2ITKA

Human pin1 bound to d-peptide
Total Genus 45
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
45
sequence length
157
structure length
145
Chain Sequence
LPPGWEKAMSRSSGRVYYFNHITNASQWERPSEPARVRCSHLLVKHSQSRRPSSWRQEKITRTKEEALELINGYIQKIKSGEEDFESLASQFSDCSSAKARGDLGAFSRGQMQKPFEDASFALRTGEMSGPVFTDSGIHIILRTE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural basis for high-affinity peptide inhibition of human Pin1.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Isomerase/isomerase inhibitor
molecule keywords Peptidyl-prolyl cis-trans isomerase NIMA-interacting 1
total genus 45
structure length 145
sequence length 157
ec nomenclature ec 5.2.1.8: Peptidylprolyl isomerase.
pdb deposition date 2006-10-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00397 WW WW domain
A PF00639 Rotamase PPIC-type PPIASE domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.20.70.10 Mainly Beta Single Sheet Ubiquitin Ligase Nedd4; Chain: W; Ubiquitin Ligase Nedd4; Chain: W; 2itkA01
3.10.50.40 Alpha Beta Roll Chitinase A; domain 3 Chitinase A; domain 3 2itkA02
4IQ2A 4DROA 2ZQUA 2BA1A 1FKDA 3IKGA 4LAWA 2YSIA 3WH0A 4JFLA 3UQAA 1O6WA 4GGQA 5I98A 1FKBA 3B7XA 2XP8A 1Q6HA 2DG3A 2VN1A 2RUCA 4G2PA 3VAWA 1K9RA 2DK7A 2L4JA 1ZK6A 3O5FA 2MF9A 2XPBA 1QZ2A 2LPVA 1L1PA 3KAFA 1R9HA 5HWCA 1KT1A 3LUOA 2ZR5A 4DRIA 3TC5A 4TW6A 1Q1CA 2KXQA 1F8AB 3GPKA 4ODQA 4ITZA 4JYSA 2YSFA 3KAHA 4MSPA 1JMQA 4LAVA 3O5RA 3KCEA 1FKLA 3IKDA 1JNTA 3O5KA 1N1AA 3O5EA 1U79A 5DIUA 3O5LA 1Q6IA 1FD9A 3KABA 2ZR6A 4QT3A 3RGCA 3UI6A 2JV4A 1FKGA 4DZ3A 2ZQSA 4GIVA 2ITKA 2XP9A 3L4HA 2KE0A 2ZQTA 2M1IA 3PRDA 1FKIA 5GPGA 4DRHA 4U84A 3CGMA 5HTGA 2PPOA 3IHZA 1J4HA 5HT1A 4C02B 1Q6UA 4ODNA 1W26A 2LJ4A 4DRMA 2K8IA 2M08A 2RURA 4TYOA 2DMVA 2YSHA 2JMFA 1I5HW 1FKRA 4R0XA 2M8JA 1NMWA 3JYJA 3MDYB 1P5QA 1FKFA 3M7NA 5AHTA 3UQBA 2KI3A 1B6CA 2MPHA 1FJDA 1JVWA 3O5DA 1A7XA 4W9OA 4DRQA 3ODKA 2MLZA 4DT4A 3KZ7A 4DRPA 5BXJA 3PA7A 1BKFA 2OFNA 3FAPA 4ODRA 1BL4A 4TW8A 1EQ3A 3EY6A 4DZ2A 2FAPA 4LAXA 3UF8A 1TCOC 4JFJA 3IK8A 1NSGA 3NI6A 3O5IA 5B8IC 4FN2A 2F4EA 1D7IA 3O5OA 5CQ2A 2FKEA 4W9PA 2PV3A 3O5JA 2LGOA 4QT2A 2E45A 4E5RA 5DITA 1PINA 2YSBA 2ZAJA 1J4IA 2JX8A 2JXWA 2XP6A 2IF4A 5HUAA 2PPPA 3JYMA 4ODKA 5D75A 2XP4A 1ZCNA 4QIBA 2KFWA 4ODPA 4ODLA 2M8IA 2DK1A 2RUQA 4IQCA 1FKKA 3KAGA 2PPNA 3O5GA 1D7JA 2LKNA 2XPAA 2XP7A 2YSGA 3TDBA 3LE4A 1FKSA 1PBKA 1YATA 2DG4A 2L2SA 2M3OW 2XP3A 2AWGA 2JZVA 2Y78A 3O5QA 2PV2A 3PRBA 4JFMA 1QPFA 3TCZA 1FKHA 4IPXA 4TNSA 2DJYA 1WMVA 2MDIA 1Y0OA 1K9QA 4G50A 1FKTA 2Q5AA 1D6OA 1D7HA 2D9FA 2RUDA 3NTPA 3JXVA 3O5PA 4MGVA 3UI5A 1FKJA 2EZ5W 2RE3A 2XP5A 2ZR4A 3H9RB 4J4NA 2DG9A 1WR7A 4LAYA 4DIPA 1JNSA 4JFKA 2F21A 1T11A 2M2AA 2RSEA 4DH0A 3UQIA 3KAIA 1ROTA 1YW5A 4JFIA 4ODMA 2F2DA 4ODOA 4W9QA 1F40A 2MNTA 4NNRA 3OOBA 2KGJA 3M85A 5DIVA 2PV1A 2N87A 3UI4A 4N19A 2MLYA 1EG3A 2KR7A 5HKGA 4O2TA 1FAPA 3NRKA 4BF8A 4FAPA 5HWBA 2ZQVA 1TK7A 4TW7A 4U86A 1ROUA 1EYMA 4REXA 3RFWA 1C9HA 3CNGA 2DWVA 3CGNA 1J4RA 1HXVA 2PBCA 1EG4A 2MLXA 4J4OA 4DRKA 5HW8A 2RQSA 2UZ5A 5HW7A 1J6YA 1NMVA 3I6CA 5HW6A 2VCDA 5J6EA 1M5YA 1QPLA 2KO7A 4DRJA 2LAJA 3KADA 3O5MA 4DRNA 4U85A 4TX0A 3KACA 1KT0A
chains in the Genus database with same CATH superfamily
4IQ2A 1GRJA 4Z2JA 1GPFA 2P4VA 2YSIA 3GTYX 1O6WA 1Q6HA 4A0UA 3VAWA 1K9RA 1XRVA 3CH9A 2MF9A 3WD0A 1X6NA 3KAFA 5HWCA 4DRIA 2DSZA 1EHNA 1Q1CA 1LL4A 1XHGA 2YSFA 5GQBA 1LQ0A 3O5KA 4R5EA 2ZQSA 4ZS6A 3L4HA 3B8SA 3FXYA 3CGMA 4ZPWR 1RP5A 1ITXA 4C02B 2DSWA 1W26A 2LJ4A 3PRAA 2K8IA 2RURA 1CTNA 4XAKA 3ARZA 2Y8NB 2WLYA 2O9OA 2M8JA 4R0XA 4MPKA 3JYJA 3MDYB 3M7NA 1B6CA 3O5DA 3ODKA 4DT4A 1GUVA 3QOKA 1BL4A 1EQ3A 1W1TA 4DZ2A 1JNEA 2FAPA 3MQGA 4LAXA 3UF8A 3O5IA 1FLCA 5CQ2A 2PV3A 1FFRA 1TFVA 4QT2A 1D2KA 1E6RA 1HJWA 2IF4A 4KR0B 2PPPA 4ODKA 3WD2A 1SYTA 4Z2KA 3KAGA 4ODQA 2RUDA 1GOIA 4AY1A 3O5QA 2OWOA 4TNSA 4G50A 1FKTA 1LL6A 2D9FA 3AS3A 1HJVA 2WAEA 1WB0A 2EZ5W 3WD1A 4LAYA 4JFKA 2F21A 2PN0A 3KAIA 2ESCA 4KQZA 4P8VA 2MLYA 1EG3A 1FAPA 1ZU8A 5HWBA 3ARWA 1EYMA 1ZB5A 3RFWA 1C9HA 3WIJA 2DWVA 3CGNA 1J4RA 1EG4A 2IUZA 1ZBWA 2DSUA 1UR8A 1J6YA 3I6CA 2B5UB 3ALGA 3O5MA 3ARYA 2YBUA 4DROA 2ZQUA 1FKDA 5E64A 1EDQA 4GGQA 5I98A 3B7XA 2XP8A 2A3EA 4P8XA 2RUCA 4WK9A 2DK7A 2L4JA 3FSCA 1ZK6A 3B9DA 4PTMA 1HJXA 1E6PA 1L1PA 3OA5A 3TC5A 4Q22A 4TW6A 2A3CA 3ARQA 2KXQA 1F8AB 3ARSA 3CHFA 3AS0A 3KAHA 4MSPA 1JMQA 3O5RA 3IKDA 1JNTA 1N1AA 3O5EA 1U79A 1Q6IA 4QT3A 1ZBCA 4DZ3A 2JV4A 2ITKA 2M1IA 3PRDA 5GPGA 4U84A 3ARUA 4DWSC 1J4HA 4HBOA 3ALFA 1Q6UA 2DMVA 3AQUA 1W9PA 1NMWA 2ETNA 1FKFA 5AHTA 3LKXA 2KI3A 3UQBA 4WKHA 4DRQA 2MLZA 2WLZA 3KZ7A 3PA7A 5E66A 5HBFA 4Z2LA 3AS1A 3NI6A 4FN2A 2F4EA 4WIWA 2G41A 1ZBVA 3EIPA 3WD3A 1E15A 2E45A 4E5RA 4GLXA 1J4IA 3BXWA 2JX8A 1WNOA 3CHCA 1W1PA 3ARVA 4ODPA 4Z2GA 2M8IA 2DK1A 3O5GA 2G8ZA 2LKNA 2XPAA 1FKSA 3TDBA 4L3NA 3LE4A 4Q7NA 2L2SA 4JFMA 2XP3A 2JZVA 1QPFA 3TCZA 2WADA 1FKHA 4IPXA 4WKFA 2MDIA 5DEZA 2Q5AA 4DWSD 3B9AA 3NTPA 2ZR4A 3FSBA 4J4NA 2FDMA 3UQIA 4JFIA 4ODMA 2DT2A 4NZCA 4S3JA 4W9QA 2MNTA 4WKAA 3BMBA 2KGJA 3M85A 2PV1A 4MNKA 2ZQVA 3WKZA 4U86A 1ROUA 2EULA 4DWSB 2YAJB 3CNGA 3RM4A 1HXVA 4J4OA 4DRKA 2RQSA 4ZPVR 2WM0A 5HW7A 3WQWA 5J6EA 2VCDA 4MNLA 1M5YA 1QPLA 4DRNA 5DF0A 1KT0A 3PQHA 4ML4A 2BA1A 3IKGA 1NH6A 4P8WA 2VN1A 4MNJA 3RM8A 3O5FA 2XPBA 1E44A 4L72B 3LUOA 2ZR5A 5JH8A 1ZBKA 1OGBA 3GPKA 4ITZA 1JCHB 4JYSA 3CHEA 3MCBA 4LAVA 2WK2A 2YBTA 1FKLA 5DIUA 3O5LA 1FD9A 1X6LA 3G6MA 1FKGA 4DRHA 2XP9A 2DT1A 4MNMA 1FKIA 1E6NA 4UDMA 5HT1A 4DWSA 4ODNA 4TYOA 2YSHA 3AROA 1HKMA 3RM9A 1H0IA 2MPHA 1FJDA 1A7XA 1W1YA 4DRPA 5U47A 1BKFA 2OFNA 4ODRA 1OGGA 3EY6A 3FY1A 1TR8A 4JFJA 3IK8A 1D7IA 1FFQA 2FKEA 4MAVA 4W9PA 3O5JA 4S3KA 5DITA 1PINA 2YSBA 2ZAJA 3MQHA 2XP6A 1KFWA 5D75A 2XP4A 4QIBA 4NSBA 2RUQA 1HKJA 4IQCA 1FKKA 1D7JA 1YATA 2XP7A 1WAWA 1UR9A 2Y78A 2M3OW 2F23A 2PV2A 4HBEA 1K9QA 5HUAA 1D7HA 5HTGA 3JXVA 1W9VA 1NWUA 3UI5A 1FKJA 2RE3A 3H9RB 2XP5A 4DIPA 1JNSA 2DG9A 2QF8A 2M2AA 4DH0A 1ROTA 1YW5A 4P8UA 3LKXB 3OOBA 3UI4A 2N87A 4N19A 5HKGA 1RD6A 4FAPA 1TK7A 4LGXA 4REXA 2PBCA 1LJYA 2MLXA 5E65A 4WJXA 5HW8A 1H0GA 1NMVA 4DRJA 3ARRA 2LAJA 3KADA 1E9LA 3FS8A 3KACA 3CZ8A 3G6LA 1NWSA 4ZPTR 4Z2HA 2DPEA 4LAWA 3WH0A 4JFLA 3UQAA 3WD4A 1FKBA 1E6ZA 2DG3A 4G2PA 2A3AA 2AOSA 3ARXA 1QZ2A 2LPVA 5DO2A 1R9HA 1KT1A 1NWTA 2PI6A 3KCEA 4IT6A 3KABA 2ZR6A 3RGCA 3UI6A 4GIVA 2KE0A 2ZQTA 1HKKA 2PPOA 3IHZA 2A3BA 4DRMA 2O92A 2M08A 3WL0A 1LL7A 2JMFA 1I5HW 5E5WA 1JNDA 3B9EA 1FKRA 1ZL1A 1P5QA 2DSVA 2DT0A 3W4RA 1JVWA 4W9OA 5BXJA 4IT4A 3FAPA 4TW8A 3PR9A 4HARA 1TCOC 2B31A 1NSGA 1K9TA 5B8IC 3O5OA 4URIA 2DT3A 2LGOA 1VF8A 2JXWA 1NWRA 3JYMA 3RMEA 3WL1A 2QRVA 1ZCNA 2KFWA 4ODLA 1W1VA 2PPNA 2YSGA 4A0TA 1PBKA 3AS2A 2DG4A 2AWGA 3PRBA 3GU0A 2DJYA 1WMVA 3ARTA 1Y0OA 4MGVA 1D6OA 3O5PA 4W5UA 1IX5A 4MTVA 4O2TA 4QZVB 1WR7A 3WQVA 1T11A 2RSEA 1OWQA 1LG2A 3ARPA 2F2DA 4ODOA 1F40A 5GPRA 4NNRA 1SR0A 5DIVA 2KR7A 3NRKA 4BF8A 4TW7A 5E62A 3MCBB 1O6IA 4Z2IA 3CHDA 2UZ5A 5HW6A 1W9UA 1EIBA 2KO7A 4U85A 1HKIA 1LG1A 4TX0A 2OLHA
chains in the Genus database with same CATH topology
4IQ2A 4Z2JA 1GPFA 2YSIA 1O6WA 1Q6HA 4A0UA 3VAWA 1K9RA 1XRVA 3CH9A 2MF9A 3WD0A 1X6NA 3KAFA 5HWCA 4DRIA 2DSZA 1EHNA 1Q1CA 1LL4A 1XHGA 2YSFA 5GQBA 1LQ0A 3O5KA 4R5EA 2ZQSA 4ZS6A 3L4HA 3B8SA 3FXYA 3CGMA 4ZPWR 1RP5A 1ITXA 4C02B 2DSWA 1W26A 2LJ4A 3PRAA 2K8IA 2RURA 1CTNA 4XAKA 3ARZA 2Y8NB 2WLYA 2O9OA 2M8JA 4R0XA 4MPKA 3JYJA 3MDYB 3M7NA 1B6CA 3O5DA 3ODKA 4DT4A 1GUVA 3QOKA 1BL4A 1EQ3A 1W1TA 4DZ2A 1JNEA 2FAPA 3MQGA 4LAXA 3UF8A 3O5IA 1FLCA 5CQ2A 2PV3A 1FFRA 1TFVA 4QT2A 1D2KA 1E6RA 1HJWA 2IF4A 4KR0B 2PPPA 4ODKA 3WD2A 1SYTA 4Z2KA 3KAGA 4ODQA 2RUDA 1GOIA 4AY1A 3O5QA 2OWOA 4TNSA 4G50A 1FKTA 1LL6A 2D9FA 3AS3A 1HJVA 2WAEA 1WB0A 2EZ5W 3WD1A 4LAYA 4JFKA 2F21A 3KAIA 2ESCA 4KQZA 4P8VA 2MLYA 1EG3A 1FAPA 1ZU8A 5HWBA 3ARWA 1EYMA 1ZB5A 3RFWA 1C9HA 3WIJA 2DWVA 3CGNA 1J4RA 1EG4A 2IUZA 1ZBWA 2DSUA 1UR8A 1J6YA 3I6CA 3ALGA 3O5MA 3ARYA 2YBUA 4DROA 2ZQUA 1FKDA 5E64A 1EDQA 4GGQA 5I98A 3B7XA 2XP8A 2A3EA 4P8XA 2RUCA 4WK9A 2DK7A 2L4JA 3FSCA 1ZK6A 3B9DA 4PTMA 1HJXA 1E6PA 1L1PA 3OA5A 3TC5A 4Q22A 4TW6A 2A3CA 3ARQA 2KXQA 1F8AB 3ARSA 3CHFA 3AS0A 3KAHA 4MSPA 1JMQA 3O5RA 3IKDA 1JNTA 1N1AA 3O5EA 1U79A 1Q6IA 4QT3A 1ZBCA 4DZ3A 2JV4A 2ITKA 2M1IA 3PRDA 5GPGA 4U84A 3ARUA 4DWSC 1J4HA 4HBOA 3ALFA 1Q6UA 2DMVA 3AQUA 1W9PA 1NMWA 1FKFA 5AHTA 3LKXA 2KI3A 3UQBA 4WKHA 4DRQA 2MLZA 2WLZA 3KZ7A 3PA7A 5E66A 5HBFA 4Z2LA 3AS1A 3NI6A 4FN2A 2F4EA 4WIWA 2G41A 1ZBVA 3WD3A 1E15A 2E45A 4E5RA 4GLXA 1J4IA 3BXWA 2JX8A 1WNOA 3CHCA 1W1PA 3ARVA 4ODPA 4Z2GA 2M8IA 2DK1A 3O5GA 2G8ZA 2LKNA 2XPAA 1FKSA 3TDBA 4L3NA 3LE4A 4Q7NA 2L2SA 4JFMA 2XP3A 2JZVA 1QPFA 3TCZA 2WADA 1FKHA 4IPXA 4WKFA 2MDIA 5DEZA 2Q5AA 4DWSD 3B9AA 3NTPA 2ZR4A 3FSBA 4J4NA 2FDMA 3UQIA 4JFIA 4ODMA 2DT2A 4NZCA 4S3JA 4W9QA 2MNTA 4WKAA 2KGJA 3M85A 2PV1A 4MNKA 2ZQVA 3WKZA 4U86A 1ROUA 4DWSB 2YAJB 3CNGA 3RM4A 1HXVA 4J4OA 4DRKA 2RQSA 4ZPVR 2WM0A 5HW7A 3WQWA 5J6EA 2VCDA 4MNLA 1M5YA 1QPLA 4DRNA 5DF0A 1KT0A 3PQHA 4ML4A 2BA1A 3IKGA 1NH6A 4P8WA 2VN1A 4MNJA 3RM8A 3O5FA 2XPBA 4L72B 3LUOA 2ZR5A 5JH8A 1ZBKA 1OGBA 3GPKA 4ITZA 4JYSA 3CHEA 3MCBA 4LAVA 2WK2A 2YBTA 1FKLA 5DIUA 3O5LA 1FD9A 1X6LA 3G6MA 1FKGA 4DRHA 2XP9A 2DT1A 4MNMA 1FKIA 1E6NA 5HT1A 4DWSA 4ODNA 4TYOA 2YSHA 3AROA 1HKMA 3RM9A 1H0IA 2MPHA 1FJDA 1A7XA 1W1YA 4DRPA 5U47A 1BKFA 2OFNA 4ODRA 1OGGA 3EY6A 3FY1A 1TR8A 4JFJA 3IK8A 1D7IA 1FFQA 2FKEA 4MAVA 4W9PA 3O5JA 4S3KA 5DITA 1PINA 2YSBA 2ZAJA 3MQHA 2XP6A 1KFWA 5D75A 2XP4A 4QIBA 4NSBA 2RUQA 1HKJA 4IQCA 1FKKA 1D7JA 1YATA 2XP7A 1WAWA 1UR9A 2Y78A 2M3OW 2PV2A 4HBEA 1K9QA 5HUAA 1D7HA 5HTGA 3JXVA 1W9VA 1NWUA 3UI5A 1FKJA 2RE3A 3H9RB 2XP5A 4DIPA 1JNSA 2DG9A 2QF8A 2M2AA 4DH0A 1ROTA 1YW5A 4P8UA 3LKXB 3OOBA 3UI4A 2N87A 4N19A 5HKGA 1RD6A 4FAPA 1TK7A 4LGXA 4REXA 2PBCA 1LJYA 2MLXA 5E65A 4WJXA 5HW8A 1H0GA 1NMVA 4DRJA 3ARRA 2LAJA 3KADA 1E9LA 3FS8A 3KACA 3CZ8A 3G6LA 1NWSA 4ZPTR 4Z2HA 2DPEA 4LAWA 3WH0A 4JFLA 3UQAA 3WD4A 1FKBA 1E6ZA 2DG3A 4G2PA 2A3AA 2AOSA 3ARXA 1QZ2A 2LPVA 5DO2A 1R9HA 1KT1A 1NWTA 2PI6A 3KCEA 4IT6A 3KABA 2ZR6A 3RGCA 3UI6A 4GIVA 2KE0A 2ZQTA 1HKKA 2PPOA 3IHZA 2A3BA 4DRMA 2O92A 2M08A 3WL0A 1LL7A 2JMFA 1I5HW 5E5WA 1JNDA 3B9EA 1FKRA 1ZL1A 1P5QA 2DSVA 2DT0A 3W4RA 1JVWA 4W9OA 5BXJA 4IT4A 3FAPA 4TW8A 3PR9A 4HARA 1TCOC 2B31A 1NSGA 1K9TA 5B8IC 3O5OA 4URIA 2DT3A 2LGOA 1VF8A 2JXWA 1NWRA 3JYMA 3RMEA 3WL1A 2QRVA 1ZCNA 2KFWA 4ODLA 1W1VA 2PPNA 2YSGA 4A0TA 1PBKA 3AS2A 2DG4A 2AWGA 3PRBA 2DJYA 1WMVA 3ARTA 1Y0OA 4MGVA 1D6OA 3O5PA 4W5UA 1IX5A 4MTVA 4O2TA 4QZVB 1WR7A 3WQVA 1T11A 2RSEA 1OWQA 1LG2A 3ARPA 2F2DA 4ODOA 1F40A 5GPRA 4NNRA 1SR0A 5DIVA 2KR7A 3NRKA 4BF8A 4TW7A 5E62A 3MCBB 1O6IA 4Z2IA 3CHDA 2UZ5A 5HW6A 1W9UA 1EIBA 2KO7A 4U85A 1HKIA 1LG1A 4TX0A 2OLHA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4IQ2 A;  4DRO A;  2ZQU A;  2BA1 A;  1FKD A;  3IKG A;  4LAW A;  2YSI A;  3WH0 A;  4JFL A;  3UQA A;  1O6W A;  4GGQ A;  5I98 A;  1FKB A;  3B7X A;  2XP8 A;  1Q6H A;  2DG3 A;  2VN1 A;  2RUC A;  4G2P A;  3VAW A;  1K9R A;  2DK7 A;  2L4J A;  1ZK6 A;  3O5F A;  2MF9 A;  2XPB A;  1QZ2 A;  2LPV A;  1L1P A;  3KAF A;  1R9H A;  5HWC A;  1KT1 A;  3LUO A;  2ZR5 A;  4DRI A;  3TC5 A;  4TW6 A;  1Q1C A;  2KXQ A;  1F8A B;  3GPK A;  4ODQ A;  4ITZ A;  4JYS A;  2YSF A;  3KAH A;  4MSP A;  1JMQ A;  4LAV A;  3O5R A;  3KCE A;  1FKL A;  3IKD A;  1JNT A;  3O5K A;  1N1A A;  3O5E A;  1U79 A;  5DIU A;  3O5L A;  1Q6I A;  1FD9 A;  3KAB A;  2ZR6 A;  4QT3 A;  3RGC A;  3UI6 A;  2JV4 A;  1FKG A;  4DZ3 A;  2ZQS A;  4GIV A;  2ITK A;  2XP9 A;  3L4H A;  2KE0 A;  2ZQT A;  2M1I A;  3PRD A;  1FKI A;  5GPG A;  4DRH A;  4U84 A;  3CGM A;  5HTG A;  2PPO A;  3IHZ A;  1J4H A;  5HT1 A;  4C02 B;  1Q6U A;  4ODN A;  1W26 A;  2LJ4 A;  4DRM A;  2K8I A;  2M08 A;  2RUR A;  4TYO A;  2DMV A;  2YSH A;  2JMF A;  1I5H W;  1FKR A;  4R0X A;  2M8J A;  1NMW A;  3JYJ A;  3MDY B;  1P5Q A;  1FKF A;  3M7N A;  5AHT A;  3UQB A;  2KI3 A;  1B6C A;  2MPH A;  1FJD A;  1JVW A;  3O5D A;  1A7X A;  4W9O A;  4DRQ A;  3ODK A;  2MLZ A;  4DT4 A;  3KZ7 A;  4DRP A;  5BXJ A;  3PA7 A;  1BKF A;  2OFN A;  3FAP A;  4ODR A;  1BL4 A;  4TW8 A;  1EQ3 A;  3EY6 A;  4DZ2 A;  2FAP A;  4LAX A;  3UF8 A;  1TCO C;  4JFJ A;  3IK8 A;  1NSG A;  3NI6 A;  3O5I A;  5B8I C;  4FN2 A;  2F4E A;  1D7I A;  3O5O A;  5CQ2 A;  2FKE A;  4W9P A;  2PV3 A;  3O5J A;  2LGO A;  4QT2 A;  2E45 A;  4E5R A;  5DIT A;  1PIN A;  2YSB A;  2ZAJ A;  1J4I A;  2JX8 A;  2JXW A;  2XP6 A;  2IF4 A;  5HUA A;  2PPP A;  3JYM A;  4ODK A;  5D75 A;  2XP4 A;  1ZCN A;  4QIB A;  2KFW A;  4ODP A;  4ODL A;  2M8I A;  2DK1 A;  2RUQ A;  4IQC A;  1FKK A;  3KAG A;  2PPN A;  3O5G A;  1D7J A;  2LKN A;  2XPA A;  2XP7 A;  2YSG A;  3TDB A;  3LE4 A;  1FKS A;  1PBK A;  1YAT A;  2DG4 A;  2L2S A;  2M3O W;  2XP3 A;  2AWG A;  2JZV A;  2Y78 A;  3O5Q A;  2PV2 A;  3PRB A;  4JFM A;  1QPF A;  3TCZ A;  1FKH A;  4IPX A;  4TNS A;  2DJY A;  1WMV A;  2MDI A;  1Y0O A;  1K9Q A;  4G50 A;  1FKT A;  2Q5A A;  1D6O A;  1D7H A;  2D9F A;  2RUD A;  3NTP A;  3JXV A;  3O5P A;  4MGV A;  3UI5 A;  1FKJ A;  2EZ5 W;  2RE3 A;  2XP5 A;  2ZR4 A;  3H9R B;  4J4N A;  2DG9 A;  1WR7 A;  4LAY A;  4DIP A;  1JNS A;  4JFK A;  2F21 A;  1T11 A;  2M2A A;  2RSE A;  4DH0 A;  3UQI A;  3KAI A;  1ROT A;  1YW5 A;  4JFI A;  4ODM A;  2F2D A;  4ODO A;  4W9Q A;  1F40 A;  2MNT A;  4NNR A;  3OOB A;  2KGJ A;  3M85 A;  5DIV A;  2PV1 A;  2N87 A;  3UI4 A;  4N19 A;  2MLY A;  1EG3 A;  2KR7 A;  5HKG A;  4O2T A;  1FAP A;  3NRK A;  4BF8 A;  4FAP A;  5HWB A;  2ZQV A;  1TK7 A;  4TW7 A;  4U86 A;  1ROU A;  1EYM A;  4REX A;  3RFW A;  1C9H A;  3CNG A;  2DWV A;  3CGN A;  1J4R A;  1HXV A;  2PBC A;  1EG4 A;  2MLX A;  4J4O A;  4DRK A;  5HW8 A;  2RQS A;  2UZ5 A;  5HW7 A;  1J6Y A;  1NMV A;  3I6C A;  5HW6 A;  2VCD A;  5J6E A;  1M5Y A;  1QPL A;  2KO7 A;  4DRJ A;  2LAJ A;  3KAD A;  3O5M A;  4DRN A;  4U85 A;  4TX0 A;  3KAC A;  1KT0 A; 
#chains in the Genus database with same CATH topology
 4IQ2 A;  1GRJ A;  4Z2J A;  1GPF A;  2P4V A;  2YSI A;  3GTY X;  1O6W A;  1Q6H A;  4A0U A;  3VAW A;  1K9R A;  1XRV A;  3CH9 A;  2MF9 A;  3WD0 A;  1X6N A;  3KAF A;  5HWC A;  4DRI A;  2DSZ A;  1EHN A;  1Q1C A;  1LL4 A;  1XHG A;  2YSF A;  5GQB A;  1LQ0 A;  3O5K A;  4R5E A;  2ZQS A;  4ZS6 A;  3L4H A;  3B8S A;  3FXY A;  3CGM A;  4ZPW R;  1RP5 A;  1ITX A;  4C02 B;  2DSW A;  1W26 A;  2LJ4 A;  3PRA A;  2K8I A;  2RUR A;  1CTN A;  4XAK A;  3ARZ A;  2Y8N B;  2WLY A;  2O9O A;  2M8J A;  4R0X A;  4MPK A;  3JYJ A;  3MDY B;  3M7N A;  1B6C A;  3O5D A;  3ODK A;  4DT4 A;  1GUV A;  3QOK A;  1BL4 A;  1EQ3 A;  1W1T A;  4DZ2 A;  1JNE A;  2FAP A;  3MQG A;  4LAX A;  3UF8 A;  3O5I A;  1FLC A;  5CQ2 A;  2PV3 A;  1FFR A;  1TFV A;  4QT2 A;  1D2K A;  1E6R A;  1HJW A;  2IF4 A;  4KR0 B;  2PPP A;  4ODK A;  3WD2 A;  1SYT A;  4Z2K A;  3KAG A;  4ODQ A;  2RUD A;  1GOI A;  4AY1 A;  3O5Q A;  2OWO A;  4TNS A;  4G50 A;  1FKT A;  1LL6 A;  2D9F A;  3AS3 A;  1HJV A;  2WAE A;  1WB0 A;  2EZ5 W;  3WD1 A;  4LAY A;  4JFK A;  2F21 A;  2PN0 A;  3KAI A;  2ESC A;  4KQZ A;  4P8V A;  2MLY A;  1EG3 A;  1FAP A;  1ZU8 A;  5HWB A;  3ARW A;  1EYM A;  1ZB5 A;  3RFW A;  1C9H A;  3WIJ A;  2DWV A;  3CGN A;  1J4R A;  1EG4 A;  2IUZ A;  1ZBW A;  2DSU A;  1UR8 A;  1J6Y A;  3I6C A;  2B5U B;  3ALG A;  3O5M A;  3ARY A;  2YBU A;  4DRO A;  2ZQU A;  1FKD A;  5E64 A;  1EDQ A;  4GGQ A;  5I98 A;  3B7X A;  2XP8 A;  2A3E A;  4P8X A;  2RUC A;  4WK9 A;  2DK7 A;  2L4J A;  3FSC A;  1ZK6 A;  3B9D A;  4PTM A;  1HJX A;  1E6P A;  1L1P A;  3OA5 A;  3TC5 A;  4Q22 A;  4TW6 A;  2A3C A;  3ARQ A;  2KXQ A;  1F8A B;  3ARS A;  3CHF A;  3AS0 A;  3KAH A;  4MSP A;  1JMQ A;  3O5R A;  3IKD A;  1JNT A;  1N1A A;  3O5E A;  1U79 A;  1Q6I A;  4QT3 A;  1ZBC A;  4DZ3 A;  2JV4 A;  2ITK A;  2M1I A;  3PRD A;  5GPG A;  4U84 A;  3ARU A;  4DWS C;  1J4H A;  4HBO A;  3ALF A;  1Q6U A;  2DMV A;  3AQU A;  1W9P A;  1NMW A;  2ETN A;  1FKF A;  5AHT A;  3LKX A;  2KI3 A;  3UQB A;  4WKH A;  4DRQ A;  2MLZ A;  2WLZ A;  3KZ7 A;  3PA7 A;  5E66 A;  5HBF A;  4Z2L A;  3AS1 A;  3NI6 A;  4FN2 A;  2F4E A;  4WIW A;  2G41 A;  1ZBV A;  3EIP A;  3WD3 A;  1E15 A;  2E45 A;  4E5R A;  4GLX A;  1J4I A;  3BXW A;  2JX8 A;  1WNO A;  3CHC A;  1W1P A;  3ARV A;  4ODP A;  4Z2G A;  2M8I A;  2DK1 A;  3O5G A;  2G8Z A;  2LKN A;  2XPA A;  1FKS A;  3TDB A;  4L3N A;  3LE4 A;  4Q7N A;  2L2S A;  4JFM A;  2XP3 A;  2JZV A;  1QPF A;  3TCZ A;  2WAD A;  1FKH A;  4IPX A;  4WKF A;  2MDI A;  5DEZ A;  2Q5A A;  4DWS D;  3B9A A;  3NTP A;  2ZR4 A;  3FSB A;  4J4N A;  2FDM A;  3UQI A;  4JFI A;  4ODM A;  2DT2 A;  4NZC A;  4S3J A;  4W9Q A;  2MNT A;  4WKA A;  3BMB A;  2KGJ A;  3M85 A;  2PV1 A;  4MNK A;  2ZQV A;  3WKZ A;  4U86 A;  1ROU A;  2EUL A;  4DWS B;  2YAJ B;  3CNG A;  3RM4 A;  1HXV A;  4J4O A;  4DRK A;  2RQS A;  4ZPV R;  2WM0 A;  5HW7 A;  3WQW A;  5J6E A;  2VCD A;  4MNL A;  1M5Y A;  1QPL A;  4DRN A;  5DF0 A;  1KT0 A;  3PQH A;  4ML4 A;  2BA1 A;  3IKG A;  1NH6 A;  4P8W A;  2VN1 A;  4MNJ A;  3RM8 A;  3O5F A;  2XPB A;  1E44 A;  4L72 B;  3LUO A;  2ZR5 A;  5JH8 A;  1ZBK A;  1OGB A;  3GPK A;  4ITZ A;  1JCH B;  4JYS A;  3CHE A;  3MCB A;  4LAV A;  2WK2 A;  2YBT A;  1FKL A;  5DIU A;  3O5L A;  1FD9 A;  1X6L A;  3G6M A;  1FKG A;  4DRH A;  2XP9 A;  2DT1 A;  4MNM A;  1FKI A;  1E6N A;  4UDM A;  5HT1 A;  4DWS A;  4ODN A;  4TYO A;  2YSH A;  3ARO A;  1HKM A;  3RM9 A;  1H0I A;  2MPH A;  1FJD A;  1A7X A;  1W1Y A;  4DRP A;  5U47 A;  1BKF A;  2OFN A;  4ODR A;  1OGG A;  3EY6 A;  3FY1 A;  1TR8 A;  4JFJ A;  3IK8 A;  1D7I A;  1FFQ A;  2FKE A;  4MAV A;  4W9P A;  3O5J A;  4S3K A;  5DIT A;  1PIN A;  2YSB A;  2ZAJ A;  3MQH A;  2XP6 A;  1KFW A;  5D75 A;  2XP4 A;  4QIB A;  4NSB A;  2RUQ A;  1HKJ A;  4IQC A;  1FKK A;  1D7J A;  1YAT A;  2XP7 A;  1WAW A;  1UR9 A;  2Y78 A;  2M3O W;  2F23 A;  2PV2 A;  4HBE A;  1K9Q A;  5HUA A;  1D7H A;  5HTG A;  3JXV A;  1W9V A;  1NWU A;  3UI5 A;  1FKJ A;  2RE3 A;  3H9R B;  2XP5 A;  4DIP A;  1JNS A;  2DG9 A;  2QF8 A;  2M2A A;  4DH0 A;  1ROT A;  1YW5 A;  4P8U A;  3LKX B;  3OOB A;  3UI4 A;  2N87 A;  4N19 A;  5HKG A;  1RD6 A;  4FAP A;  1TK7 A;  4LGX A;  4REX A;  2PBC A;  1LJY A;  2MLX A;  5E65 A;  4WJX A;  5HW8 A;  1H0G A;  1NMV A;  4DRJ A;  3ARR A;  2LAJ A;  3KAD A;  1E9L A;  3FS8 A;  3KAC A;  3CZ8 A;  3G6L A;  1NWS A;  4ZPT R;  4Z2H A;  2DPE A;  4LAW A;  3WH0 A;  4JFL A;  3UQA A;  3WD4 A;  1FKB A;  1E6Z A;  2DG3 A;  4G2P A;  2A3A A;  2AOS A;  3ARX A;  1QZ2 A;  2LPV A;  5DO2 A;  1R9H A;  1KT1 A;  1NWT A;  2PI6 A;  3KCE A;  4IT6 A;  3KAB A;  2ZR6 A;  3RGC A;  3UI6 A;  4GIV A;  2KE0 A;  2ZQT A;  1HKK A;  2PPO A;  3IHZ A;  2A3B A;  4DRM A;  2O92 A;  2M08 A;  3WL0 A;  1LL7 A;  2JMF A;  1I5H W;  5E5W A;  1JND A;  3B9E A;  1FKR A;  1ZL1 A;  1P5Q A;  2DSV A;  2DT0 A;  3W4R A;  1JVW A;  4W9O A;  5BXJ A;  4IT4 A;  3FAP A;  4TW8 A;  3PR9 A;  4HAR A;  1TCO C;  2B31 A;  1NSG A;  1K9T A;  5B8I C;  3O5O A;  4URI A;  2DT3 A;  2LGO A;  1VF8 A;  2JXW A;  1NWR A;  3JYM A;  3RME A;  3WL1 A;  2QRV A;  1ZCN A;  2KFW A;  4ODL A;  1W1V A;  2PPN A;  2YSG A;  4A0T A;  1PBK A;  3AS2 A;  2DG4 A;  2AWG A;  3PRB A;  3GU0 A;  2DJY A;  1WMV A;  3ART A;  1Y0O A;  4MGV A;  1D6O A;  3O5P A;  4W5U A;  1IX5 A;  4MTV A;  4O2T A;  4QZV B;  1WR7 A;  3WQV A;  1T11 A;  2RSE A;  1OWQ A;  1LG2 A;  3ARP A;  2F2D A;  4ODO A;  1F40 A;  5GPR A;  4NNR A;  1SR0 A;  5DIV A;  2KR7 A;  3NRK A;  4BF8 A;  4TW7 A;  5E62 A;  3MCB B;  1O6I A;  4Z2I A;  3CHD A;  2UZ5 A;  5HW6 A;  1W9U A;  1EIB A;  2KO7 A;  4U85 A;  1HKI A;  1LG1 A;  4TX0 A;  2OLH A; 
#chains in the Genus database with same CATH homology
 4IQ2 A;  4Z2J A;  1GPF A;  2YSI A;  1O6W A;  1Q6H A;  4A0U A;  3VAW A;  1K9R A;  1XRV A;  3CH9 A;  2MF9 A;  3WD0 A;  1X6N A;  3KAF A;  5HWC A;  4DRI A;  2DSZ A;  1EHN A;  1Q1C A;  1LL4 A;  1XHG A;  2YSF A;  5GQB A;  1LQ0 A;  3O5K A;  4R5E A;  2ZQS A;  4ZS6 A;  3L4H A;  3B8S A;  3FXY A;  3CGM A;  4ZPW R;  1RP5 A;  1ITX A;  4C02 B;  2DSW A;  1W26 A;  2LJ4 A;  3PRA A;  2K8I A;  2RUR A;  1CTN A;  4XAK A;  3ARZ A;  2Y8N B;  2WLY A;  2O9O A;  2M8J A;  4R0X A;  4MPK A;  3JYJ A;  3MDY B;  3M7N A;  1B6C A;  3O5D A;  3ODK A;  4DT4 A;  1GUV A;  3QOK A;  1BL4 A;  1EQ3 A;  1W1T A;  4DZ2 A;  1JNE A;  2FAP A;  3MQG A;  4LAX A;  3UF8 A;  3O5I A;  1FLC A;  5CQ2 A;  2PV3 A;  1FFR A;  1TFV A;  4QT2 A;  1D2K A;  1E6R A;  1HJW A;  2IF4 A;  4KR0 B;  2PPP A;  4ODK A;  3WD2 A;  1SYT A;  4Z2K A;  3KAG A;  4ODQ A;  2RUD A;  1GOI A;  4AY1 A;  3O5Q A;  2OWO A;  4TNS A;  4G50 A;  1FKT A;  1LL6 A;  2D9F A;  3AS3 A;  1HJV A;  2WAE A;  1WB0 A;  2EZ5 W;  3WD1 A;  4LAY A;  4JFK A;  2F21 A;  3KAI A;  2ESC A;  4KQZ A;  4P8V A;  2MLY A;  1EG3 A;  1FAP A;  1ZU8 A;  5HWB A;  3ARW A;  1EYM A;  1ZB5 A;  3RFW A;  1C9H A;  3WIJ A;  2DWV A;  3CGN A;  1J4R A;  1EG4 A;  2IUZ A;  1ZBW A;  2DSU A;  1UR8 A;  1J6Y A;  3I6C A;  3ALG A;  3O5M A;  3ARY A;  2YBU A;  4DRO A;  2ZQU A;  1FKD A;  5E64 A;  1EDQ A;  4GGQ A;  5I98 A;  3B7X A;  2XP8 A;  2A3E A;  4P8X A;  2RUC A;  4WK9 A;  2DK7 A;  2L4J A;  3FSC A;  1ZK6 A;  3B9D A;  4PTM A;  1HJX A;  1E6P A;  1L1P A;  3OA5 A;  3TC5 A;  4Q22 A;  4TW6 A;  2A3C A;  3ARQ A;  2KXQ A;  1F8A B;  3ARS A;  3CHF A;  3AS0 A;  3KAH A;  4MSP A;  1JMQ A;  3O5R A;  3IKD A;  1JNT A;  1N1A A;  3O5E A;  1U79 A;  1Q6I A;  4QT3 A;  1ZBC A;  4DZ3 A;  2JV4 A;  2ITK A;  2M1I A;  3PRD A;  5GPG A;  4U84 A;  3ARU A;  4DWS C;  1J4H A;  4HBO A;  3ALF A;  1Q6U A;  2DMV A;  3AQU A;  1W9P A;  1NMW A;  1FKF A;  5AHT A;  3LKX A;  2KI3 A;  3UQB A;  4WKH A;  4DRQ A;  2MLZ A;  2WLZ A;  3KZ7 A;  3PA7 A;  5E66 A;  5HBF A;  4Z2L A;  3AS1 A;  3NI6 A;  4FN2 A;  2F4E A;  4WIW A;  2G41 A;  1ZBV A;  3WD3 A;  1E15 A;  2E45 A;  4E5R A;  4GLX A;  1J4I A;  3BXW A;  2JX8 A;  1WNO A;  3CHC A;  1W1P A;  3ARV A;  4ODP A;  4Z2G A;  2M8I A;  2DK1 A;  3O5G A;  2G8Z A;  2LKN A;  2XPA A;  1FKS A;  3TDB A;  4L3N A;  3LE4 A;  4Q7N A;  2L2S A;  4JFM A;  2XP3 A;  2JZV A;  1QPF A;  3TCZ A;  2WAD A;  1FKH A;  4IPX A;  4WKF A;  2MDI A;  5DEZ A;  2Q5A A;  4DWS D;  3B9A A;  3NTP A;  2ZR4 A;  3FSB A;  4J4N A;  2FDM A;  3UQI A;  4JFI A;  4ODM A;  2DT2 A;  4NZC A;  4S3J A;  4W9Q A;  2MNT A;  4WKA A;  2KGJ A;  3M85 A;  2PV1 A;  4MNK A;  2ZQV A;  3WKZ A;  4U86 A;  1ROU A;  4DWS B;  2YAJ B;  3CNG A;  3RM4 A;  1HXV A;  4J4O A;  4DRK A;  2RQS A;  4ZPV R;  2WM0 A;  5HW7 A;  3WQW A;  5J6E A;  2VCD A;  4MNL A;  1M5Y A;  1QPL A;  4DRN A;  5DF0 A;  1KT0 A;  3PQH A;  4ML4 A;  2BA1 A;  3IKG A;  1NH6 A;  4P8W A;  2VN1 A;  4MNJ A;  3RM8 A;  3O5F A;  2XPB A;  4L72 B;  3LUO A;  2ZR5 A;  5JH8 A;  1ZBK A;  1OGB A;  3GPK A;  4ITZ A;  4JYS A;  3CHE A;  3MCB A;  4LAV A;  2WK2 A;  2YBT A;  1FKL A;  5DIU A;  3O5L A;  1FD9 A;  1X6L A;  3G6M A;  1FKG A;  4DRH A;  2XP9 A;  2DT1 A;  4MNM A;  1FKI A;  1E6N A;  5HT1 A;  4DWS A;  4ODN A;  4TYO A;  2YSH A;  3ARO A;  1HKM A;  3RM9 A;  1H0I A;  2MPH A;  1FJD A;  1A7X A;  1W1Y A;  4DRP A;  5U47 A;  1BKF A;  2OFN A;  4ODR A;  1OGG A;  3EY6 A;  3FY1 A;  1TR8 A;  4JFJ A;  3IK8 A;  1D7I A;  1FFQ A;  2FKE A;  4MAV A;  4W9P A;  3O5J A;  4S3K A;  5DIT A;  1PIN A;  2YSB A;  2ZAJ A;  3MQH A;  2XP6 A;  1KFW A;  5D75 A;  2XP4 A;  4QIB A;  4NSB A;  2RUQ A;  1HKJ A;  4IQC A;  1FKK A;  1D7J A;  1YAT A;  2XP7 A;  1WAW A;  1UR9 A;  2Y78 A;  2M3O W;  2PV2 A;  4HBE A;  1K9Q A;  5HUA A;  1D7H A;  5HTG A;  3JXV A;  1W9V A;  1NWU A;  3UI5 A;  1FKJ A;  2RE3 A;  3H9R B;  2XP5 A;  4DIP A;  1JNS A;  2DG9 A;  2QF8 A;  2M2A A;  4DH0 A;  1ROT A;  1YW5 A;  4P8U A;  3LKX B;  3OOB A;  3UI4 A;  2N87 A;  4N19 A;  5HKG A;  1RD6 A;  4FAP A;  1TK7 A;  4LGX A;  4REX A;  2PBC A;  1LJY A;  2MLX A;  5E65 A;  4WJX A;  5HW8 A;  1H0G A;  1NMV A;  4DRJ A;  3ARR A;  2LAJ A;  3KAD A;  1E9L A;  3FS8 A;  3KAC A;  3CZ8 A;  3G6L A;  1NWS A;  4ZPT R;  4Z2H A;  2DPE A;  4LAW A;  3WH0 A;  4JFL A;  3UQA A;  3WD4 A;  1FKB A;  1E6Z A;  2DG3 A;  4G2P A;  2A3A A;  2AOS A;  3ARX A;  1QZ2 A;  2LPV A;  5DO2 A;  1R9H A;  1KT1 A;  1NWT A;  2PI6 A;  3KCE A;  4IT6 A;  3KAB A;  2ZR6 A;  3RGC A;  3UI6 A;  4GIV A;  2KE0 A;  2ZQT A;  1HKK A;  2PPO A;  3IHZ A;  2A3B A;  4DRM A;  2O92 A;  2M08 A;  3WL0 A;  1LL7 A;  2JMF A;  1I5H W;  5E5W A;  1JND A;  3B9E A;  1FKR A;  1ZL1 A;  1P5Q A;  2DSV A;  2DT0 A;  3W4R A;  1JVW A;  4W9O A;  5BXJ A;  4IT4 A;  3FAP A;  4TW8 A;  3PR9 A;  4HAR A;  1TCO C;  2B31 A;  1NSG A;  1K9T A;  5B8I C;  3O5O A;  4URI A;  2DT3 A;  2LGO A;  1VF8 A;  2JXW A;  1NWR A;  3JYM A;  3RME A;  3WL1 A;  2QRV A;  1ZCN A;  2KFW A;  4ODL A;  1W1V A;  2PPN A;  2YSG A;  4A0T A;  1PBK A;  3AS2 A;  2DG4 A;  2AWG A;  3PRB A;  2DJY A;  1WMV A;  3ART A;  1Y0O A;  4MGV A;  1D6O A;  3O5P A;  4W5U A;  1IX5 A;  4MTV A;  4O2T A;  4QZV B;  1WR7 A;  3WQV A;  1T11 A;  2RSE A;  1OWQ A;  1LG2 A;  3ARP A;  2F2D A;  4ODO A;  1F40 A;  5GPR A;  4NNR A;  1SR0 A;  5DIV A;  2KR7 A;  3NRK A;  4BF8 A;  4TW7 A;  5E62 A;  3MCB B;  1O6I A;  4Z2I A;  3CHD A;  2UZ5 A;  5HW6 A;  1W9U A;  1EIB A;  2KO7 A;  4U85 A;  1HKI A;  1LG1 A;  4TX0 A;  2OLH A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...