2XP8A

Discovery of cell-active phenyl-imidazole pin1 inhibitors by structure-guided fragment evolution
Total Genus 43
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
43
sequence length
157
structure length
145
Chain Sequence
LPPGWEKAMSRSSGRVYYFNHITNASQWERPSEPARVRCSHLLVKHSQSRRPSSWRQEKITRTKEEALELINGYIQKIKSGEEDFESLASQFSDCSSAKARGDLGAFSRGQMQKPFEDASFALRTGEMSGPVFTDSGIHIILRTE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PEPTIDYL-PROLYL CIS-TRANS ISOMERASE NIMA-INTERACTING 1
publication title Discovery of Cell-Active Phenyl-Imidazole Pin1 Inhibitors by Structure-Guided Fragment Evolution.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Isomerase
total genus 43
structure length 145
sequence length 157
ec nomenclature ec 5.2.1.8: Peptidylprolyl isomerase.
pdb deposition date 2010-08-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00397 WW WW domain
A PF00639 Rotamase PPIC-type PPIASE domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.20.70.10 Mainly Beta Single Sheet Ubiquitin Ligase Nedd4; Chain: W; Ubiquitin Ligase Nedd4; Chain: W; 2xp8A01
3.10.50.40 Alpha Beta Roll Chitinase A; domain 3 Chitinase A; domain 3 2xp8A02
5BXJA 2JX8A 3TC5A 5B8IC 1FKIA 5J6EA 3IKGA 3KAIA 2UZ5A 1D6OA 4DRIA 2ZQTA 2XP8A 2ZR6A 2OFNA 4DRNA 4DRMA 3CNGA 3KZ7A 1FAPA 1M5YA 1FKLA 3NI6A 4LAXA 2XPBA 3FAPA 2M08A 3L4HA 2FAPA 1FD9A 2KFWA 5DITA 2DG9A 4IQCA 2JZVA 1WMVA 1P5QA 4BF8A 1BKFA 4DZ3A 5HW8A 3UQBA 3KAFA 4JYSA 5HKGA 1KT1A 3ODKA 2MPHA 4FN2A 2Y78A 1KT0A 1WR7A 2XP3A 2M2AA 2RE3A 5HT1A 4IQ2A 1T11A 4ODNA 3UI6A 2M3OW 2DG3A 4ODMA 3IHZA 5CQ2A 1W26A 4W9QA 5DIUA 3KCEA 1U79A 1EG4A 2M1IA 2KE0A 5DIVA 2YSGA 3LUOA 2KR7A 1TCOC 4ODPA 2FKEA 3VAWA 1FKBA 3TCZA 2RSEA 2MLZA 5HUAA 2PPOA 4DRPA 2K8IA 2DK1A 3O5MA 2VCDA 4QT3A 1JVWA 3O5QA 4TW8A 3M7NA 3O5FA 4C02B 1FKRA 2PV3A 3I6CA 2XP7A 2XP4A 4QIBA 5GPGA 2ZR4A 4GIVA 1ROTA 3CGMA 3OOBA 1J4IA 3O5LA 1FKKA 2F21A 2LGOA 3UQIA 3O5JA 2YSFA 2DK7A 4DRQA 4QT2A 1PINA 2D9FA 3UF8A 4ODLA 2YSBA 5HTGA 4G50A 1Q6IA 4DRHA 1O6WA 1FKJA 1NSGA 4O2TA 2JXWA 1ZK6A 3PRDA 4IPXA 4DT4A 1N1AA 3TDBA 1FKGA 3NTPA 4DROA 2L4JA 3M85A 4TW7A 1EG3A 2PV2A 4ODQA 1J4RA 2IF4A 1FKHA 2YSHA 4MSPA 3PRBA 1YW5A 1NMWA 2RQSA 3KACA 2F2DA 1TK7A 1QPFA 2RUCA 2ITKA 3IKDA 2ZR5A 2MDIA 1J4HA 3IK8A 3NRKA 4GGQA 1Q6UA 2DG4A 2M8JA 2MF9A 1F40A 2DJYA 3MDYB 4W9OA 4TYOA 3UQAA 2XP9A 5HWCA 1D7HA 2LPVA 1K9QA 3KAHA 2AWGA 2KI3A 4J4OA 1D7JA 3KADA 3O5EA 2ZQUA 4TW6A 1YATA 2MLXA 3O5IA 4ODRA 4JFIA 2MNTA 2PPNA 3RFWA 2EZ5W 3O5DA 2E45A 2RURA 3O5KA 3O5RA 1FKFA 2DWVA 4W9PA 3KAGA 4DRJA 2ZAJA 2JV4A 2KXQA 4JFJA 4R0XA 3PA7A 3LE4A 1R9HA 1Q1CA 1FJDA 1HXVA 1BL4A 2MLYA 1Y0OA 3CGNA 3JXVA 2KGJA 2PBCA 4LAYA 3B7XA 4J4NA 4U86A 3GPKA 3WH0A 3UI5A 2M8IA 1K9RA 4DH0A 4U85A 4ODOA 4JFLA 4DZ2A 2RUQA 4JFMA 1Q6HA 2N87A 4G2PA 2XPAA 3UI4A 1F8AB 1PBKA 4ODKA 1NMVA 2RUDA 1JMQA 3RGCA 2YSIA 2JMFA 1B6CA 2Q5AA 5HW7A 1EYMA 3O5OA 1EQ3A 2BA1A 1A7XA 2XP6A 4E5RA 2LJ4A 3O5PA 3JYMA 5HWBA 2LKNA 2F4EA 3H9RB 1C9HA 1FKTA 1JNSA 4MGVA 2LAJA 2XP5A 1ZCNA 1JNTA 5HW6A 2KO7A 4LAWA 1ROUA 1QZ2A 4JFKA 4ITZA 4LAVA 4U84A 3KABA 4TNSA 1D7IA 2PV1A 4N19A 3O5GA 3EY6A 1I5HW 1FKDA 4TX0A 1QPLA 5AHTA 2VN1A 1J6YA 5I98A 1FKSA 5D75A 4REXA 4NNRA 2ZQVA 4FAPA 4DIPA 2PPPA 3JYJA 2DMVA 4DRKA 2ZQSA 2L2SA 1L1PA
chains in the Genus database with same CATH superfamily
5BXJA 2JX8A 3TC5A 1HKIA 1HKJA 4S3JA 4MNJA 5B8IC 1FKIA 5DO2A 1JCHB 2OWOA 5J6EA 3IKGA 2PI6A 2DSWA 4MNKA 3KAIA 2UZ5A 1D6OA 4DRIA 2ZQTA 1KFWA 1EDQA 3GU0A 4WIWA 2XP8A 3MCBB 2AOSA 2ZR6A 1E6NA 4ZS6A 2OFNA 4DRNA 4DRMA 3CNGA 2WLYA 3KZ7A 1FAPA 1M5YA 4PTMA 1FKLA 3MQHA 3NI6A 4LAXA 4XAKA 2XPBA 3FSCA 1ZB5A 2M08A 3ALGA 3B8SA 3FAPA 4MPKA 3W4RA 3L4HA 2FAPA 1FD9A 2KFWA 1W9UA 5DITA 2DSZA 2DG9A 2YAJB 4IQCA 2JZVA 1WMVA 1P5QA 1O6IA 3WD0A 3RM4A 4BF8A 1BKFA 4DZ3A 5HW8A 3UQBA 1LG1A 3KAFA 1GPFA 3ARSA 2DT3A 4JYSA 5HKGA 1KT1A 3ODKA 3BXWA 3QOKA 2MPHA 4FN2A 2Y78A 5HBFA 3ARUA 3LKXB 1KT0A 1WR7A 4Z2LA 4KR0B 4W5UA 2XP3A 2M2AA 2B31A 2RE3A 2P4VA 5HT1A 4IQ2A 1T11A 4ODNA 4ML4A 3UI6A 2M3OW 2DG3A 3B9DA 4ODMA 3IHZA 1E15A 5CQ2A 4A0UA 1W26A 4Q22A 4W9QA 3CHDA 5JH8A 5DIUA 3FSBA 3KCEA 2WK2A 4R5EA 1U79A 1EG4A 2M1IA 2KE0A 5DIVA 3ARVA 4ZPWR 2YSGA 1LQ0A 3LUOA 2KR7A 3PRAA 1EIBA 1TCOC 4Z2GA 2QF8A 4ODPA 1H0IA 2FKEA 2DPEA 3FS8A 3VAWA 1FKBA 3TCZA 2RSEA 3ARWA 2MLZA 3B9AA 3WIJA 4P8XA 5HUAA 2PPOA 4MTVA 2F23A 3ARZA 1W1VA 1HJXA 3EIPA 1SYTA 4DRPA 3WL0A 4Z2KA 1EHNA 2K8IA 2YBTA 3WD2A 4DWSB 4UDMA 2DK1A 5E66A 2DT1A 2WLZA 5E62A 1IX5A 1K9TA 3O5MA 4S3KA 2VCDA 4QT3A 4MAVA 4Z2IA 3AS2A 4P8WA 1JVWA 3O5QA 4TW8A 3M7NA 3RMEA 3O5FA 1GOIA 2PN0A 4C02B 3WD3A 1FKRA 2PV3A 3I6CA 2XP7A 1OGBA 4HARA 2XP4A 4QIBA 5GPGA 2ZR4A 2WAEA 3ARXA 4GIVA 1ROTA 3CGMA 3OOBA 1J4IA 3WD1A 1WB0A 1FKKA 3ALFA 2F21A 3O5LA 2LGOA 3UQIA 2G8ZA 1ITXA 1W9PA 2QRVA 3MCBA 3O5JA 3AROA 2YSFA 2DK7A 4WKHA 4QT2A 4MNLA 4DRQA 1PINA 2D9FA 3UF8A 4ODLA 2G41A 1GRJA 2YSBA 5HTGA 4G50A 1Q6IA 1HKMA 4DRHA 1NWTA 1O6WA 1FKJA 1NSGA 1UR8A 1TFVA 4O2TA 3ARRA 4WKFA 1JNDA 2JXWA 1ZK6A 1HKKA 2DSVA 2EULA 3MQGA 3PRDA 3CH9A 1W1YA 4IPXA 3OA5A 4DT4A 4Z2HA 1NH6A 1NWUA 2ESCA 3CHFA 1UR9A 1N1AA 3TDBA 1FKGA 3RM8A 1LL6A 3NTPA 4WJXA 1XHGA 4DROA 4ZPVR 2Y8NB 2L4JA 3M85A 4TW7A 1EG3A 2PV2A 4ODQA 1J4RA 3LKXA 3CHEA 2IF4A 4AY1A 1FKHA 3FXYA 4QZVB 2YSHA 4MSPA 3PRBA 1YW5A 1NMWA 1W9VA 2RQSA 3KACA 3PQHA 2F2DA 1TK7A 1QPFA 2RUCA 2ITKA 1W1PA 3IKDA 2ZR5A 2MDIA 1J4HA 3IK8A 4WK9A 3NRKA 4GGQA 1Q6UA 1W1TA 2DG4A 3AS3A 1E9LA 2M8JA 2MF9A 1F40A 2DJYA 3MDYB 4W9OA 3GTYX 4A0TA 1E6PA 4TYOA 1LG2A 3UQAA 1NWSA 2B5UB 1ZU8A 4L72B 5DF0A 1E44A 1VF8A 1ZBKA 1WAWA 2XP9A 5HWCA 1XRVA 3B9EA 5E64A 1D7HA 2LPVA 1K9QA 3KAHA 2AWGA 4ZPTR 2KI3A 4J4OA 1D7JA 3KADA 3O5EA 2ZQUA 4TW6A 4MNMA 1YATA 2MLXA 4LGXA 1D2KA 4P8UA 3AQUA 3O5IA 4ODRA 1JNEA 2MNTA 4JFIA 2PPNA 1H0GA 2EZ5W 3O5DA 2E45A 2RURA 3RFWA 3O5KA 3O5RA 1FKFA 2A3BA 2DWVA 4P8VA 4W9PA 4DWSA 3KAGA 4DRJA 2FDMA 3ARPA 2ZAJA 2JV4A 2KXQA 4JFJA 4R0XA 3PA7A 1NWRA 3LE4A 1R9HA 1Q1CA 1E6ZA 1LL4A 5E65A 2A3AA 3ARYA 2A3EA 4Q7NA 1FJDA 1HXVA 1BL4A 2ETNA 2MLYA 1Y0OA 3CGNA 1FLCA 3ARTA 3JXVA 3CZ8A 5E5WA 3FY1A 1ZL1A 3BMBA 2KGJA 2DSUA 2PBCA 1OWQA 1X6NA 1ZBVA 4LAYA 3CHCA 3B7XA 4J4NA 1E6RA 4U86A 3GPKA 3WH0A 3UI5A 2M8IA 5GPRA 1K9RA 4DH0A 5GQBA 4GLXA 4U85A 4ODOA 4JFLA 2O92A 4WKAA 4Z2JA 1FFQA 3PR9A 5U47A 4DZ2A 2RUQA 4DWSD 4JFMA 1Q6HA 2N87A 4G2PA 2XPAA 1RP5A 4IT4A 3UI4A 1X6LA 1F8AB 1PBKA 4ODKA 2YBUA 1NMVA 2RUDA 1JMQA 4L3NA 3RGCA 2YSIA 3AS1A 2DT2A 2JMFA 4NZCA 1B6CA 2Q5AA 2A3CA 5HW7A 1EYMA 1OGGA 2DT0A 1SR0A 2WM0A 3O5OA 1ZBCA 1TR8A 1EQ3A 2BA1A 1A7XA 2XP6A 4E5RA 2OLHA 2LJ4A 4KQZA 3G6MA 3O5PA 3RM9A 3JYMA 5HWBA 2LKNA 2F4EA 3ARQA 3H9RB 4DWSC 1C9HA 4HBOA 1FKTA 3WQVA 3WQWA 1JNSA 4MGVA 2LAJA 4IT6A 3AS0A 2XP5A 1ZCNA 1JNTA 5HW6A 2KO7A 3WKZA 4LAWA 1ROUA 1QZ2A 4JFKA 4ITZA 4LAVA 4U84A 3KABA 5DEZA 4TNSA 1FFRA 1HJVA 1HJWA 1D7IA 2PV1A 1GUVA 4N19A 1WNOA 1LL7A 3O5GA 3EY6A 1I5HW 4URIA 2WADA 2IUZA 4NSBA 1FKDA 4TX0A 1RD6A 1QPLA 5AHTA 2VN1A 3G6LA 1J6YA 1CTNA 5I98A 1FKSA 3WD4A 1ZBWA 5D75A 4REXA 4NNRA 2ZQVA 3WL1A 2O9OA 2PPPA 1LJYA 4DIPA 3JYJA 4FAPA 2DMVA 4HBEA 4DRKA 2ZQSA 2L2SA 1L1PA
chains in the Genus database with same CATH topology
5BXJA 2JX8A 3TC5A 1HKIA 1HKJA 4S3JA 4MNJA 5B8IC 1FKIA 5DO2A 2OWOA 5J6EA 3IKGA 2PI6A 2DSWA 4MNKA 3KAIA 2UZ5A 1D6OA 4DRIA 2ZQTA 1KFWA 1EDQA 4WIWA 2XP8A 3MCBB 2AOSA 2ZR6A 1E6NA 4ZS6A 2OFNA 4DRNA 4DRMA 3CNGA 2WLYA 3KZ7A 1FAPA 1M5YA 4PTMA 1FKLA 3MQHA 3NI6A 4LAXA 4XAKA 2XPBA 3FSCA 1ZB5A 2M08A 3ALGA 3B8SA 3FAPA 4MPKA 3W4RA 3L4HA 2FAPA 1FD9A 2KFWA 1W9UA 5DITA 2DSZA 2DG9A 2YAJB 4IQCA 2JZVA 1WMVA 1P5QA 1O6IA 3WD0A 3RM4A 4BF8A 1BKFA 4DZ3A 5HW8A 3UQBA 1LG1A 3KAFA 1GPFA 3ARSA 2DT3A 4JYSA 5HKGA 1KT1A 3ODKA 3BXWA 3QOKA 2MPHA 4FN2A 2Y78A 5HBFA 3ARUA 3LKXB 1KT0A 1WR7A 4Z2LA 4KR0B 4W5UA 2XP3A 2M2AA 2B31A 2RE3A 5HT1A 4IQ2A 1T11A 4ODNA 4ML4A 3UI6A 2M3OW 2DG3A 3B9DA 4ODMA 3IHZA 1E15A 5CQ2A 4A0UA 1W26A 4Q22A 4W9QA 3CHDA 5JH8A 5DIUA 3FSBA 3KCEA 2WK2A 4R5EA 1U79A 1EG4A 2M1IA 2KE0A 5DIVA 3ARVA 4ZPWR 2YSGA 1LQ0A 3LUOA 2KR7A 3PRAA 1EIBA 1TCOC 4Z2GA 2QF8A 4ODPA 1H0IA 2FKEA 2DPEA 3FS8A 3VAWA 1FKBA 3TCZA 2RSEA 3ARWA 2MLZA 3B9AA 3WIJA 4P8XA 5HUAA 2PPOA 4MTVA 3ARZA 1W1VA 1HJXA 1SYTA 4DRPA 3WL0A 4Z2KA 1EHNA 2K8IA 2YBTA 3WD2A 4DWSB 2DK1A 5E66A 2DT1A 2WLZA 5E62A 1IX5A 1K9TA 3O5MA 4S3KA 2VCDA 4QT3A 4MAVA 4Z2IA 3AS2A 4P8WA 1JVWA 3O5QA 4TW8A 3M7NA 3RMEA 3O5FA 1GOIA 4C02B 3WD3A 1FKRA 2PV3A 3I6CA 2XP7A 1OGBA 4HARA 2XP4A 4QIBA 5GPGA 2ZR4A 2WAEA 3ARXA 4GIVA 1ROTA 3CGMA 3OOBA 1J4IA 3WD1A 1WB0A 1FKKA 3ALFA 2F21A 3O5LA 2LGOA 3UQIA 2G8ZA 1ITXA 1W9PA 2QRVA 3MCBA 3O5JA 3AROA 2YSFA 2DK7A 4WKHA 4QT2A 4MNLA 4DRQA 1PINA 2D9FA 3UF8A 4ODLA 2G41A 2YSBA 5HTGA 4G50A 1Q6IA 1HKMA 4DRHA 1NWTA 1O6WA 1FKJA 1NSGA 1UR8A 1TFVA 4O2TA 3ARRA 4WKFA 1JNDA 2JXWA 1ZK6A 1HKKA 2DSVA 3MQGA 3PRDA 3CH9A 1W1YA 4IPXA 3OA5A 4DT4A 4Z2HA 1NH6A 1NWUA 2ESCA 3CHFA 1UR9A 1N1AA 3TDBA 1FKGA 3RM8A 1LL6A 3NTPA 4WJXA 1XHGA 4DROA 4ZPVR 2Y8NB 2L4JA 3M85A 4TW7A 1EG3A 2PV2A 4ODQA 1J4RA 3LKXA 3CHEA 2IF4A 4AY1A 1FKHA 3FXYA 4QZVB 2YSHA 4MSPA 3PRBA 1YW5A 1NMWA 1W9VA 2RQSA 3KACA 3PQHA 2F2DA 1TK7A 1QPFA 2RUCA 2ITKA 1W1PA 3IKDA 2ZR5A 2MDIA 1J4HA 3IK8A 4WK9A 3NRKA 4GGQA 1Q6UA 1W1TA 2DG4A 3AS3A 1E9LA 2M8JA 2MF9A 1F40A 2DJYA 3MDYB 4W9OA 4A0TA 1E6PA 4TYOA 1LG2A 3UQAA 1NWSA 1ZU8A 4L72B 5DF0A 1VF8A 1ZBKA 1WAWA 2XP9A 5HWCA 1XRVA 3B9EA 5E64A 1D7HA 2LPVA 1K9QA 3KAHA 2AWGA 4ZPTR 2KI3A 4J4OA 1D7JA 3KADA 3O5EA 2ZQUA 4TW6A 4MNMA 1YATA 2MLXA 4LGXA 1D2KA 4P8UA 3AQUA 3O5IA 4ODRA 1JNEA 2MNTA 4JFIA 2PPNA 1H0GA 2EZ5W 3O5DA 2E45A 2RURA 3RFWA 3O5KA 3O5RA 1FKFA 2A3BA 2DWVA 4P8VA 4W9PA 4DWSA 3KAGA 4DRJA 2FDMA 3ARPA 2ZAJA 2JV4A 2KXQA 4JFJA 4R0XA 3PA7A 1NWRA 3LE4A 1R9HA 1Q1CA 1E6ZA 1LL4A 5E65A 2A3AA 3ARYA 2A3EA 4Q7NA 1FJDA 1HXVA 1BL4A 2MLYA 1Y0OA 3CGNA 1FLCA 3ARTA 3JXVA 3CZ8A 5E5WA 3FY1A 1ZL1A 2KGJA 2DSUA 2PBCA 1OWQA 1X6NA 1ZBVA 4LAYA 3CHCA 3B7XA 4J4NA 1E6RA 4U86A 3GPKA 3WH0A 3UI5A 2M8IA 5GPRA 1K9RA 4DH0A 5GQBA 4GLXA 4U85A 4ODOA 4JFLA 2O92A 4WKAA 4Z2JA 1FFQA 3PR9A 5U47A 4DZ2A 2RUQA 4DWSD 4JFMA 1Q6HA 2N87A 4G2PA 2XPAA 1RP5A 4IT4A 3UI4A 1X6LA 1F8AB 1PBKA 4ODKA 2YBUA 1NMVA 2RUDA 1JMQA 4L3NA 3RGCA 2YSIA 3AS1A 2DT2A 2JMFA 4NZCA 1B6CA 2Q5AA 2A3CA 5HW7A 1EYMA 1OGGA 2DT0A 1SR0A 2WM0A 3O5OA 1ZBCA 1TR8A 1EQ3A 2BA1A 1A7XA 2XP6A 4E5RA 2OLHA 2LJ4A 4KQZA 3G6MA 3O5PA 3RM9A 3JYMA 5HWBA 2LKNA 2F4EA 3ARQA 3H9RB 4DWSC 1C9HA 4HBOA 1FKTA 3WQVA 3WQWA 1JNSA 4MGVA 2LAJA 4IT6A 3AS0A 2XP5A 1ZCNA 1JNTA 5HW6A 2KO7A 3WKZA 4LAWA 1ROUA 1QZ2A 4JFKA 4ITZA 4LAVA 4U84A 3KABA 5DEZA 4TNSA 1FFRA 1HJVA 1HJWA 1D7IA 2PV1A 1GUVA 4N19A 1WNOA 1LL7A 3O5GA 3EY6A 1I5HW 4URIA 2WADA 2IUZA 4NSBA 1FKDA 4TX0A 1RD6A 1QPLA 5AHTA 2VN1A 3G6LA 1J6YA 1CTNA 5I98A 1FKSA 3WD4A 1ZBWA 5D75A 4REXA 4NNRA 2ZQVA 3WL1A 2O9OA 2PPPA 1LJYA 4DIPA 3JYJA 4FAPA 2DMVA 4HBEA 4DRKA 2ZQSA 2L2SA 1L1PA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5BXJ A;  2JX8 A;  3TC5 A;  5B8I C;  1FKI A;  5J6E A;  3IKG A;  3KAI A;  2UZ5 A;  1D6O A;  4DRI A;  2ZQT A;  2XP8 A;  2ZR6 A;  2OFN A;  4DRN A;  4DRM A;  3CNG A;  3KZ7 A;  1FAP A;  1M5Y A;  1FKL A;  3NI6 A;  4LAX A;  2XPB A;  3FAP A;  2M08 A;  3L4H A;  2FAP A;  1FD9 A;  2KFW A;  5DIT A;  2DG9 A;  4IQC A;  2JZV A;  1WMV A;  1P5Q A;  4BF8 A;  1BKF A;  4DZ3 A;  5HW8 A;  3UQB A;  3KAF A;  4JYS A;  5HKG A;  1KT1 A;  3ODK A;  2MPH A;  4FN2 A;  2Y78 A;  1KT0 A;  1WR7 A;  2XP3 A;  2M2A A;  2RE3 A;  5HT1 A;  4IQ2 A;  1T11 A;  4ODN A;  3UI6 A;  2M3O W;  2DG3 A;  4ODM A;  3IHZ A;  5CQ2 A;  1W26 A;  4W9Q A;  5DIU A;  3KCE A;  1U79 A;  1EG4 A;  2M1I A;  2KE0 A;  5DIV A;  2YSG A;  3LUO A;  2KR7 A;  1TCO C;  4ODP A;  2FKE A;  3VAW A;  1FKB A;  3TCZ A;  2RSE A;  2MLZ A;  5HUA A;  2PPO A;  4DRP A;  2K8I A;  2DK1 A;  3O5M A;  2VCD A;  4QT3 A;  1JVW A;  3O5Q A;  4TW8 A;  3M7N A;  3O5F A;  4C02 B;  1FKR A;  2PV3 A;  3I6C A;  2XP7 A;  2XP4 A;  4QIB A;  5GPG A;  2ZR4 A;  4GIV A;  1ROT A;  3CGM A;  3OOB A;  1J4I A;  3O5L A;  1FKK A;  2F21 A;  2LGO A;  3UQI A;  3O5J A;  2YSF A;  2DK7 A;  4DRQ A;  4QT2 A;  1PIN A;  2D9F A;  3UF8 A;  4ODL A;  2YSB A;  5HTG A;  4G50 A;  1Q6I A;  4DRH A;  1O6W A;  1FKJ A;  1NSG A;  4O2T A;  2JXW A;  1ZK6 A;  3PRD A;  4IPX A;  4DT4 A;  1N1A A;  3TDB A;  1FKG A;  3NTP A;  4DRO A;  2L4J A;  3M85 A;  4TW7 A;  1EG3 A;  2PV2 A;  4ODQ A;  1J4R A;  2IF4 A;  1FKH A;  2YSH A;  4MSP A;  3PRB A;  1YW5 A;  1NMW A;  2RQS A;  3KAC A;  2F2D A;  1TK7 A;  1QPF A;  2RUC A;  2ITK A;  3IKD A;  2ZR5 A;  2MDI A;  1J4H A;  3IK8 A;  3NRK A;  4GGQ A;  1Q6U A;  2DG4 A;  2M8J A;  2MF9 A;  1F40 A;  2DJY A;  3MDY B;  4W9O A;  4TYO A;  3UQA A;  2XP9 A;  5HWC A;  1D7H A;  2LPV A;  1K9Q A;  3KAH A;  2AWG A;  2KI3 A;  4J4O A;  1D7J A;  3KAD A;  3O5E A;  2ZQU A;  4TW6 A;  1YAT A;  2MLX A;  3O5I A;  4ODR A;  4JFI A;  2MNT A;  2PPN A;  3RFW A;  2EZ5 W;  3O5D A;  2E45 A;  2RUR A;  3O5K A;  3O5R A;  1FKF A;  2DWV A;  4W9P A;  3KAG A;  4DRJ A;  2ZAJ A;  2JV4 A;  2KXQ A;  4JFJ A;  4R0X A;  3PA7 A;  3LE4 A;  1R9H A;  1Q1C A;  1FJD A;  1HXV A;  1BL4 A;  2MLY A;  1Y0O A;  3CGN A;  3JXV A;  2KGJ A;  2PBC A;  4LAY A;  3B7X A;  4J4N A;  4U86 A;  3GPK A;  3WH0 A;  3UI5 A;  2M8I A;  1K9R A;  4DH0 A;  4U85 A;  4ODO A;  4JFL A;  4DZ2 A;  2RUQ A;  4JFM A;  1Q6H A;  2N87 A;  4G2P A;  2XPA A;  3UI4 A;  1F8A B;  1PBK A;  4ODK A;  1NMV A;  2RUD A;  1JMQ A;  3RGC A;  2YSI A;  2JMF A;  1B6C A;  2Q5A A;  5HW7 A;  1EYM A;  3O5O A;  1EQ3 A;  2BA1 A;  1A7X A;  2XP6 A;  4E5R A;  2LJ4 A;  3O5P A;  3JYM A;  5HWB A;  2LKN A;  2F4E A;  3H9R B;  1C9H A;  1FKT A;  1JNS A;  4MGV A;  2LAJ A;  2XP5 A;  1ZCN A;  1JNT A;  5HW6 A;  2KO7 A;  4LAW A;  1ROU A;  1QZ2 A;  4JFK A;  4ITZ A;  4LAV A;  4U84 A;  3KAB A;  4TNS A;  1D7I A;  2PV1 A;  4N19 A;  3O5G A;  3EY6 A;  1I5H W;  1FKD A;  4TX0 A;  1QPL A;  5AHT A;  2VN1 A;  1J6Y A;  5I98 A;  1FKS A;  5D75 A;  4REX A;  4NNR A;  2ZQV A;  4FAP A;  4DIP A;  2PPP A;  3JYJ A;  2DMV A;  4DRK A;  2ZQS A;  2L2S A;  1L1P A; 
#chains in the Genus database with same CATH topology
 5BXJ A;  2JX8 A;  3TC5 A;  1HKI A;  1HKJ A;  4S3J A;  4MNJ A;  5B8I C;  1FKI A;  5DO2 A;  1JCH B;  2OWO A;  5J6E A;  3IKG A;  2PI6 A;  2DSW A;  4MNK A;  3KAI A;  2UZ5 A;  1D6O A;  4DRI A;  2ZQT A;  1KFW A;  1EDQ A;  3GU0 A;  4WIW A;  2XP8 A;  3MCB B;  2AOS A;  2ZR6 A;  1E6N A;  4ZS6 A;  2OFN A;  4DRN A;  4DRM A;  3CNG A;  2WLY A;  3KZ7 A;  1FAP A;  1M5Y A;  4PTM A;  1FKL A;  3MQH A;  3NI6 A;  4LAX A;  4XAK A;  2XPB A;  3FSC A;  1ZB5 A;  2M08 A;  3ALG A;  3B8S A;  3FAP A;  4MPK A;  3W4R A;  3L4H A;  2FAP A;  1FD9 A;  2KFW A;  1W9U A;  5DIT A;  2DSZ A;  2DG9 A;  2YAJ B;  4IQC A;  2JZV A;  1WMV A;  1P5Q A;  1O6I A;  3WD0 A;  3RM4 A;  4BF8 A;  1BKF A;  4DZ3 A;  5HW8 A;  3UQB A;  1LG1 A;  3KAF A;  1GPF A;  3ARS A;  2DT3 A;  4JYS A;  5HKG A;  1KT1 A;  3ODK A;  3BXW A;  3QOK A;  2MPH A;  4FN2 A;  2Y78 A;  5HBF A;  3ARU A;  3LKX B;  1KT0 A;  1WR7 A;  4Z2L A;  4KR0 B;  4W5U A;  2XP3 A;  2M2A A;  2B31 A;  2RE3 A;  2P4V A;  5HT1 A;  4IQ2 A;  1T11 A;  4ODN A;  4ML4 A;  3UI6 A;  2M3O W;  2DG3 A;  3B9D A;  4ODM A;  3IHZ A;  1E15 A;  5CQ2 A;  4A0U A;  1W26 A;  4Q22 A;  4W9Q A;  3CHD A;  5JH8 A;  5DIU A;  3FSB A;  3KCE A;  2WK2 A;  4R5E A;  1U79 A;  1EG4 A;  2M1I A;  2KE0 A;  5DIV A;  3ARV A;  4ZPW R;  2YSG A;  1LQ0 A;  3LUO A;  2KR7 A;  3PRA A;  1EIB A;  1TCO C;  4Z2G A;  2QF8 A;  4ODP A;  1H0I A;  2FKE A;  2DPE A;  3FS8 A;  3VAW A;  1FKB A;  3TCZ A;  2RSE A;  3ARW A;  2MLZ A;  3B9A A;  3WIJ A;  4P8X A;  5HUA A;  2PPO A;  4MTV A;  2F23 A;  3ARZ A;  1W1V A;  1HJX A;  3EIP A;  1SYT A;  4DRP A;  3WL0 A;  4Z2K A;  1EHN A;  2K8I A;  2YBT A;  3WD2 A;  4DWS B;  4UDM A;  2DK1 A;  5E66 A;  2DT1 A;  2WLZ A;  5E62 A;  1IX5 A;  1K9T A;  3O5M A;  4S3K A;  2VCD A;  4QT3 A;  4MAV A;  4Z2I A;  3AS2 A;  4P8W A;  1JVW A;  3O5Q A;  4TW8 A;  3M7N A;  3RME A;  3O5F A;  1GOI A;  2PN0 A;  4C02 B;  3WD3 A;  1FKR A;  2PV3 A;  3I6C A;  2XP7 A;  1OGB A;  4HAR A;  2XP4 A;  4QIB A;  5GPG A;  2ZR4 A;  2WAE A;  3ARX A;  4GIV A;  1ROT A;  3CGM A;  3OOB A;  1J4I A;  3WD1 A;  1WB0 A;  1FKK A;  3ALF A;  2F21 A;  3O5L A;  2LGO A;  3UQI A;  2G8Z A;  1ITX A;  1W9P A;  2QRV A;  3MCB A;  3O5J A;  3ARO A;  2YSF A;  2DK7 A;  4WKH A;  4QT2 A;  4MNL A;  4DRQ A;  1PIN A;  2D9F A;  3UF8 A;  4ODL A;  2G41 A;  1GRJ A;  2YSB A;  5HTG A;  4G50 A;  1Q6I A;  1HKM A;  4DRH A;  1NWT A;  1O6W A;  1FKJ A;  1NSG A;  1UR8 A;  1TFV A;  4O2T A;  3ARR A;  4WKF A;  1JND A;  2JXW A;  1ZK6 A;  1HKK A;  2DSV A;  2EUL A;  3MQG A;  3PRD A;  3CH9 A;  1W1Y A;  4IPX A;  3OA5 A;  4DT4 A;  4Z2H A;  1NH6 A;  1NWU A;  2ESC A;  3CHF A;  1UR9 A;  1N1A A;  3TDB A;  1FKG A;  3RM8 A;  1LL6 A;  3NTP A;  4WJX A;  1XHG A;  4DRO A;  4ZPV R;  2Y8N B;  2L4J A;  3M85 A;  4TW7 A;  1EG3 A;  2PV2 A;  4ODQ A;  1J4R A;  3LKX A;  3CHE A;  2IF4 A;  4AY1 A;  1FKH A;  3FXY A;  4QZV B;  2YSH A;  4MSP A;  3PRB A;  1YW5 A;  1NMW A;  1W9V A;  2RQS A;  3KAC A;  3PQH A;  2F2D A;  1TK7 A;  1QPF A;  2RUC A;  2ITK A;  1W1P A;  3IKD A;  2ZR5 A;  2MDI A;  1J4H A;  3IK8 A;  4WK9 A;  3NRK A;  4GGQ A;  1Q6U A;  1W1T A;  2DG4 A;  3AS3 A;  1E9L A;  2M8J A;  2MF9 A;  1F40 A;  2DJY A;  3MDY B;  4W9O A;  3GTY X;  4A0T A;  1E6P A;  4TYO A;  1LG2 A;  3UQA A;  1NWS A;  2B5U B;  1ZU8 A;  4L72 B;  5DF0 A;  1E44 A;  1VF8 A;  1ZBK A;  1WAW A;  2XP9 A;  5HWC A;  1XRV A;  3B9E A;  5E64 A;  1D7H A;  2LPV A;  1K9Q A;  3KAH A;  2AWG A;  4ZPT R;  2KI3 A;  4J4O A;  1D7J A;  3KAD A;  3O5E A;  2ZQU A;  4TW6 A;  4MNM A;  1YAT A;  2MLX A;  4LGX A;  1D2K A;  4P8U A;  3AQU A;  3O5I A;  4ODR A;  1JNE A;  2MNT A;  4JFI A;  2PPN A;  1H0G A;  2EZ5 W;  3O5D A;  2E45 A;  2RUR A;  3RFW A;  3O5K A;  3O5R A;  1FKF A;  2A3B A;  2DWV A;  4P8V A;  4W9P A;  4DWS A;  3KAG A;  4DRJ A;  2FDM A;  3ARP A;  2ZAJ A;  2JV4 A;  2KXQ A;  4JFJ A;  4R0X A;  3PA7 A;  1NWR A;  3LE4 A;  1R9H A;  1Q1C A;  1E6Z A;  1LL4 A;  5E65 A;  2A3A A;  3ARY A;  2A3E A;  4Q7N A;  1FJD A;  1HXV A;  1BL4 A;  2ETN A;  2MLY A;  1Y0O A;  3CGN A;  1FLC A;  3ART A;  3JXV A;  3CZ8 A;  5E5W A;  3FY1 A;  1ZL1 A;  3BMB A;  2KGJ A;  2DSU A;  2PBC A;  1OWQ A;  1X6N A;  1ZBV A;  4LAY A;  3CHC A;  3B7X A;  4J4N A;  1E6R A;  4U86 A;  3GPK A;  3WH0 A;  3UI5 A;  2M8I A;  5GPR A;  1K9R A;  4DH0 A;  5GQB A;  4GLX A;  4U85 A;  4ODO A;  4JFL A;  2O92 A;  4WKA A;  4Z2J A;  1FFQ A;  3PR9 A;  5U47 A;  4DZ2 A;  2RUQ A;  4DWS D;  4JFM A;  1Q6H A;  2N87 A;  4G2P A;  2XPA A;  1RP5 A;  4IT4 A;  3UI4 A;  1X6L A;  1F8A B;  1PBK A;  4ODK A;  2YBU A;  1NMV A;  2RUD A;  1JMQ A;  4L3N A;  3RGC A;  2YSI A;  3AS1 A;  2DT2 A;  2JMF A;  4NZC A;  1B6C A;  2Q5A A;  2A3C A;  5HW7 A;  1EYM A;  1OGG A;  2DT0 A;  1SR0 A;  2WM0 A;  3O5O A;  1ZBC A;  1TR8 A;  1EQ3 A;  2BA1 A;  1A7X A;  2XP6 A;  4E5R A;  2OLH A;  2LJ4 A;  4KQZ A;  3G6M A;  3O5P A;  3RM9 A;  3JYM A;  5HWB A;  2LKN A;  2F4E A;  3ARQ A;  3H9R B;  4DWS C;  1C9H A;  4HBO A;  1FKT A;  3WQV A;  3WQW A;  1JNS A;  4MGV A;  2LAJ A;  4IT6 A;  3AS0 A;  2XP5 A;  1ZCN A;  1JNT A;  5HW6 A;  2KO7 A;  3WKZ A;  4LAW A;  1ROU A;  1QZ2 A;  4JFK A;  4ITZ A;  4LAV A;  4U84 A;  3KAB A;  5DEZ A;  4TNS A;  1FFR A;  1HJV A;  1HJW A;  1D7I A;  2PV1 A;  1GUV A;  4N19 A;  1WNO A;  1LL7 A;  3O5G A;  3EY6 A;  1I5H W;  4URI A;  2WAD A;  2IUZ A;  4NSB A;  1FKD A;  4TX0 A;  1RD6 A;  1QPL A;  5AHT A;  2VN1 A;  3G6L A;  1J6Y A;  1CTN A;  5I98 A;  1FKS A;  3WD4 A;  1ZBW A;  5D75 A;  4REX A;  4NNR A;  2ZQV A;  3WL1 A;  2O9O A;  2PPP A;  1LJY A;  4DIP A;  3JYJ A;  4FAP A;  2DMV A;  4HBE A;  4DRK A;  2ZQS A;  2L2S A;  1L1P A; 
#chains in the Genus database with same CATH homology
 5BXJ A;  2JX8 A;  3TC5 A;  1HKI A;  1HKJ A;  4S3J A;  4MNJ A;  5B8I C;  1FKI A;  5DO2 A;  2OWO A;  5J6E A;  3IKG A;  2PI6 A;  2DSW A;  4MNK A;  3KAI A;  2UZ5 A;  1D6O A;  4DRI A;  2ZQT A;  1KFW A;  1EDQ A;  4WIW A;  2XP8 A;  3MCB B;  2AOS A;  2ZR6 A;  1E6N A;  4ZS6 A;  2OFN A;  4DRN A;  4DRM A;  3CNG A;  2WLY A;  3KZ7 A;  1FAP A;  1M5Y A;  4PTM A;  1FKL A;  3MQH A;  3NI6 A;  4LAX A;  4XAK A;  2XPB A;  3FSC A;  1ZB5 A;  2M08 A;  3ALG A;  3B8S A;  3FAP A;  4MPK A;  3W4R A;  3L4H A;  2FAP A;  1FD9 A;  2KFW A;  1W9U A;  5DIT A;  2DSZ A;  2DG9 A;  2YAJ B;  4IQC A;  2JZV A;  1WMV A;  1P5Q A;  1O6I A;  3WD0 A;  3RM4 A;  4BF8 A;  1BKF A;  4DZ3 A;  5HW8 A;  3UQB A;  1LG1 A;  3KAF A;  1GPF A;  3ARS A;  2DT3 A;  4JYS A;  5HKG A;  1KT1 A;  3ODK A;  3BXW A;  3QOK A;  2MPH A;  4FN2 A;  2Y78 A;  5HBF A;  3ARU A;  3LKX B;  1KT0 A;  1WR7 A;  4Z2L A;  4KR0 B;  4W5U A;  2XP3 A;  2M2A A;  2B31 A;  2RE3 A;  5HT1 A;  4IQ2 A;  1T11 A;  4ODN A;  4ML4 A;  3UI6 A;  2M3O W;  2DG3 A;  3B9D A;  4ODM A;  3IHZ A;  1E15 A;  5CQ2 A;  4A0U A;  1W26 A;  4Q22 A;  4W9Q A;  3CHD A;  5JH8 A;  5DIU A;  3FSB A;  3KCE A;  2WK2 A;  4R5E A;  1U79 A;  1EG4 A;  2M1I A;  2KE0 A;  5DIV A;  3ARV A;  4ZPW R;  2YSG A;  1LQ0 A;  3LUO A;  2KR7 A;  3PRA A;  1EIB A;  1TCO C;  4Z2G A;  2QF8 A;  4ODP A;  1H0I A;  2FKE A;  2DPE A;  3FS8 A;  3VAW A;  1FKB A;  3TCZ A;  2RSE A;  3ARW A;  2MLZ A;  3B9A A;  3WIJ A;  4P8X A;  5HUA A;  2PPO A;  4MTV A;  3ARZ A;  1W1V A;  1HJX A;  1SYT A;  4DRP A;  3WL0 A;  4Z2K A;  1EHN A;  2K8I A;  2YBT A;  3WD2 A;  4DWS B;  2DK1 A;  5E66 A;  2DT1 A;  2WLZ A;  5E62 A;  1IX5 A;  1K9T A;  3O5M A;  4S3K A;  2VCD A;  4QT3 A;  4MAV A;  4Z2I A;  3AS2 A;  4P8W A;  1JVW A;  3O5Q A;  4TW8 A;  3M7N A;  3RME A;  3O5F A;  1GOI A;  4C02 B;  3WD3 A;  1FKR A;  2PV3 A;  3I6C A;  2XP7 A;  1OGB A;  4HAR A;  2XP4 A;  4QIB A;  5GPG A;  2ZR4 A;  2WAE A;  3ARX A;  4GIV A;  1ROT A;  3CGM A;  3OOB A;  1J4I A;  3WD1 A;  1WB0 A;  1FKK A;  3ALF A;  2F21 A;  3O5L A;  2LGO A;  3UQI A;  2G8Z A;  1ITX A;  1W9P A;  2QRV A;  3MCB A;  3O5J A;  3ARO A;  2YSF A;  2DK7 A;  4WKH A;  4QT2 A;  4MNL A;  4DRQ A;  1PIN A;  2D9F A;  3UF8 A;  4ODL A;  2G41 A;  2YSB A;  5HTG A;  4G50 A;  1Q6I A;  1HKM A;  4DRH A;  1NWT A;  1O6W A;  1FKJ A;  1NSG A;  1UR8 A;  1TFV A;  4O2T A;  3ARR A;  4WKF A;  1JND A;  2JXW A;  1ZK6 A;  1HKK A;  2DSV A;  3MQG A;  3PRD A;  3CH9 A;  1W1Y A;  4IPX A;  3OA5 A;  4DT4 A;  4Z2H A;  1NH6 A;  1NWU A;  2ESC A;  3CHF A;  1UR9 A;  1N1A A;  3TDB A;  1FKG A;  3RM8 A;  1LL6 A;  3NTP A;  4WJX A;  1XHG A;  4DRO A;  4ZPV R;  2Y8N B;  2L4J A;  3M85 A;  4TW7 A;  1EG3 A;  2PV2 A;  4ODQ A;  1J4R A;  3LKX A;  3CHE A;  2IF4 A;  4AY1 A;  1FKH A;  3FXY A;  4QZV B;  2YSH A;  4MSP A;  3PRB A;  1YW5 A;  1NMW A;  1W9V A;  2RQS A;  3KAC A;  3PQH A;  2F2D A;  1TK7 A;  1QPF A;  2RUC A;  2ITK A;  1W1P A;  3IKD A;  2ZR5 A;  2MDI A;  1J4H A;  3IK8 A;  4WK9 A;  3NRK A;  4GGQ A;  1Q6U A;  1W1T A;  2DG4 A;  3AS3 A;  1E9L A;  2M8J A;  2MF9 A;  1F40 A;  2DJY A;  3MDY B;  4W9O A;  4A0T A;  1E6P A;  4TYO A;  1LG2 A;  3UQA A;  1NWS A;  1ZU8 A;  4L72 B;  5DF0 A;  1VF8 A;  1ZBK A;  1WAW A;  2XP9 A;  5HWC A;  1XRV A;  3B9E A;  5E64 A;  1D7H A;  2LPV A;  1K9Q A;  3KAH A;  2AWG A;  4ZPT R;  2KI3 A;  4J4O A;  1D7J A;  3KAD A;  3O5E A;  2ZQU A;  4TW6 A;  4MNM A;  1YAT A;  2MLX A;  4LGX A;  1D2K A;  4P8U A;  3AQU A;  3O5I A;  4ODR A;  1JNE A;  2MNT A;  4JFI A;  2PPN A;  1H0G A;  2EZ5 W;  3O5D A;  2E45 A;  2RUR A;  3RFW A;  3O5K A;  3O5R A;  1FKF A;  2A3B A;  2DWV A;  4P8V A;  4W9P A;  4DWS A;  3KAG A;  4DRJ A;  2FDM A;  3ARP A;  2ZAJ A;  2JV4 A;  2KXQ A;  4JFJ A;  4R0X A;  3PA7 A;  1NWR A;  3LE4 A;  1R9H A;  1Q1C A;  1E6Z A;  1LL4 A;  5E65 A;  2A3A A;  3ARY A;  2A3E A;  4Q7N A;  1FJD A;  1HXV A;  1BL4 A;  2MLY A;  1Y0O A;  3CGN A;  1FLC A;  3ART A;  3JXV A;  3CZ8 A;  5E5W A;  3FY1 A;  1ZL1 A;  2KGJ A;  2DSU A;  2PBC A;  1OWQ A;  1X6N A;  1ZBV A;  4LAY A;  3CHC A;  3B7X A;  4J4N A;  1E6R A;  4U86 A;  3GPK A;  3WH0 A;  3UI5 A;  2M8I A;  5GPR A;  1K9R A;  4DH0 A;  5GQB A;  4GLX A;  4U85 A;  4ODO A;  4JFL A;  2O92 A;  4WKA A;  4Z2J A;  1FFQ A;  3PR9 A;  5U47 A;  4DZ2 A;  2RUQ A;  4DWS D;  4JFM A;  1Q6H A;  2N87 A;  4G2P A;  2XPA A;  1RP5 A;  4IT4 A;  3UI4 A;  1X6L A;  1F8A B;  1PBK A;  4ODK A;  2YBU A;  1NMV A;  2RUD A;  1JMQ A;  4L3N A;  3RGC A;  2YSI A;  3AS1 A;  2DT2 A;  2JMF A;  4NZC A;  1B6C A;  2Q5A A;  2A3C A;  5HW7 A;  1EYM A;  1OGG A;  2DT0 A;  1SR0 A;  2WM0 A;  3O5O A;  1ZBC A;  1TR8 A;  1EQ3 A;  2BA1 A;  1A7X A;  2XP6 A;  4E5R A;  2OLH A;  2LJ4 A;  4KQZ A;  3G6M A;  3O5P A;  3RM9 A;  3JYM A;  5HWB A;  2LKN A;  2F4E A;  3ARQ A;  3H9R B;  4DWS C;  1C9H A;  4HBO A;  1FKT A;  3WQV A;  3WQW A;  1JNS A;  4MGV A;  2LAJ A;  4IT6 A;  3AS0 A;  2XP5 A;  1ZCN A;  1JNT A;  5HW6 A;  2KO7 A;  3WKZ A;  4LAW A;  1ROU A;  1QZ2 A;  4JFK A;  4ITZ A;  4LAV A;  4U84 A;  3KAB A;  5DEZ A;  4TNS A;  1FFR A;  1HJV A;  1HJW A;  1D7I A;  2PV1 A;  1GUV A;  4N19 A;  1WNO A;  1LL7 A;  3O5G A;  3EY6 A;  1I5H W;  4URI A;  2WAD A;  2IUZ A;  4NSB A;  1FKD A;  4TX0 A;  1RD6 A;  1QPL A;  5AHT A;  2VN1 A;  3G6L A;  1J6Y A;  1CTN A;  5I98 A;  1FKS A;  3WD4 A;  1ZBW A;  5D75 A;  4REX A;  4NNR A;  2ZQV A;  3WL1 A;  2O9O A;  2PPP A;  1LJY A;  4DIP A;  3JYJ A;  4FAP A;  2DMV A;  4HBE A;  4DRK A;  2ZQS A;  2L2S A;  1L1P A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...