOA 2E45A 4G50A 4DRPA 2YSGA 1ZB5A 1VF8A 1QZ2A 4ZPVR 4Z2KA 3FSCA 1A7XA 4URIA 1J4RA 4MAVA 2OLHA 2JXWA 1OGGA 3M85A 1E6NA 3IKDA 4HARA 4JFJA 1EHNA 3O5MA 3KCEA 3CGNA 2YSBA 2YSIA 3KAIA 3ARSA 5HTGA 2ZQVA 1Y0OA 4MNKA 1E9LA 2D9FA 2BA1A 3NRKA 4JFLA 5HW6A 2DG9A 4DT4A 2M08A 2LAJA 2XP8A 3ARYA 1LG2A 1QPLA 2DT3A 4TYOA 1JMQA 1XRVA 4DRNA 3ARVA 1NWTA 1EG4A 2LGOA 4Z2LA 5D75A 4QT2A 4PTMA 5HT1A 4DROA 4FN2A 4L72B 3UQAA 3MCBA 3O5OA 1OWQA 1H0GA 5CQ2A 1R9HA 1T11A 1FKDA 5E64A 2JX8A 3O5DA 4NZCA 2DT0A 1F8AB 2ITKA 1QPFA 3O5IA 2A3EA 2F2DA 3CH9A 3RM4A 2MNTA 4LGXA 1NSGA 2IUZA 2YSFA 4IQCA 2MLYA 3LKXB 2DSWA 3OA5A 2MF9A 3AROA 2XP7A 1FFQA 2YAJB 2AWGA 2DSVA 1FKKA 3IKGA 2KFWA 4DWSD 2PPNA 1K9TA 3O5PA 1D2KA 3UI4A 4HBEA 4J4OA 2DK7A 4Z2GA 1KFWA 4JYSA 4MTVA 3GPKA 1LL7A 4E5RA 1C9HA 1NMWA 4IT6A 1GOIA 2DJYA 1J4HA 5E62A 2XPBA 5DIVA 2KGJA 3CHFA 3WD0A 2PV1A 3FS8A 1D6OA 1FD9A 2DSUA 2WLZA 1WAWA 5HWBA 4KQZA 1D7IA 3IK8A 3AQUA 2WADA 3UQIA 1ZBKA 3BXWA 4ZS6A 1YW5A 3L4HA 2WM0A 1J6YA 4QIBA 3NI6A 4U86A 1FFRA 1LQ0A 2Y8NB 3ARUA 4LAXA 1RP5A 1GUVA 4MNLA 2RUDA 1E6PA 3FAPA 4BF8A 3MDYB 2RE3A 2XP5A 2JMFA 1TCOC 2PPPA 1FKFA 4Z2JA 2ZQUA 4DRIA 3WKZA 3WIJA 2RSEA 5J6EA 2KI3A 1Q6UA 4MNMA 5GPGA 1HKJA 3PRBA 4LAVA 1FKBA 4DRKA 4DZ2A 2K8IA 4TW7A 4ZPTR 4LAWA 1E6ZA 4P8WA 5GQBA 4S3KA 3AS2A 4DWSB 1E6RA 3KZ7A 1HJVA 4REXA 1UR9A 2LJ4A 2PBCA 4JFIA 1L1PA 4QZVB 3B8SA 3LKXA 1P5QA 2WAEA 1GPFA 1LG1A 1UR8A 5GPRA 3JXVA 3WD2A 1YATA 2KE0A 2ZAJA 1FKLA 3O5QA 3KAHA 4Q22A 1TFVA 3AS3A 4WIWA 3I6CA 1FKGA 1W9UA 3RFWA 1W1VA 3RMEA 1FKRA 5HW8A 1U79A 1RD6A 2B31A 4AY1A 1J4IA 3AS0A 1JNEA 1O6WA 3OOBA 5HKGA 4WK9A 1N1AA 1ZL1A 1TR8A 2RUQA 4U85A 3PRAA 3UI6A 4Z2IA 3PR9A 4S3JA 3WD1A 1K9QA 2ZQTA 3ARWA 1HJXA 2N87A 2M1IA 3B9AA 2YSHA 4W9OA 4DZ3A 1E15A 4Q7NA 1I5HW 2ESCA 2JZVA 1FAPA 4DIPA 3ARTA 3JYMA 4R0XA 4WKAA 3KAGA 2MLZA 2ZR5A 4MNJA 4GIVA 2PV3A 1K9RA 3RM8A 3G6MA 1NH6A 2G8ZA 2A3BA 4DWSA 4ODOA 3MQHA 5HW7A 1BKFA 4U84A 5E65A 1EIBA 2DT1A 2KR7A 3VAWA 1O6IA 2DG3A 3H9RB 1W9PA 1WR7A 3KABA 1HKKA 3WQVA 2Q5AA 1TK7A 2RURA 3O5KA 4L3NA 1H0IA 2YBTA 4C02B 4DRJA 2DSZA 4GLXA 5I98A 3KADA 3RM9A 3TDBA 2RQSA 1EG3A 4W9PA 5DITA 2FAPA 3WD4A 1ZBWA 3ARXA 2ZR4A 4IPXA 1BL4A 3UF8A 4A0TA 4ML4A 3G6LA 2PV2A 1D7HA 2ZQSA 4TX0A 1ROTA 1Q6IA 3O5FA 3CNGA 1PBKA 3O5JA 5E5WA 5HBFA 1NWSA 1D7JA 3CHEA 1HJWA 4JFMA 1Q6HA 5U47A 4ODLA 2YBUA 3AS1A 4P8UA 3WL0A 4WKHA 4NSBA 2LPVA 4P8VA 3B9DA 1FLCA 1EDQA 3M7NA 5DIUA 4IT4A 1F40A 5AHTA 5JH8A 3ARQA 4Z2HA 1KT1A 4ZPWR 5DEZA 3CGMA 4ITZA 2VN1A 3CHDA 2F4EA 5B8IC 3B9EA 1WNOA 4GGQA 1B6CA 2WLYA 1HXVA 2O9OA 3ALFA 2DK1A 1FKIA 2DG4A 4TW8A 3RGCA 3CZ8A 2WK2A 2Y78A 2F21A 3KAFA 3O5RA 3WH0A 3O5LA 1FKHA 1W1PA 1W26A 2VCDA 4QT3A 1W9VA 3WD3A 5HWCA 1WMVA 2M3OW 5DF0A 2LKNA 2MLXA 2L2SA 1PINA 3JYJA 4XAKA 2QRVA 1LJYA 1M5YA 4ODKA 2XPAA 4A0UA 4ODPA 4LAYA 3B7XA 4J4NA 4P8XA 3O5EA 5BXJA 4DWSC 1JNDA 1KT0A 4N19A 4ODQA 3TCZA 3FY1A 5HUAA 1X6NA 2DT2A 4ODMA 1SR0A 2XP3A 1W1YA 3ARPA 4FAPA 1IX5A 2O92A 4WJXA 3KACA 4DRQA 1ZCNA 2EZ5W 4MSPA 1EQ3A 2MDIA 1NMVA 1NWRA 1EYMA 1FKJA 1CTNA 3WL1A 2MPHA 3O5GA 4MGVA 3ALGA 2DMVA 2A3AA 2KXQA 3W4RA 2L4JA 4TW6A 3MQGA 1X6LA 3IHZA 3LE4A 4WKFA 3LUOA 2DWVA 3ARZA 2FKEA 4O2TA 2XP6A 3PA7A 4DH0A 2DPEA 2M8JA 2A3CA 4TNSA 4ODNA 3WQWA 4IQ2A 1OGBA 3EY6A 1ZK6A 2QF8A 4NNRA 2JV4A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2XP4 A;  4DRH A;  1JNT A;  1FKS A;  2ZR6 A;  1JVW A;  4G2P A;  2XP9 A;  3TC5 A;  1FKT A;  2OFN A;  4W9Q A;  1JNS A;  3PRD A;  4JFK A;  4DRM A;  3UQB A;  2UZ5 A;  2M8I A;  4ODR A;  3UI5 A;  2KO7 A;  2M2A A;  1ROU A;  2IF4 A;  2RUC A;  3NTP A;  1FJD A;  3ODK A;  1Q1C A;  2PPO A;  2E45 A;  4G50 A;  4DRP A;  2YSG A;  1QZ2 A;  1A7X A;  1J4R A;  2JXW A;  4JFJ A;  3M85 A;  3IKD A;  3O5M A;  3KCE A;  3CGN A;  2YSB A;  2YSI A;  3KAI A;  5HTG A;  2ZQV A;  1Y0O A;  2D9F A;  2BA1 A;  3NRK A;  4JFL A;  5HW6 A;  2DG9 A;  4DT4 A;  2M08 A;  2LAJ A;  2XP8 A;  1QPL A;  4TYO A;  1JMQ A;  4DRN A;  1EG4 A;  2LGO A;  5D75 A;  4QT2 A;  4DRO A;  5HT1 A;  4FN2 A;  3UQA A;  3O5O A;  5CQ2 A;  1R9H A;  1T11 A;  1FKD A;  2JX8 A;  3O5D A;  1F8A B;  3O5I A;  1QPF A;  2ITK A;  2F2D A;  2MNT A;  1NSG A;  2YSF A;  4IQC A;  2MLY A;  2MF9 A;  2XP7 A;  2AWG A;  1FKK A;  3IKG A;  2KFW A;  2PPN A;  3O5P A;  3UI4 A;  4J4O A;  2DK7 A;  4JYS A;  3GPK A;  4E5R A;  1C9H A;  1NMW A;  2DJY A;  1J4H A;  2XPB A;  5DIV A;  2KGJ A;  2PV1 A;  1D6O A;  1FD9 A;  5HWB A;  1D7I A;  3IK8 A;  3UQI A;  1YW5 A;  3L4H A;  1J6Y A;  4QIB A;  3NI6 A;  4U86 A;  4LAX A;  2RUD A;  3FAP A;  4BF8 A;  3MDY B;  2RE3 A;  2XP5 A;  2JMF A;  1TCO C;  2PPP A;  1FKF A;  2ZQU A;  4DRI A;  2RSE A;  5J6E A;  2KI3 A;  1Q6U A;  5GPG A;  3PRB A;  4LAV A;  1FKB A;  4DRK A;  4DZ2 A;  2K8I A;  4TW7 A;  4LAW A;  3KZ7 A;  4REX A;  2LJ4 A;  2PBC A;  4JFI A;  1L1P A;  1P5Q A;  3JXV A;  1YAT A;  2KE0 A;  2ZAJ A;  1FKL A;  3O5Q A;  3KAH A;  3I6C A;  1FKG A;  3RFW A;  1FKR A;  5HW8 A;  1U79 A;  1J4I A;  1O6W A;  3OOB A;  5HKG A;  1N1A A;  2RUQ A;  4U85 A;  3UI6 A;  1K9Q A;  2ZQT A;  2N87 A;  2M1I A;  2YSH A;  4W9O A;  4DZ3 A;  1I5H W;  2JZV A;  4DIP A;  1FAP A;  3JYM A;  4R0X A;  3KAG A;  2MLZ A;  2ZR5 A;  4GIV A;  2PV3 A;  1K9R A;  4ODO A;  5HW7 A;  1BKF A;  4U84 A;  2KR7 A;  3VAW A;  2DG3 A;  3H9R B;  1WR7 A;  3KAB A;  2Q5A A;  1TK7 A;  2RUR A;  3O5K A;  4C02 B;  4DRJ A;  5I98 A;  3KAD A;  3TDB A;  2RQS A;  1EG3 A;  4W9P A;  5DIT A;  2FAP A;  2ZR4 A;  4IPX A;  1BL4 A;  3UF8 A;  2PV2 A;  1D7H A;  2ZQS A;  4TX0 A;  1ROT A;  1Q6I A;  3O5F A;  3CNG A;  1PBK A;  3O5J A;  1D7J A;  4JFM A;  1Q6H A;  4ODL A;  2LPV A;  5DIU A;  3M7N A;  1F40 A;  5AHT A;  1KT1 A;  3CGM A;  4ITZ A;  2VN1 A;  2F4E A;  5B8I C;  4GGQ A;  1B6C A;  1HXV A;  2DK1 A;  1FKI A;  2DG4 A;  4TW8 A;  3RGC A;  2Y78 A;  2F21 A;  3KAF A;  3O5R A;  3WH0 A;  3O5L A;  1FKH A;  1W26 A;  2VCD A;  4QT3 A;  5HWC A;  1WMV A;  2M3O W;  2LKN A;  2MLX A;  2L2S A;  1PIN A;  3JYJ A;  4ODK A;  1M5Y A;  2XPA A;  4ODP A;  4LAY A;  3B7X A;  4J4N A;  3O5E A;  5BXJ A;  4N19 A;  1KT0 A;  4ODQ A;  3TCZ A;  5HUA A;  4ODM A;  2XP3 A;  4FAP A;  4DRQ A;  3KAC A;  1ZCN A;  2EZ5 W;  4MSP A;  1EQ3 A;  2MDI A;  1NMV A;  1EYM A;  1FKJ A;  2MPH A;  3O5G A;  4MGV A;  2DMV A;  2KXQ A;  2L4J A;  4TW6 A;  3IHZ A;  3LE4 A;  3LUO A;  2DWV A;  2FKE A;  4O2T A;  2XP6 A;  3PA7 A;  4DH0 A;  2M8J A;  4TNS A;  4ODN A;  4IQ2 A;  3EY6 A;  1ZK6 A;  4NNR A;  2JV4 A; 
#chains in the Genus database with same CATH topology
 1HKM A;  2XP4 A;  2OWO A;  1ITX A;  4DRH A;  2PI6 A;  3MCB B;  1JNT A;  1FKS A;  2ZR6 A;  1JVW A;  4G2P A;  3ARR A;  1LL6 A;  3CHC A;  4HBO A;  2XP9 A;  3TC5 A;  1FKT A;  4W5U A;  2FDM A;  2OFN A;  1HKI A;  2G41 A;  4W9Q A;  1JNS A;  3QOK A;  4KR0 B;  1W1T A;  3PRD A;  4JFK A;  5DO2 A;  1ZBC A;  4DRM A;  1ZBV A;  1XHG A;  4MPK A;  3UQB A;  1NWU A;  2UZ5 A;  2M8I A;  1ZU8 A;  1LL4 A;  4ODR A;  3UI5 A;  2KO7 A;  2M2A A;  2AOS A;  1ROU A;  3FSB A;  4R5E A;  5E66 A;  2IF4 A;  2RUC A;  3NTP A;  1FJD A;  1SYT A;  3PQH A;  1WB0 A;  3FXY A;  3ODK A;  1Q1C A;  2PPO A;  2E45 A;  4G50 A;  4DRP A;  2YSG A;  1ZB5 A;  1VF8 A;  1QZ2 A;  4ZPV R;  4Z2K A;  3FSC A;  1A7X A;  4URI A;  1J4R A;  4MAV A;  2OLH A;  2JXW A;  1OGG A;  3M85 A;  1E6N A;  3IKD A;  4HAR A;  4JFJ A;  1EHN A;  3O5M A;  3KCE A;  3CGN A;  2YSB A;  2YSI A;  3KAI A;  3ARS A;  5HTG A;  2ZQV A;  1Y0O A;  4MNK A;  1E9L A;  2D9F A;  2BA1 A;  3NRK A;  4JFL A;  5HW6 A;  2DG9 A;  4DT4 A;  2M08 A;  3GTY X;  2LAJ A;  2XP8 A;  3ARY A;  1LG2 A;  1QPL A;  2DT3 A;  4TYO A;  1JMQ A;  1XRV A;  4DRN A;  3ARV A;  2EUL A;  1NWT A;  1EG4 A;  2LGO A;  4Z2L A;  5D75 A;  4QT2 A;  4PTM A;  5HT1 A;  4DRO A;  4FN2 A;  4L72 B;  3UQA A;  3MCB A;  3O5O A;  1OWQ A;  1H0G A;  5CQ2 A;  1R9H A;  1T11 A;  1FKD A;  5E64 A;  2JX8 A;  3O5D A;  4NZC A;  2DT0 A;  1F8A B;  2ITK A;  1QPF A;  3O5I A;  3GU0 A;  2A3E A;  2F2D A;  3CH9 A;  3RM4 A;  2MNT A;  4LGX A;  1NSG A;  2IUZ A;  2YSF A;  4IQC A;  2MLY A;  3LKX B;  2DSW A;  3OA5 A;  2MF9 A;  3ARO A;  2XP7 A;  1FFQ A;  2YAJ B;  2AWG A;  2DSV A;  1FKK A;  3IKG A;  2KFW A;  4DWS D;  2PPN A;  1K9T A;  3O5P A;  1D2K A;  3UI4 A;  4HBE A;  4J4O A;  2DK7 A;  4Z2G A;  1KFW A;  4JYS A;  4MTV A;  3GPK A;  1LL7 A;  4E5R A;  1C9H A;  1NMW A;  4IT6 A;  1GOI A;  2DJY A;  1J4H A;  5E62 A;  2XPB A;  5DIV A;  2KGJ A;  3CHF A;  3WD0 A;  2PV1 A;  3FS8 A;  1D6O A;  1FD9 A;  2DSU A;  2WLZ A;  1WAW A;  5HWB A;  4KQZ A;  1D7I A;  3IK8 A;  3AQU A;  2WAD A;  3UQI A;  1ZBK A;  3BXW A;  4ZS6 A;  1YW5 A;  3L4H A;  2WM0 A;  1J6Y A;  4QIB A;  3NI6 A;  4U86 A;  1FFR A;  1LQ0 A;  2Y8N B;  3ARU A;  4LAX A;  1RP5 A;  1GUV A;  4MNL A;  2RUD A;  1E6P A;  3EIP A;  3FAP A;  4BF8 A;  3MDY B;  2RE3 A;  2XP5 A;  2JMF A;  1TCO C;  2PPP A;  1GRJ A;  1FKF A;  4Z2J A;  2ZQU A;  4DRI A;  3WKZ A;  3WIJ A;  2RSE A;  5J6E A;  2KI3 A;  1Q6U A;  4MNM A;  5GPG A;  1HKJ A;  3PRB A;  4LAV A;  1FKB A;  4DRK A;  4DZ2 A;  2K8I A;  4TW7 A;  4ZPT R;  4LAW A;  1E6Z A;  4P8W A;  5GQB A;  4S3K A;  3AS2 A;  4DWS B;  1E6R A;  3KZ7 A;  1HJV A;  4REX A;  1UR9 A;  2LJ4 A;  2PBC A;  4JFI A;  1L1P A;  4QZV B;  3B8S A;  3LKX A;  1P5Q A;  2WAE A;  1GPF A;  1LG1 A;  1UR8 A;  5GPR A;  3JXV A;  3WD2 A;  1YAT A;  2KE0 A;  2ZAJ A;  1FKL A;  3O5Q A;  3KAH A;  4Q22 A;  1TFV A;  3AS3 A;  4WIW A;  3I6C A;  1FKG A;  1W9U A;  3RFW A;  1W1V A;  3RME A;  1FKR A;  5HW8 A;  1U79 A;  1RD6 A;  2B31 A;  4AY1 A;  1J4I A;  3AS0 A;  1JNE A;  1O6W A;  3OOB A;  5HKG A;  4WK9 A;  1N1A A;  1ZL1 A;  1TR8 A;  2RUQ A;  4U85 A;  3PRA A;  3UI6 A;  4Z2I A;  3PR9 A;  4S3J A;  3WD1 A;  1K9Q A;  2ZQT A;  3ARW A;  3BMB A;  1HJX A;  2N87 A;  2M1I A;  3B9A A;  2YSH A;  4W9O A;  4DZ3 A;  1E15 A;  4Q7N A;  1I5H W;  2ESC A;  2JZV A;  1FAP A;  4DIP A;  3ART A;  3JYM A;  4R0X A;  4WKA A;  3KAG A;  2MLZ A;  2ZR5 A;  4MNJ A;  4GIV A;  2PV3 A;  1K9R A;  3RM8 A;  3G6M A;  1NH6 A;  2G8Z A;  2A3B A;  4DWS A;  4ODO A;  3MQH A;  5HW7 A;  1BKF A;  4U84 A;  5E65 A;  1EIB A;  2DT1 A;  2KR7 A;  3VAW A;  2PN0 A;  1O6I A;  2DG3 A;  3H9R B;  1W9P A;  1WR7 A;  3KAB A;  1HKK A;  3WQV A;  2Q5A A;  1TK7 A;  2RUR A;  3O5K A;  4L3N A;  1H0I A;  2YBT A;  4C02 B;  4DRJ A;  2DSZ A;  4GLX A;  5I98 A;  3KAD A;  3RM9 A;  3TDB A;  2RQS A;  1EG3 A;  4W9P A;  5DIT A;  2FAP A;  3WD4 A;  1ZBW A;  3ARX A;  2ZR4 A;  4IPX A;  1BL4 A;  3UF8 A;  4A0T A;  4ML4 A;  3G6L A;  1D7H A;  2PV2 A;  2ZQS A;  4TX0 A;  1ROT A;  1Q6I A;  3O5F A;  3CNG A;  1PBK A;  3O5J A;  5E5W A;  5HBF A;  1NWS A;  1D7J A;  3CHE A;  1HJW A;  4JFM A;  1Q6H A;  5U47 A;  4ODL A;  2YBU A;  3AS1 A;  4P8U A;  3WL0 A;  4WKH A;  4NSB A;  2LPV A;  4P8V A;  3B9D A;  1FLC A;  1EDQ A;  3M7N A;  5DIU A;  4IT4 A;  1F40 A;  5AHT A;  5JH8 A;  3ARQ A;  4Z2H A;  1KT1 A;  4ZPW R;  5DEZ A;  3CGM A;  4ITZ A;  2VN1 A;  3CHD A;  4UDM A;  2F4E A;  5B8I C;  1E44 A;  3B9E A;  1WNO A;  4GGQ A;  1B6C A;  2WLY A;  1HXV A;  2O9O A;  3ALF A;  2DK1 A;  1FKI A;  2DG4 A;  4TW8 A;  3RGC A;  3CZ8 A;  2WK2 A;  2P4V A;  2Y78 A;  2F21 A;  3KAF A;  3O5R A;  3WH0 A;  3O5L A;  1FKH A;  1W1P A;  1W26 A;  2VCD A;  4QT3 A;  1W9V A;  3WD3 A;  5HWC A;  1WMV A;  2M3O W;  5DF0 A;  2LKN A;  2MLX A;  2ETN A;  2L2S A;  1PIN A;  3JYJ A;  4XAK A;  2QRV A;  1LJY A;  1M5Y A;  4ODK A;  2XPA A;  4A0U A;  4ODP A;  4LAY A;  1JCH B;  3B7X A;  4J4N A;  4P8X A;  3O5E A;  5BXJ A;  4DWS C;  1JND A;  1KT0 A;  4N19 A;  4ODQ A;  3TCZ A;  3FY1 A;  5HUA A;  1X6N A;  2DT2 A;  4ODM A;  1SR0 A;  2XP3 A;  1W1Y A;  3ARP A;  4FAP A;  1IX5 A;  2O92 A;  4WJX A;  3KAC A;  4DRQ A;  1ZCN A;  2EZ5 W;  4MSP A;  1EQ3 A;  2MDI A;  1NMV A;  1NWR A;  1EYM A;  1FKJ A;  1CTN A;  3WL1 A;  2MPH A;  3O5G A;  4MGV A;  3ALG A;  2DMV A;  2A3A A;  2KXQ A;  3W4R A;  2L4J A;  4TW6 A;  3MQG A;  1X6L A;  3IHZ A;  2B5U B;  3LE4 A;  4WKF A;  3LUO A;  2DWV A;  3ARZ A;  2FKE A;  4O2T A;  2XP6 A;  3PA7 A;  4DH0 A;  2DPE A;  2M8J A;  2F23 A;  2A3C A;  4TNS A;  4ODN A;  3WQW A;  4IQ2 A;  1OGB A;  3EY6 A;  1ZK6 A;  2QF8 A;  4NNR A;  2JV4 A; 
#chains in the Genus database with same CATH homology
 1HKM A;  2XP4 A;  2OWO A;  1ITX A;  4DRH A;  2PI6 A;  3MCB B;  1JNT A;  1FKS A;  2ZR6 A;  1JVW A;  4G2P A;  3ARR A;  1LL6 A;  3CHC A;  4HBO A;  2XP9 A;  3TC5 A;  1FKT A;  4W5U A;  2FDM A;  2OFN A;  1HKI A;  2G41 A;  4W9Q A;  1JNS A;  3QOK A;  4KR0 B;  1W1T A;  3PRD A;  4JFK A;  5DO2 A;  1ZBC A;  4DRM A;  1ZBV A;  1XHG A;  4MPK A;  3UQB A;  1NWU A;  2UZ5 A;  2M8I A;  1ZU8 A;  1LL4 A;  4ODR A;  3UI5 A;  2KO7 A;  2M2A A;  2AOS A;  1ROU A;  3FSB A;  4R5E A;  5E66 A;  2IF4 A;  2RUC A;  3NTP A;  1FJD A;  1SYT A;  3PQH A;  1WB0 A;  3FXY A;  3ODK A;  1Q1C A;  2PPO A;  2E45 A;  4G50 A;  4DRP A;  2YSG A;  1ZB5 A;  1VF8 A;  1QZ2 A;  4ZPV R;  4Z2K A;  3FSC A;  1A7X A;  4URI A;  1J4R A;  4MAV A;  2OLH A;  2JXW A;  1OGG A;  3M85 A;  1E6N A;  3IKD A;  4HAR A;  4JFJ A;  1EHN A;  3O5M A;  3KCE A;  3CGN A;  2YSB A;  2YSI A;  3KAI A;  3ARS A;  5HTG A;  2ZQV A;  1Y0O A;  4MNK A;  1E9L A;  2D9F A;  2BA1 A;  3NRK A;  4JFL A;  5HW6 A;  2DG9 A;  4DT4 A;  2M08 A;  2LAJ A;  2XP8 A;  3ARY A;  1LG2 A;  1QPL A;  2DT3 A;  4TYO A;  1JMQ A;  1XRV A;  4DRN A;  3ARV A;  1NWT A;  1EG4 A;  2LGO A;  4Z2L A;  5D75 A;  4QT2 A;  4PTM A;  5HT1 A;  4DRO A;  4FN2 A;  4L72 B;  3UQA A;  3MCB A;  3O5O A;  1OWQ A;  1H0G A;  5CQ2 A;  1R9H A;  1T11 A;  1FKD A;  5E64 A;  2JX8 A;  3O5D A;  4NZC A;  2DT0 A;  1F8A B;  2ITK A;  1QPF A;  3O5I A;  2A3E A;  2F2D A;  3CH9 A;  3RM4 A;  2MNT A;  4LGX A;  1NSG A;  2IUZ A;  2YSF A;  4IQC A;  2MLY A;  3LKX B;  2DSW A;  3OA5 A;  2MF9 A;  3ARO A;  2XP7 A;  1FFQ A;  2YAJ B;  2AWG A;  2DSV A;  1FKK A;  3IKG A;  2KFW A;  4DWS D;  2PPN A;  1K9T A;  3O5P A;  1D2K A;  3UI4 A;  4HBE A;  4J4O A;  2DK7 A;  4Z2G A;  1KFW A;  4JYS A;  4MTV A;  3GPK A;  1LL7 A;  4E5R A;  1C9H A;  1NMW A;  4IT6 A;  1GOI A;  2DJY A;  1J4H A;  5E62 A;  2XPB A;  5DIV A;  2KGJ A;  3CHF A;  3WD0 A;  2PV1 A;  3FS8 A;  1D6O A;  1FD9 A;  2DSU A;  2WLZ A;  1WAW A;  5HWB A;  4KQZ A;  1D7I A;  3IK8 A;  3AQU A;  2WAD A;  3UQI A;  1ZBK A;  3BXW A;  4ZS6 A;  1YW5 A;  3L4H A;  2WM0 A;  1J6Y A;  4QIB A;  3NI6 A;  4U86 A;  1FFR A;  1LQ0 A;  2Y8N B;  3ARU A;  4LAX A;  1RP5 A;  1GUV A;  4MNL A;  2RUD A;  1E6P A;  3FAP A;  4BF8 A;  3MDY B;  2RE3 A;  2XP5 A;  2JMF A;  1TCO C;  2PPP A;  1FKF A;  4Z2J A;  2ZQU A;  4DRI A;  3WKZ A;  3WIJ A;  2RSE A;  5J6E A;  2KI3 A;  1Q6U A;  4MNM A;  5GPG A;  1HKJ A;  3PRB A;  4LAV A;  1FKB A;  4DRK A;  4DZ2 A;  2K8I A;  4TW7 A;  4ZPT R;  4LAW A;  1E6Z A;  4P8W A;  5GQB A;  4S3K A;  3AS2 A;  4DWS B;  1E6R A;  3KZ7 A;  1HJV A;  4REX A;  1UR9 A;  2LJ4 A;  2PBC A;  4JFI A;  1L1P A;  4QZV B;  3B8S A;  3LKX A;  1P5Q A;  2WAE A;  1GPF A;  1LG1 A;  1UR8 A;  5GPR A;  3JXV A;  3WD2 A;  1YAT A;  2KE0 A;  2ZAJ A;  1FKL A;  3O5Q A;  3KAH A;  4Q22 A;  1TFV A;  3AS3 A;  4WIW A;  3I6C A;  1FKG A;  1W9U A;  3RFW A;  1W1V A;  3RME A;  1FKR A;  5HW8 A;  1U79 A;  1RD6 A;  2B31 A;  4AY1 A;  1J4I A;  3AS0 A;  1JNE A;  1O6W A;  3OOB A;  5HKG A;  4WK9 A;  1N1A A;  1ZL1 A;  1TR8 A;  2RUQ A;  4U85 A;  3PRA A;  3UI6 A;  4Z2I A;  3PR9 A;  4S3J A;  3WD1 A;  1K9Q A;  2ZQT A;  3ARW A;  1HJX A;  2N87 A;  2M1I A;  3B9A A;  2YSH A;  4W9O A;  4DZ3 A;  1E15 A;  4Q7N A;  1I5H W;  2ESC A;  2JZV A;  1FAP A;  4DIP A;  3ART A;  3JYM A;  4R0X A;  4WKA A;  3KAG A;  2MLZ A;  2ZR5 A;  4MNJ A;  4GIV A;  2PV3 A;  1K9R A;  3RM8 A;  3G6M A;  1NH6 A;  2G8Z A;  2A3B A;  4DWS A;  4ODO A;  3MQH A;  5HW7 A;  1BKF A;  4U84 A;  5E65 A;  1EIB A;  2DT1 A;  2KR7 A;  3VAW A;  1O6I A;  2DG3 A;  3H9R B;  1W9P A;  1WR7 A;  3KAB A;  1HKK A;  3WQV A;  2Q5A A;  1TK7 A;  2RUR A;  3O5K A;  4L3N A;  1H0I A;  2YBT A;  4C02 B;  4DRJ A;  2DSZ A;  4GLX A;  5I98 A;  3KAD A;  3RM9 A;  3TDB A;  2RQS A;  1EG3 A;  4W9P A;  5DIT A;  2FAP A;  3WD4 A;  1ZBW A;  3ARX A;  2ZR4 A;  4IPX A;  1BL4 A;  3UF8 A;  4A0T A;  4ML4 A;  3G6L A;  2PV2 A;  1D7H A;  2ZQS A;  4TX0 A;  1ROT A;  1Q6I A;  3O5F A;  3CNG A;  1PBK A;  3O5J A;  5E5W A;  5HBF A;  1NWS A;  1D7J A;  3CHE A;  1HJW A;  4JFM A;  1Q6H A;  5U47 A;  4ODL A;  2YBU A;  3AS1 A;  4P8U A;  3WL0 A;  4WKH A;  4NSB A;  2LPV A;  4P8V A;  3B9D A;  1FLC A;  1EDQ A;  3M7N A;  5DIU A;  4IT4 A;  1F40 A;  5AHT A;  5JH8 A;  3ARQ A;  4Z2H A;  1KT1 A;  4ZPW R;  5DEZ A;  3CGM A;  4ITZ A;  2VN1 A;  3CHD A;  2F4E A;  5B8I C;  3B9E A;  1WNO A;  4GGQ A;  1B6C A;  2WLY A;  1HXV A;  2O9O A;  3ALF A;  2DK1 A;  1FKI A;  2DG4 A;  4TW8 A;  3RGC A;  3CZ8 A;  2WK2 A;  2Y78 A;  2F21 A;  3KAF A;  3O5R A;  3WH0 A;  3O5L A;  1FKH A;  1W1P A;  1W26 A;  2VCD A;  4QT3 A;  1W9V A;  3WD3 A;  5HWC A;  1WMV A;  2M3O W;  5DF0 A;  2LKN A;  2MLX A;  2L2S A;  1PIN A;  3JYJ A;  4XAK A;  2QRV A;  1LJY A;  1M5Y A;  4ODK A;  2XPA A;  4A0U A;  4ODP A;  4LAY A;  3B7X A;  4J4N A;  4P8X A;  3O5E A;  5BXJ A;  4DWS C;  1JND A;  1KT0 A;  4N19 A;  4ODQ A;  3TCZ A;  3FY1 A;  5HUA A;  1X6N A;  2DT2 A;  4ODM A;  1SR0 A;  2XP3 A;  1W1Y A;  3ARP A;  4FAP A;  1IX5 A;  2O92 A;  4WJX A;  3KAC A;  4DRQ A;  1ZCN A;  2EZ5 W;  4MSP A;  1EQ3 A;  2MDI A;  1NMV A;  1NWR A;  1EYM A;  1FKJ A;  1CTN A;  3WL1 A;  2MPH A;  3O5G A;  4MGV A;  3ALG A;  2DMV A;  2A3A A;  2KXQ A;  3W4R A;  2L4J A;  4TW6 A;  3MQG A;  1X6L A;  3IHZ A;  3LE4 A;  4WKF A;  3LUO A;  2DWV A;  3ARZ A;  2FKE A;  4O2T A;  2XP6 A;  3PA7 A;  4DH0 A;  2DPE A;  2M8J A;  2A3C A;  4TNS A;  4ODN A;  3WQW A;  4IQ2 A;  1OGB A;  3EY6 A;  1ZK6 A;  2QF8 A;  4NNR A;  2JV4 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...