2XP8A

Discovery of cell-active phenyl-imidazole pin1 inhibitors by structure-guided fragment evolution
Total Genus 43
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
43
sequence length
157
structure length
145
Chain Sequence
b'LPPGWEKAMSRSSGRVYYFNHITNASQWERPSEPARVRCSHLLVKHSQSRRPSSWRQEKITRTKEEALELINGYIQKIKSGEEDFESLASQFSDCSSAKARGDLGAFSRGQMQKPFEDASFALRTGEMSGPVFTDSGIHIILRTE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PEPTIDYL-PROLYL CIS-TRANS ISOMERASE NIMA-INTERACTING 1
publication title Discovery of Cell-Active Phenyl-Imidazole Pin1 Inhibitors by Structure-Guided Fragment Evolution.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Isomerase
total genus 43
structure length 145
sequence length 157
ec nomenclature ec 5.2.1.8: Peptidylprolyl isomerase.
pdb deposition date 2010-08-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00397 WW WW domain
A PF00639 Rotamase PPIC-type PPIASE domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.20.70.10 Mainly Beta Single Sheet Ubiquitin Ligase Nedd4; Chain: W; Ubiquitin Ligase Nedd4; Chain: W; 2xp8A01
3.10.50.40 Alpha Beta Roll Chitinase A; domain 3 Chitinase A; domain 3 2xp8A02
4JFJA 2DMVA 1FKKA 2K8IA 2ITKA 3LE4A 2XP5A 3JYJA 1QPFA 4FN2A 1D6OA 3UF8A 2ZR6A 4TNSA 3CGNA 2MLYA 2ZQTA 3B7XA 4DRPA 2D9FA 2JX8A 2PV3A 1JMQA 4QIBA 1FKSA 2DG3A 4W9OA 3KAIA 1ZK6A 2XP6A 1EQ3A 4W9QA 2MPHA 3RFWA 3L4HA 3PA7A 4TW6A 1HXVA 4TW8A 4TYOA 1YW5A 2M2AA 3PRBA 3FAPA 3EY6A 3UI5A 1F40A 2JXWA 2N87A 3JYMA 3O5FA 1FKGA 1NSGA 4E5RA 5BXJA 3O5OA 3MDYB 2ZQSA 3UI4A 4C02B 4LAVA 2KGJA 5B8IC 1B6CA 2DG4A 4DRNA 5DITA 4MSPA 5HW8A 1ROUA 3O5GA 1FJDA 2RUCA 2MF9A 2RQSA 5J6EA 3TCZA 2PBCA 5GPGA 2ZQVA 4DRHA 1O6WA 1BKFA 2XP9A 1FKBA 1YATA 2XP8A 1K9QA 1T11A 1ROTA 2MLXA 2KE0A 4U86A 2Q5AA 3O5DA 4NNRA 5HW7A 3UI6A 3TC5A 4GIVA 3TDBA 1K9RA 4O2TA 3UQIA 3M7NA 2M1IA 3UQBA 4QT2A 2JV4A 5I98A 2LPVA 3VAWA 2RURA 1J4HA 2KI3A 1FKJA 2UZ5A 4BF8A 2EZ5W 5HKGA 2PPPA 3KAGA 1FKIA 2RUDA 3PRDA 3CNGA 3GPKA 3KABA 1EG4A 1Q1CA 1WMVA 4JFLA 3O5KA 1WR7A 1FKHA 4JFIA 1L1PA 4FAPA 2LJ4A 1JNTA 4J4OA 2MNTA 1U79A 4DROA 4N19A 1R9HA 1KT1A 1BL4A 3IHZA 2M3OW 3O5MA 2KFWA 5DIUA 3KAHA 5AHTA 2Y78A 3KZ7A 1J4IA 3O5PA 2VN1A 4ODRA 4W9PA 1FKTA 1I5HW 3O5RA 3O5EA 3O5LA 1W26A 4QT3A 1JNSA 2F2DA 4ODLA 2YSFA 2MLZA 3IKGA 1KT0A 1EG3A 1Q6IA 4ODMA 1D7JA 2F4EA 2ZR4A 2KO7A 2DG9A 2KR7A 4DRKA 1EYMA 3RGCA 4TW7A 1FKRA 2ZAJA 1NMWA 5HTGA 4DH0A 2DK7A 3LUOA 3KACA 3O5QA 3JXVA 3CGMA 1FD9A 2XP7A 1FKFA 4U84A 2JZVA 2DJYA 2LGOA 4IQ2A 2AWGA 3UQAA 2F21A 1FAPA 2YSHA 1Y0OA 2XPBA 2IF4A 1FKDA 2M08A 1C9HA 2LAJA 1D7IA 2XPAA 3IK8A 5HT1A 1J6YA 4DRJA 3KCEA 4DRIA 1M5YA 3O5JA 4LAXA 2YSIA 2PPNA 5HW6A 5HWCA 1QPLA 4JFMA 2XP3A 4ODKA 2MDIA 2PV2A 2RUQA 2DWVA 4U85A 4ODOA 2YSGA 4DIPA 4DT4A 2OFNA 5DIVA 2LKNA 3I6CA 2RSEA 2PPOA 2KXQA 1P5QA 1JVWA 4R0XA 1Q6HA 3IKDA 2ZR5A 3H9RB 4TX0A 4G50A 1Q6UA 2VCDA 2YSBA 3NI6A 2ZQUA 3WH0A 4LAYA 4DZ3A 1N1AA 3M85A 1PBKA 4DRQA 1TK7A 2JMFA 2BA1A 3NTPA 4J4NA 4JFKA 2L4JA 2PV1A 1NMVA 1F8AB 1A7XA 2FKEA 4IPXA 4ODPA 2M8IA 1PINA 2RE3A 3OOBA 4JYSA 1ZCNA 2L2SA 5HUAA 4LAWA 4ITZA 3KAFA 3O5IA 4DRMA 5D75A 4IQCA 3ODKA 4G2PA 4ODQA 5HWBA 3KADA 1J4RA 1FKLA 2E45A 1QZ2A 2FAPA 2XP4A 1D7HA 4DZ2A 4MGVA 3NRKA 4ODNA 2M8JA 4REXA 4GGQA 5CQ2A 2DK1A 1TCOC
chains in the Genus database with same CATH superfamily
4JFJA 4W5UA 2DMVA 4ZPVR 1FKKA 3ARQA 2DSUA 2DT3A 2K8IA 2ITKA 3CHDA 1FFQA 3LE4A 2XP5A 4MNMA 5GPRA 3JYJA 1QPFA 4FN2A 2YAJB 1D6OA 4WKHA 1HKJA 4DWSC 3FY1A 3UF8A 2ZR6A 4TNSA 1ZBCA 3WKZA 3CGNA 2MLYA 3GTYX 2ZQTA 1LL4A 2F23A 3AS0A 3B7XA 4DRPA 2D9FA 2JX8A 2PV3A 1SYTA 1JMQA 1VF8A 1EHNA 4QIBA 1FKSA 2ESCA 2DG3A 4W9OA 4AY1A 1UR8A 3KAIA 3G6MA 4Z2JA 1X6NA 3CZ8A 3G6LA 1ZK6A 2YBUA 2XP6A 1E6RA 1ZL1A 5E5WA 2Y8NB 1LJYA 3RM8A 1EQ3A 5DF0A 4W9QA 2B31A 4QZVB 2MPHA 3L4HA 4TW6A 3FSCA 3PA7A 3RFWA 1HXVA 4TW8A 5E66A 4TYOA 1NWTA 1YW5A 2M2AA 3PRBA 3FAPA 2QF8A 3EY6A 4L72B 3UI5A 4Z2LA 1E15A 1F40A 2JXWA 2N87A 3JYMA 1NWUA 1FKGA 1NSGA 3O5FA 4E5RA 5BXJA 3O5OA 3MDYB 2ZQSA 3UI4A 4C02B 4LAVA 2KGJA 5B8IC 2WAEA 1B6CA 2DG4A 4DRNA 1LG2A 4NZCA 5DITA 3AQUA 3W4RA 4DWSB 4MSPA 5HW8A 3ARTA 1ROUA 4Z2GA 3ARZA 3O5GA 1FJDA 2RUCA 2MF9A 2DSWA 2RQSA 5J6EA 3TCZA 2PBCA 2WLZA 5GPGA 1RP5A 2ZQVA 4DRHA 1O6WA 1BKFA 2XP9A 1FKBA 1FLCA 4MTVA 1YATA 3WL0A 4NSBA 4DWSD 2XP8A 1K9QA 1T11A 1ROTA 2B5UB 2MLXA 4Q7NA 2KE0A 4U86A 2Q5AA 3O5DA 1E6NA 3BXWA 4NNRA 3ARPA 2WADA 1WAWA 2G41A 3CH9A 3UI6A 5HW7A 3ARYA 3TC5A 4GIVA 3TDBA 1K9RA 3ARRA 4O2TA 3UQIA 3M7NA 2M1IA 3UQBA 4QT2A 2JV4A 5I98A 2LPVA 4LGXA 3B9EA 3VAWA 2RURA 2O9OA 1K9TA 3PR9A 1J4HA 2KI3A 1FKJA 2UZ5A 4BF8A 5DO2A 2EZ5W 3PRAA 4KQZA 1ZBVA 5HKGA 2PPPA 3EIPA 3KAGA 1FKIA 1NWRA 2RUDA 3PRDA 3CNGA 1GRJA 3GPKA 3KABA 1EG4A 1Q1CA 1WMVA 4JFLA 3O5KA 4P8XA 1WR7A 1FKHA 4JFIA 2OWOA 3MQGA 1L1PA 1W1YA 1KFWA 4FAPA 2LJ4A 1JNTA 4J4OA 4MPKA 4HBOA 3RMEA 2MNTA 1NWSA 1U79A 4DROA 2YBTA 4N19A 4P8WA 1R9HA 1KT1A 4L3NA 1BL4A 4MNLA 3IHZA 1HJXA 2DPEA 2A3CA 2M3OW 3WQWA 1TR8A 3O5MA 2KFWA 5DIUA 1HKIA 1WB0A 3KAHA 5AHTA 2PN0A 1LL6A 2Y78A 3KZ7A 1J4IA 3O5PA 2VN1A 3ARWA 1GPFA 4ODRA 3WD3A 4W9PA 3LKXB 1W9PA 2DSZA 2A3BA 1I5HW 1FKTA 3O5RA 3O5EA 3O5LA 1W26A 1O6IA 3CHFA 3ARXA 2DT2A 2WM0A 1HKMA 1X6LA 5E64A 1HJWA 2PI6A 4QT3A 4WIWA 3B8SA 4MNJA 1JNSA 2F2DA 1OWQA 4ODLA 2YSFA 2O92A 2MLZA 1SR0A 3IKGA 1KT0A 3MCBB 4Q22A 4A0TA 1EG3A 3RM9A 3ARSA 1Q6IA 4ODMA 1E9LA 3FXYA 2EULA 3WD4A 4ML4A 1D7JA 2F4EA 3AROA 1EDQA 1W1VA 2ZR4A 2KO7A 4HBEA 2DG9A 2KR7A 1W1PA 4DRKA 1EYMA 3RGCA 4P8UA 1WNOA 4TW7A 2FDMA 3WQVA 1ZBKA 1FKRA 2ZAJA 1JNEA 1NMWA 2IUZA 5HTGA 1EIBA 4DH0A 2DK7A 3LUOA 2A3EA 3ALFA 4R5EA 3KACA 1HJVA 3O5QA 3JXVA 3CGMA 3WD0A 1FD9A 3AS2A 2XP7A 1FKFA 1W9VA 4UDMA 4U84A 3AS3A 2JZVA 4Z2KA 2DJYA 4Z2IA 2LGOA 3ALGA 1LG1A 4IQ2A 2OLHA 3BMBA 5DEZA 2AWGA 4XAKA 3UQAA 2F21A 1XHGA 4DWSA 5E65A 2G8ZA 1FAPA 2YSHA 1Y0OA 2XPBA 2IF4A 3FS8A 4WJXA 1FKDA 2M08A 1C9HA 2LAJA 1D7IA 2XPAA 3IK8A 5HT1A 1J6YA 4DRJA 3KCEA 4DRIA 1E44A 1M5YA 3OA5A 3B9AA 3O5JA 1ZBWA 1XRVA 4LAXA 2QRVA 2YSIA 3ARVA 4KR0B 3ARUA 5GQBA 2PPNA 3WD1A 1RD6A 5HW6A 5U47A 1LL7A 1LQ0A 5HWCA 2DT0A 3QOKA 1GOIA 1QPLA 4JFMA 2XP3A 5JH8A 4ODKA 2MDIA 2P4VA 3AS1A 4S3JA 2PV2A 1IX5A 1E6ZA 1OGGA 2RUQA 4S3KA 4URIA 2DWVA 4MNKA 1D2KA 4U85A 4ODOA 5HBFA 2YSGA 4DIPA 4DT4A 4ZPTR 2OFNA 5DIVA 2LKNA 3I6CA 2RSEA 3CHCA 2PPOA 4ZPWR 2KXQA 4PTMA 1P5QA 1JVWA 2WLYA 4R0XA 1Q6HA 3IKDA 4A0UA 2ZR5A 3H9RB 3RM4A 4TX0A 4G50A 1Q6UA 1W1TA 2VCDA 2YSBA 3NI6A 2ZQUA 3WH0A 4LAYA 4WKAA 3WD2A 4DZ3A 1HKKA 1UR9A 1H0IA 1N1AA 3M85A 1PBKA 4DRQA 1TK7A 4WKFA 4P8VA 3WL1A 2JMFA 2WK2A 2BA1A 2A3AA 3B9DA 3NTPA 4J4NA 4JFKA 1JCHB 1FFRA 2L4JA 4HARA 2PV1A 1NMVA 2DSVA 4WK9A 1NH6A 2ETNA 1F8AB 4MAVA 1A7XA 2FKEA 4IPXA 4ODPA 2M8IA 1PINA 2RE3A 3OOBA 3PQHA 3LKXA 4JYSA 4IT6A 1ZCNA 2L2SA 5HUAA 1ZB5A 4LAWA 4ITZA 3KAFA 4GLXA 3CHEA 3O5IA 4DRMA 5D75A 4Z2HA 4IQCA 3ODKA 3MCBA 1TFVA 4G2PA 4ODQA 5HWBA 1H0GA 1CTNA 3KADA 2DT1A 1OGBA 1J4RA 5E62A 1FKLA 3MQHA 2E45A 1QZ2A 1ITXA 2FAPA 3WIJA 3FSBA 4IT4A 4ZS6A 1W9UA 1ZU8A 2XP4A 1D7HA 4DZ2A 2AOSA 4MGVA 3NRKA 3GU0A 1GUVA 4ODNA 2M8JA 4REXA 4GGQA 5CQ2A 1JNDA 2DK1A 1TCOC 1E6PA
chains in the Genus database with same CATH topology
4JFJA 4W5UA 2DMVA 4ZPVR 1FKKA 3ARQA 2DSUA 2DT3A 2K8IA 2ITKA 3CHDA 1FFQA 3LE4A 2XP5A 4MNMA 5GPRA 3JYJA 1QPFA 4FN2A 2YAJB 1D6OA 4WKHA 1HKJA 4DWSC 3FY1A 3UF8A 2ZR6A 4TNSA 1ZBCA 3WKZA 3CGNA 2MLYA 2ZQTA 1LL4A 3AS0A 3B7XA 4DRPA 2D9FA 2JX8A 2PV3A 1SYTA 1JMQA 1VF8A 1EHNA 4QIBA 1FKSA 2ESCA 2DG3A 4W9OA 4AY1A 1UR8A 3KAIA 3G6MA 4Z2JA 1X6NA 3CZ8A 3G6LA 1ZK6A 2YBUA 2XP6A 1E6RA 1ZL1A 5E5WA 2Y8NB 1LJYA 3RM8A 1EQ3A 5DF0A 4W9QA 2B31A 4QZVB 2MPHA 3L4HA 4TW6A 3FSCA 3PA7A 3RFWA 1HXVA 4TW8A 5E66A 4TYOA 1NWTA 1YW5A 2M2AA 3PRBA 3FAPA 2QF8A 3EY6A 4L72B 3UI5A 4Z2LA 1E15A 1F40A 2JXWA 2N87A 3JYMA 1NWUA 1FKGA 1NSGA 3O5FA 4E5RA 5BXJA 3O5OA 3MDYB 2ZQSA 3UI4A 4C02B 4LAVA 2KGJA 5B8IC 2WAEA 1B6CA 2DG4A 4DRNA 1LG2A 4NZCA 5DITA 3AQUA 3W4RA 4DWSB 4MSPA 5HW8A 3ARTA 1ROUA 4Z2GA 3ARZA 3O5GA 1FJDA 2RUCA 2MF9A 2DSWA 2RQSA 5J6EA 3TCZA 2PBCA 2WLZA 5GPGA 1RP5A 2ZQVA 4DRHA 1O6WA 1BKFA 2XP9A 1FKBA 1FLCA 4MTVA 1YATA 3WL0A 4NSBA 4DWSD 2XP8A 1K9QA 1T11A 1ROTA 2MLXA 4Q7NA 2KE0A 4U86A 2Q5AA 3O5DA 1E6NA 3BXWA 4NNRA 3ARPA 2WADA 1WAWA 2G41A 3CH9A 3UI6A 5HW7A 3ARYA 3TC5A 4GIVA 3TDBA 1K9RA 3ARRA 4O2TA 3UQIA 3M7NA 2M1IA 3UQBA 4QT2A 2JV4A 5I98A 2LPVA 4LGXA 3B9EA 3VAWA 2RURA 2O9OA 1K9TA 3PR9A 1J4HA 2KI3A 1FKJA 2UZ5A 4BF8A 5DO2A 2EZ5W 3PRAA 4KQZA 1ZBVA 5HKGA 2PPPA 3KAGA 1FKIA 1NWRA 2RUDA 3PRDA 3CNGA 3GPKA 3KABA 1EG4A 1Q1CA 1WMVA 4JFLA 3O5KA 4P8XA 1WR7A 1FKHA 4JFIA 2OWOA 3MQGA 1L1PA 1W1YA 1KFWA 4FAPA 2LJ4A 1JNTA 4J4OA 4MPKA 4HBOA 3RMEA 2MNTA 1NWSA 1U79A 4DROA 2YBTA 4N19A 4P8WA 1R9HA 1KT1A 4L3NA 1BL4A 4MNLA 3IHZA 1HJXA 2DPEA 2A3CA 2M3OW 3WQWA 1TR8A 3O5MA 2KFWA 5DIUA 1HKIA 1WB0A 3KAHA 5AHTA 1LL6A 2Y78A 3KZ7A 1J4IA 3O5PA 2VN1A 3ARWA 1GPFA 4ODRA 3WD3A 4W9PA 3LKXB 1W9PA 2DSZA 2A3BA 1I5HW 1FKTA 3O5RA 3O5EA 3O5LA 1W26A 1O6IA 3CHFA 3ARXA 2DT2A 2WM0A 1HKMA 1X6LA 5E64A 1HJWA 2PI6A 4QT3A 4WIWA 3B8SA 4MNJA 1JNSA 2F2DA 1OWQA 4ODLA 2YSFA 2O92A 2MLZA 1SR0A 3IKGA 1KT0A 3MCBB 4Q22A 4A0TA 1EG3A 3RM9A 3ARSA 1Q6IA 4ODMA 1E9LA 3FXYA 3WD4A 4ML4A 1D7JA 2F4EA 3AROA 1EDQA 1W1VA 2ZR4A 2KO7A 4HBEA 2DG9A 2KR7A 1W1PA 4DRKA 1EYMA 3RGCA 4P8UA 1WNOA 4TW7A 2FDMA 3WQVA 1ZBKA 1FKRA 2ZAJA 1JNEA 1NMWA 2IUZA 5HTGA 1EIBA 4DH0A 2DK7A 3LUOA 2A3EA 3ALFA 4R5EA 3KACA 1HJVA 3O5QA 3JXVA 3CGMA 3WD0A 1FD9A 3AS2A 2XP7A 1FKFA 1W9VA 4U84A 3AS3A 2JZVA 4Z2KA 2DJYA 4Z2IA 2LGOA 3ALGA 1LG1A 4IQ2A 2OLHA 5DEZA 2AWGA 4XAKA 3UQAA 2F21A 1XHGA 4DWSA 5E65A 2G8ZA 1FAPA 2YSHA 1Y0OA 2XPBA 2IF4A 3FS8A 4WJXA 1FKDA 2M08A 1C9HA 2LAJA 1D7IA 2XPAA 3IK8A 5HT1A 1J6YA 4DRJA 3KCEA 4DRIA 1M5YA 3OA5A 3B9AA 3O5JA 1ZBWA 1XRVA 4LAXA 2QRVA 2YSIA 3ARVA 4KR0B 3ARUA 5GQBA 2PPNA 3WD1A 1RD6A 5HW6A 5U47A 1LL7A 1LQ0A 5HWCA 2DT0A 3QOKA 1GOIA 1QPLA 4JFMA 2XP3A 5JH8A 4ODKA 2MDIA 3AS1A 4S3JA 2PV2A 1IX5A 1E6ZA 1OGGA 2RUQA 4S3KA 4URIA 2DWVA 4MNKA 1D2KA 4U85A 4ODOA 5HBFA 2YSGA 4DIPA 4DT4A 4ZPTR 2OFNA 5DIVA 2LKNA 3I6CA 2RSEA 3CHCA 2PPOA 4ZPWR 2KXQA 4PTMA 1P5QA 1JVWA 2WLYA 4R0XA 1Q6HA 3IKDA 4A0UA 2ZR5A 3H9RB 3RM4A 4TX0A 4G50A 1Q6UA 1W1TA 2VCDA 2YSBA 3NI6A 2ZQUA 3WH0A 4LAYA 4WKAA 3WD2A 4DZ3A 1HKKA 1UR9A 1H0IA 1N1AA 3M85A 1PBKA 4DRQA 1TK7A 4WKFA 4P8VA 3WL1A 2JMFA 2WK2A 2BA1A 2A3AA 3B9DA 3NTPA 4J4NA 4JFKA 1FFRA 2L4JA 4HARA 2PV1A 1NMVA 2DSVA 4WK9A 1NH6A 1F8AB 4MAVA 1A7XA 2FKEA 4IPXA 4ODPA 2M8IA 1PINA 2RE3A 3OOBA 3PQHA 3LKXA 4JYSA 4IT6A 1ZCNA 2L2SA 5HUAA 1ZB5A 4LAWA 4ITZA 3KAFA 4GLXA 3CHEA 3O5IA 4DRMA 5D75A 4Z2HA 4IQCA 3ODKA 3MCBA 1TFVA 4G2PA 4ODQA 5HWBA 1H0GA 1CTNA 3KADA 2DT1A 1OGBA 1J4RA 5E62A 1FKLA 3MQHA 2E45A 1QZ2A 1ITXA 2FAPA 3WIJA 3FSBA 4IT4A 4ZS6A 1W9UA 1ZU8A 2XP4A 1D7HA 4DZ2A 2AOSA 4MGVA 3NRKA 1GUVA 4ODNA 2M8JA 4REXA 4GGQA 5CQ2A 1JNDA 2DK1A 1TCOC 1E6PA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4JFJ A;  2DMV A;  1FKK A;  2K8I A;  2ITK A;  3LE4 A;  2XP5 A;  3JYJ A;  1QPF A;  4FN2 A;  1D6O A;  3UF8 A;  2ZR6 A;  4TNS A;  3CGN A;  2MLY A;  2ZQT A;  3B7X A;  4DRP A;  2D9F A;  2JX8 A;  2PV3 A;  1JMQ A;  4QIB A;  1FKS A;  2DG3 A;  4W9O A;  3KAI A;  1ZK6 A;  2XP6 A;  1EQ3 A;  4W9Q A;  2MPH A;  3RFW A;  3L4H A;  3PA7 A;  4TW6 A;  1HXV A;  4TW8 A;  4TYO A;  1YW5 A;  2M2A A;  3PRB A;  3FAP A;  3EY6 A;  3UI5 A;  1F40 A;  2JXW A;  2N87 A;  3JYM A;  3O5F A;  1FKG A;  1NSG A;  4E5R A;  5BXJ A;  3O5O A;  3MDY B;  2ZQS A;  3UI4 A;  4C02 B;  4LAV A;  2KGJ A;  5B8I C;  1B6C A;  2DG4 A;  4DRN A;  5DIT A;  4MSP A;  5HW8 A;  1ROU A;  3O5G A;  1FJD A;  2RUC A;  2MF9 A;  2RQS A;  5J6E A;  3TCZ A;  2PBC A;  5GPG A;  2ZQV A;  4DRH A;  1O6W A;  1BKF A;  2XP9 A;  1FKB A;  1YAT A;  2XP8 A;  1K9Q A;  1T11 A;  1ROT A;  2MLX A;  2KE0 A;  4U86 A;  2Q5A A;  3O5D A;  4NNR A;  5HW7 A;  3UI6 A;  3TC5 A;  4GIV A;  3TDB A;  1K9R A;  4O2T A;  3UQI A;  3M7N A;  2M1I A;  3UQB A;  4QT2 A;  2JV4 A;  5I98 A;  2LPV A;  3VAW A;  2RUR A;  1J4H A;  2KI3 A;  1FKJ A;  2UZ5 A;  4BF8 A;  2EZ5 W;  5HKG A;  2PPP A;  3KAG A;  1FKI A;  2RUD A;  3PRD A;  3CNG A;  3GPK A;  3KAB A;  1EG4 A;  1Q1C A;  1WMV A;  4JFL A;  3O5K A;  1WR7 A;  1FKH A;  4JFI A;  1L1P A;  4FAP A;  2LJ4 A;  1JNT A;  4J4O A;  2MNT A;  1U79 A;  4DRO A;  4N19 A;  1R9H A;  1KT1 A;  1BL4 A;  3IHZ A;  2M3O W;  3O5M A;  2KFW A;  5DIU A;  3KAH A;  5AHT A;  2Y78 A;  3KZ7 A;  1J4I A;  3O5P A;  2VN1 A;  4ODR A;  4W9P A;  1FKT A;  1I5H W;  3O5R A;  3O5E A;  3O5L A;  1W26 A;  4QT3 A;  1JNS A;  2F2D A;  4ODL A;  2YSF A;  2MLZ A;  3IKG A;  1KT0 A;  1EG3 A;  1Q6I A;  4ODM A;  1D7J A;  2F4E A;  2ZR4 A;  2KO7 A;  2DG9 A;  2KR7 A;  4DRK A;  1EYM A;  3RGC A;  4TW7 A;  1FKR A;  2ZAJ A;  1NMW A;  5HTG A;  4DH0 A;  2DK7 A;  3LUO A;  3KAC A;  3O5Q A;  3JXV A;  3CGM A;  1FD9 A;  2XP7 A;  1FKF A;  4U84 A;  2JZV A;  2DJY A;  2LGO A;  4IQ2 A;  2AWG A;  3UQA A;  2F21 A;  1FAP A;  2YSH A;  1Y0O A;  2XPB A;  2IF4 A;  1FKD A;  2M08 A;  1C9H A;  2LAJ A;  1D7I A;  2XPA A;  3IK8 A;  5HT1 A;  1J6Y A;  4DRJ A;  3KCE A;  4DRI A;  1M5Y A;  3O5J A;  4LAX A;  2YSI A;  2PPN A;  5HW6 A;  5HWC A;  1QPL A;  4JFM A;  2XP3 A;  4ODK A;  2MDI A;  2PV2 A;  2RUQ A;  2DWV A;  4U85 A;  4ODO A;  2YSG A;  4DIP A;  4DT4 A;  2OFN A;  5DIV A;  2LKN A;  3I6C A;  2RSE A;  2PPO A;  2KXQ A;  1P5Q A;  1JVW A;  4R0X A;  1Q6H A;  3IKD A;  2ZR5 A;  3H9R B;  4TX0 A;  4G50 A;  1Q6U A;  2VCD A;  2YSB A;  3NI6 A;  2ZQU A;  3WH0 A;  4LAY A;  4DZ3 A;  1N1A A;  3M85 A;  1PBK A;  4DRQ A;  1TK7 A;  2JMF A;  2BA1 A;  3NTP A;  4J4N A;  4JFK A;  2L4J A;  2PV1 A;  1NMV A;  1F8A B;  1A7X A;  2FKE A;  4IPX A;  4ODP A;  2M8I A;  1PIN A;  2RE3 A;  3OOB A;  4JYS A;  1ZCN A;  2L2S A;  5HUA A;  4LAW A;  4ITZ A;  3KAF A;  3O5I A;  4DRM A;  5D75 A;  4IQC A;  3ODK A;  4G2P A;  4ODQ A;  5HWB A;  3KAD A;  1J4R A;  1FKL A;  2E45 A;  1QZ2 A;  2FAP A;  2XP4 A;  1D7H A;  4DZ2 A;  4MGV A;  3NRK A;  4ODN A;  2M8J A;  4REX A;  4GGQ A;  5CQ2 A;  2DK1 A;  1TCO C; 
#chains in the Genus database with same CATH topology
 4JFJ A;  4W5U A;  2DMV A;  4ZPV R;  1FKK A;  3ARQ A;  2DSU A;  2DT3 A;  2K8I A;  2ITK A;  3CHD A;  1FFQ A;  3LE4 A;  2XP5 A;  4MNM A;  5GPR A;  3JYJ A;  1QPF A;  4FN2 A;  2YAJ B;  1D6O A;  4WKH A;  1HKJ A;  4DWS C;  3FY1 A;  3UF8 A;  2ZR6 A;  4TNS A;  1ZBC A;  3WKZ A;  3CGN A;  2MLY A;  3GTY X;  2ZQT A;  1LL4 A;  2F23 A;  3AS0 A;  3B7X A;  4DRP A;  2D9F A;  2JX8 A;  2PV3 A;  1SYT A;  1JMQ A;  1VF8 A;  1EHN A;  4QIB A;  1FKS A;  2ESC A;  2DG3 A;  4W9O A;  4AY1 A;  1UR8 A;  3KAI A;  3G6M A;  4Z2J A;  1X6N A;  3CZ8 A;  3G6L A;  1ZK6 A;  2YBU A;  2XP6 A;  1E6R A;  1ZL1 A;  5E5W A;  2Y8N B;  1LJY A;  3RM8 A;  1EQ3 A;  5DF0 A;  4W9Q A;  2B31 A;  4QZV B;  2MPH A;  3L4H A;  4TW6 A;  3FSC A;  3PA7 A;  3RFW A;  1HXV A;  4TW8 A;  5E66 A;  4TYO A;  1NWT A;  1YW5 A;  2M2A A;  3PRB A;  3FAP A;  2QF8 A;  3EY6 A;  4L72 B;  3UI5 A;  4Z2L A;  1E15 A;  1F40 A;  2JXW A;  2N87 A;  3JYM A;  1NWU A;  1FKG A;  1NSG A;  3O5F A;  4E5R A;  5BXJ A;  3O5O A;  3MDY B;  2ZQS A;  3UI4 A;  4C02 B;  4LAV A;  2KGJ A;  5B8I C;  2WAE A;  1B6C A;  2DG4 A;  4DRN A;  1LG2 A;  4NZC A;  5DIT A;  3AQU A;  3W4R A;  4DWS B;  4MSP A;  5HW8 A;  3ART A;  1ROU A;  4Z2G A;  3ARZ A;  3O5G A;  1FJD A;  2RUC A;  2MF9 A;  2DSW A;  2RQS A;  5J6E A;  3TCZ A;  2PBC A;  2WLZ A;  5GPG A;  1RP5 A;  2ZQV A;  4DRH A;  1O6W A;  1BKF A;  2XP9 A;  1FKB A;  1FLC A;  4MTV A;  1YAT A;  3WL0 A;  4NSB A;  4DWS D;  2XP8 A;  1K9Q A;  1T11 A;  1ROT A;  2B5U B;  2MLX A;  4Q7N A;  2KE0 A;  4U86 A;  2Q5A A;  3O5D A;  1E6N A;  3BXW A;  4NNR A;  3ARP A;  2WAD A;  1WAW A;  2G41 A;  3CH9 A;  3UI6 A;  5HW7 A;  3ARY A;  3TC5 A;  4GIV A;  3TDB A;  1K9R A;  3ARR A;  4O2T A;  3UQI A;  3M7N A;  2M1I A;  3UQB A;  4QT2 A;  2JV4 A;  5I98 A;  2LPV A;  4LGX A;  3B9E A;  3VAW A;  2RUR A;  2O9O A;  1K9T A;  3PR9 A;  1J4H A;  2KI3 A;  1FKJ A;  2UZ5 A;  4BF8 A;  5DO2 A;  2EZ5 W;  3PRA A;  4KQZ A;  1ZBV A;  5HKG A;  2PPP A;  3EIP A;  3KAG A;  1FKI A;  1NWR A;  2RUD A;  3PRD A;  3CNG A;  1GRJ A;  3GPK A;  3KAB A;  1EG4 A;  1Q1C A;  1WMV A;  4JFL A;  3O5K A;  4P8X A;  1WR7 A;  1FKH A;  4JFI A;  2OWO A;  3MQG A;  1L1P A;  1W1Y A;  1KFW A;  4FAP A;  2LJ4 A;  1JNT A;  4J4O A;  4MPK A;  4HBO A;  3RME A;  2MNT A;  1NWS A;  1U79 A;  4DRO A;  2YBT A;  4N19 A;  4P8W A;  1R9H A;  1KT1 A;  4L3N A;  1BL4 A;  4MNL A;  3IHZ A;  1HJX A;  2DPE A;  2A3C A;  2M3O W;  3WQW A;  1TR8 A;  3O5M A;  2KFW A;  5DIU A;  1HKI A;  1WB0 A;  3KAH A;  5AHT A;  2PN0 A;  1LL6 A;  2Y78 A;  3KZ7 A;  1J4I A;  3O5P A;  2VN1 A;  3ARW A;  1GPF A;  4ODR A;  3WD3 A;  4W9P A;  3LKX B;  1W9P A;  2DSZ A;  2A3B A;  1I5H W;  1FKT A;  3O5R A;  3O5E A;  3O5L A;  1W26 A;  1O6I A;  3CHF A;  3ARX A;  2DT2 A;  2WM0 A;  1HKM A;  1X6L A;  5E64 A;  1HJW A;  2PI6 A;  4QT3 A;  4WIW A;  3B8S A;  4MNJ A;  1JNS A;  2F2D A;  1OWQ A;  4ODL A;  2YSF A;  2O92 A;  2MLZ A;  1SR0 A;  3IKG A;  1KT0 A;  3MCB B;  4Q22 A;  4A0T A;  1EG3 A;  3RM9 A;  3ARS A;  1Q6I A;  4ODM A;  1E9L A;  3FXY A;  2EUL A;  3WD4 A;  4ML4 A;  1D7J A;  2F4E A;  3ARO A;  1EDQ A;  1W1V A;  2ZR4 A;  2KO7 A;  4HBE A;  2DG9 A;  2KR7 A;  1W1P A;  4DRK A;  1EYM A;  3RGC A;  4P8U A;  1WNO A;  4TW7 A;  2FDM A;  3WQV A;  1ZBK A;  1FKR A;  2ZAJ A;  1JNE A;  1NMW A;  2IUZ A;  5HTG A;  1EIB A;  4DH0 A;  2DK7 A;  3LUO A;  2A3E A;  3ALF A;  4R5E A;  3KAC A;  1HJV A;  3O5Q A;  3JXV A;  3CGM A;  3WD0 A;  1FD9 A;  3AS2 A;  2XP7 A;  1FKF A;  1W9V A;  4UDM A;  4U84 A;  3AS3 A;  2JZV A;  4Z2K A;  2DJY A;  4Z2I A;  2LGO A;  3ALG A;  1LG1 A;  4IQ2 A;  2OLH A;  3BMB A;  5DEZ A;  2AWG A;  4XAK A;  3UQA A;  2F21 A;  1XHG A;  4DWS A;  5E65 A;  2G8Z A;  1FAP A;  2YSH A;  1Y0O A;  2XPB A;  2IF4 A;  3FS8 A;  4WJX A;  1FKD A;  2M08 A;  1C9H A;  2LAJ A;  1D7I A;  2XPA A;  3IK8 A;  5HT1 A;  1J6Y A;  4DRJ A;  3KCE A;  4DRI A;  1E44 A;  1M5Y A;  3OA5 A;  3B9A A;  3O5J A;  1ZBW A;  1XRV A;  4LAX A;  2QRV A;  2YSI A;  3ARV A;  4KR0 B;  3ARU A;  5GQB A;  2PPN A;  3WD1 A;  1RD6 A;  5HW6 A;  5U47 A;  1LL7 A;  1LQ0 A;  5HWC A;  2DT0 A;  3QOK A;  1GOI A;  1QPL A;  4JFM A;  2XP3 A;  5JH8 A;  4ODK A;  2MDI A;  2P4V A;  3AS1 A;  4S3J A;  2PV2 A;  1IX5 A;  1E6Z A;  1OGG A;  2RUQ A;  4S3K A;  4URI A;  2DWV A;  4MNK A;  1D2K A;  4U85 A;  4ODO A;  5HBF A;  2YSG A;  4DIP A;  4DT4 A;  4ZPT R;  2OFN A;  5DIV A;  2LKN A;  3I6C A;  2RSE A;  3CHC A;  2PPO A;  4ZPW R;  2KXQ A;  4PTM A;  1P5Q A;  1JVW A;  2WLY A;  4R0X A;  1Q6H A;  3IKD A;  4A0U A;  2ZR5 A;  3H9R B;  3RM4 A;  4TX0 A;  4G50 A;  1Q6U A;  1W1T A;  2VCD A;  2YSB A;  3NI6 A;  2ZQU A;  3WH0 A;  4LAY A;  4WKA A;  3WD2 A;  4DZ3 A;  1HKK A;  1UR9 A;  1H0I A;  1N1A A;  3M85 A;  1PBK A;  4DRQ A;  1TK7 A;  4WKF A;  4P8V A;  3WL1 A;  2JMF A;  2WK2 A;  2BA1 A;  2A3A A;  3B9D A;  3NTP A;  4J4N A;  4JFK A;  1JCH B;  1FFR A;  2L4J A;  4HAR A;  2PV1 A;  1NMV A;  2DSV A;  4WK9 A;  1NH6 A;  2ETN A;  1F8A B;  4MAV A;  1A7X A;  2FKE A;  4IPX A;  4ODP A;  2M8I A;  1PIN A;  2RE3 A;  3OOB A;  3PQH A;  3LKX A;  4JYS A;  4IT6 A;  1ZCN A;  2L2S A;  5HUA A;  1ZB5 A;  4LAW A;  4ITZ A;  3KAF A;  4GLX A;  3CHE A;  3O5I A;  4DRM A;  5D75 A;  4Z2H A;  4IQC A;  3ODK A;  3MCB A;  1TFV A;  4G2P A;  4ODQ A;  5HWB A;  1H0G A;  1CTN A;  3KAD A;  2DT1 A;  1OGB A;  1J4R A;  5E62 A;  1FKL A;  3MQH A;  2E45 A;  1QZ2 A;  1ITX A;  2FAP A;  3WIJ A;  3FSB A;  4IT4 A;  4ZS6 A;  1W9U A;  1ZU8 A;  2XP4 A;  1D7H A;  4DZ2 A;  2AOS A;  4MGV A;  3NRK A;  3GU0 A;  1GUV A;  4ODN A;  2M8J A;  4REX A;  4GGQ A;  5CQ2 A;  1JND A;  2DK1 A;  1TCO C;  1E6P A; 
#chains in the Genus database with same CATH homology
 4JFJ A;  4W5U A;  2DMV A;  4ZPV R;  1FKK A;  3ARQ A;  2DSU A;  2DT3 A;  2K8I A;  2ITK A;  3CHD A;  1FFQ A;  3LE4 A;  2XP5 A;  4MNM A;  5GPR A;  3JYJ A;  1QPF A;  4FN2 A;  2YAJ B;  1D6O A;  4WKH A;  1HKJ A;  4DWS C;  3FY1 A;  3UF8 A;  2ZR6 A;  4TNS A;  1ZBC A;  3WKZ A;  3CGN A;  2MLY A;  2ZQT A;  1LL4 A;  3AS0 A;  3B7X A;  4DRP A;  2D9F A;  2JX8 A;  2PV3 A;  1SYT A;  1JMQ A;  1VF8 A;  1EHN A;  4QIB A;  1FKS A;  2ESC A;  2DG3 A;  4W9O A;  4AY1 A;  1UR8 A;  3KAI A;  3G6M A;  4Z2J A;  1X6N A;  3CZ8 A;  3G6L A;  1ZK6 A;  2YBU A;  2XP6 A;  1E6R A;  1ZL1 A;  5E5W A;  2Y8N B;  1LJY A;  3RM8 A;  1EQ3 A;  5DF0 A;  4W9Q A;  2B31 A;  4QZV B;  2MPH A;  3L4H A;  4TW6 A;  3FSC A;  3PA7 A;  3RFW A;  1HXV A;  4TW8 A;  5E66 A;  4TYO A;  1NWT A;  1YW5 A;  2M2A A;  3PRB A;  3FAP A;  2QF8 A;  3EY6 A;  4L72 B;  3UI5 A;  4Z2L A;  1E15 A;  1F40 A;  2JXW A;  2N87 A;  3JYM A;  1NWU A;  1FKG A;  1NSG A;  3O5F A;  4E5R A;  5BXJ A;  3O5O A;  3MDY B;  2ZQS A;  3UI4 A;  4C02 B;  4LAV A;  2KGJ A;  5B8I C;  2WAE A;  1B6C A;  2DG4 A;  4DRN A;  1LG2 A;  4NZC A;  5DIT A;  3AQU A;  3W4R A;  4DWS B;  4MSP A;  5HW8 A;  3ART A;  1ROU A;  4Z2G A;  3ARZ A;  3O5G A;  1FJD A;  2RUC A;  2MF9 A;  2DSW A;  2RQS A;  5J6E A;  3TCZ A;  2PBC A;  2WLZ A;  5GPG A;  1RP5 A;  2ZQV A;  4DRH A;  1O6W A;  1BKF A;  2XP9 A;  1FKB A;  1FLC A;  4MTV A;  1YAT A;  3WL0 A;  4NSB A;  4DWS D;  2XP8 A;  1K9Q A;  1T11 A;  1ROT A;  2MLX A;  4Q7N A;  2KE0 A;  4U86 A;  2Q5A A;  3O5D A;  1E6N A;  3BXW A;  4NNR A;  3ARP A;  2WAD A;  1WAW A;  2G41 A;  3CH9 A;  3UI6 A;  5HW7 A;  3ARY A;  3TC5 A;  4GIV A;  3TDB A;  1K9R A;  3ARR A;  4O2T A;  3UQI A;  3M7N A;  2M1I A;  3UQB A;  4QT2 A;  2JV4 A;  5I98 A;  2LPV A;  4LGX A;  3B9E A;  3VAW A;  2RUR A;  2O9O A;  1K9T A;  3PR9 A;  1J4H A;  2KI3 A;  1FKJ A;  2UZ5 A;  4BF8 A;  5DO2 A;  2EZ5 W;  3PRA A;  4KQZ A;  1ZBV A;  5HKG A;  2PPP A;  3KAG A;  1FKI A;  1NWR A;  2RUD A;  3PRD A;  3CNG A;  3GPK A;  3KAB A;  1EG4 A;  1Q1C A;  1WMV A;  4JFL A;  3O5K A;  4P8X A;  1WR7 A;  1FKH A;  4JFI A;  2OWO A;  3MQG A;  1L1P A;  1W1Y A;  1KFW A;  4FAP A;  2LJ4 A;  1JNT A;  4J4O A;  4MPK A;  4HBO A;  3RME A;  2MNT A;  1NWS A;  1U79 A;  4DRO A;  2YBT A;  4N19 A;  4P8W A;  1R9H A;  1KT1 A;  4L3N A;  1BL4 A;  4MNL A;  3IHZ A;  1HJX A;  2DPE A;  2A3C A;  2M3O W;  3WQW A;  1TR8 A;  3O5M A;  2KFW A;  5DIU A;  1HKI A;  1WB0 A;  3KAH A;  5AHT A;  1LL6 A;  2Y78 A;  3KZ7 A;  1J4I A;  3O5P A;  2VN1 A;  3ARW A;  1GPF A;  4ODR A;  3WD3 A;  4W9P A;  3LKX B;  1W9P A;  2DSZ A;  2A3B A;  1I5H W;  1FKT A;  3O5R A;  3O5E A;  3O5L A;  1W26 A;  1O6I A;  3CHF A;  3ARX A;  2DT2 A;  2WM0 A;  1HKM A;  1X6L A;  5E64 A;  1HJW A;  2PI6 A;  4QT3 A;  4WIW A;  3B8S A;  4MNJ A;  1JNS A;  2F2D A;  1OWQ A;  4ODL A;  2YSF A;  2O92 A;  2MLZ A;  1SR0 A;  3IKG A;  1KT0 A;  3MCB B;  4Q22 A;  4A0T A;  1EG3 A;  3RM9 A;  3ARS A;  1Q6I A;  4ODM A;  1E9L A;  3FXY A;  3WD4 A;  4ML4 A;  1D7J A;  2F4E A;  3ARO A;  1EDQ A;  1W1V A;  2ZR4 A;  2KO7 A;  4HBE A;  2DG9 A;  2KR7 A;  1W1P A;  4DRK A;  1EYM A;  3RGC A;  4P8U A;  1WNO A;  4TW7 A;  2FDM A;  3WQV A;  1ZBK A;  1FKR A;  2ZAJ A;  1JNE A;  1NMW A;  2IUZ A;  5HTG A;  1EIB A;  4DH0 A;  2DK7 A;  3LUO A;  2A3E A;  3ALF A;  4R5E A;  3KAC A;  1HJV A;  3O5Q A;  3JXV A;  3CGM A;  3WD0 A;  1FD9 A;  3AS2 A;  2XP7 A;  1FKF A;  1W9V A;  4U84 A;  3AS3 A;  2JZV A;  4Z2K A;  2DJY A;  4Z2I A;  2LGO A;  3ALG A;  1LG1 A;  4IQ2 A;  2OLH A;  5DEZ A;  2AWG A;  4XAK A;  3UQA A;  2F21 A;  1XHG A;  4DWS A;  5E65 A;  2G8Z A;  1FAP A;  2YSH A;  1Y0O A;  2XPB A;  2IF4 A;  3FS8 A;  4WJX A;  1FKD A;  2M08 A;  1C9H A;  2LAJ A;  1D7I A;  2XPA A;  3IK8 A;  5HT1 A;  1J6Y A;  4DRJ A;  3KCE A;  4DRI A;  1M5Y A;  3OA5 A;  3B9A A;  3O5J A;  1ZBW A;  1XRV A;  4LAX A;  2QRV A;  2YSI A;  3ARV A;  4KR0 B;  3ARU A;  5GQB A;  2PPN A;  3WD1 A;  1RD6 A;  5HW6 A;  5U47 A;  1LL7 A;  1LQ0 A;  5HWC A;  2DT0 A;  3QOK A;  1GOI A;  1QPL A;  4JFM A;  2XP3 A;  5JH8 A;  4ODK A;  2MDI A;  3AS1 A;  4S3J A;  2PV2 A;  1IX5 A;  1E6Z A;  1OGG A;  2RUQ A;  4S3K A;  4URI A;  2DWV A;  4MNK A;  1D2K A;  4U85 A;  4ODO A;  5HBF A;  2YSG A;  4DIP A;  4DT4 A;  4ZPT R;  2OFN A;  5DIV A;  2LKN A;  3I6C A;  2RSE A;  3CHC A;  2PPO A;  4ZPW R;  2KXQ A;  4PTM A;  1P5Q A;  1JVW A;  2WLY A;  4R0X A;  1Q6H A;  3IKD A;  4A0U A;  2ZR5 A;  3H9R B;  3RM4 A;  4TX0 A;  4G50 A;  1Q6U A;  1W1T A;  2VCD A;  2YSB A;  3NI6 A;  2ZQU A;  3WH0 A;  4LAY A;  4WKA A;  3WD2 A;  4DZ3 A;  1HKK A;  1UR9 A;  1H0I A;  1N1A A;  3M85 A;  1PBK A;  4DRQ A;  1TK7 A;  4WKF A;  4P8V A;  3WL1 A;  2JMF A;  2WK2 A;  2BA1 A;  2A3A A;  3B9D A;  3NTP A;  4J4N A;  4JFK A;  1FFR A;  2L4J A;  4HAR A;  2PV1 A;  1NMV A;  2DSV A;  4WK9 A;  1NH6 A;  1F8A B;  4MAV A;  1A7X A;  2FKE A;  4IPX A;  4ODP A;  2M8I A;  1PIN A;  2RE3 A;  3OOB A;  3PQH A;  3LKX A;  4JYS A;  4IT6 A;  1ZCN A;  2L2S A;  5HUA A;  1ZB5 A;  4LAW A;  4ITZ A;  3KAF A;  4GLX A;  3CHE A;  3O5I A;  4DRM A;  5D75 A;  4Z2H A;  4IQC A;  3ODK A;  3MCB A;  1TFV A;  4G2P A;  4ODQ A;  5HWB A;  1H0G A;  1CTN A;  3KAD A;  2DT1 A;  1OGB A;  1J4R A;  5E62 A;  1FKL A;  3MQH A;  2E45 A;  1QZ2 A;  1ITX A;  2FAP A;  3WIJ A;  3FSB A;  4IT4 A;  4ZS6 A;  1W9U A;  1ZU8 A;  2XP4 A;  1D7H A;  4DZ2 A;  2AOS A;  4MGV A;  3NRK A;  1GUV A;  4ODN A;  2M8J A;  4REX A;  4GGQ A;  5CQ2 A;  1JND A;  2DK1 A;  1TCO C;  1E6P A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...