2XP8A

Discovery of cell-active phenyl-imidazole pin1 inhibitors by structure-guided fragment evolution
Total Genus 43
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
43
sequence length
157
structure length
145
Chain Sequence
LPPGWEKAMSRSSGRVYYFNHITNASQWERPSEPARVRCSHLLVKHSQSRRPSSWRQEKITRTKEEALELINGYIQKIKSGEEDFESLASQFSDCSSAKARGDLGAFSRGQMQKPFEDASFALRTGEMSGPVFTDSGIHIILRTE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PEPTIDYL-PROLYL CIS-TRANS ISOMERASE NIMA-INTERACTING 1
publication title Discovery of Cell-Active Phenyl-Imidazole Pin1 Inhibitors by Structure-Guided Fragment Evolution.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Isomerase
total genus 43
structure length 145
sequence length 157
ec nomenclature ec 5.2.1.8: Peptidylprolyl isomerase.
pdb deposition date 2010-08-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00397 WW WW domain
A PF00639 Rotamase PPIC-type PPIASE domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.20.70.10 Mainly Beta Single Sheet Ubiquitin Ligase Nedd4; Chain: W; Ubiquitin Ligase Nedd4; Chain: W; 2xp8A01
3.10.50.40 Alpha Beta Roll Chitinase A; domain 3 Chitinase A; domain 3 2xp8A02
2YSIA 1T11A 2RUQA 4ODQA 5HWBA 1FKDA 3O5PA 3H9RB 2ZR5A 4G2PA 3IKGA 2XPBA 2XP8A 3KAIA 2BA1A 2PPOA 3ODKA 5HUAA 1M5YA 1J4RA 2KI3A 1W26A 3CNGA 2F4EA 3O5KA 1FKSA 1JNTA 2RQSA 3RGCA 5HW7A 2M08A 2IF4A 5HW6A 4DRPA 2ZQTA 2M3OW 5CQ2A 4DRHA 1F40A 2KXQA 4U84A 1D7JA 4GIVA 2YSFA 5I98A 2PV2A 5HW8A 2K8IA 4G50A 3KADA 5B8IC 2DWVA 2MDIA 1ZCNA 1I5HW 3O5LA 1FKKA 2DK7A 2MF9A 2KFWA 4REXA 4LAXA 4GGQA 3LE4A 3KACA 3IK8A 3PRBA 1JNSA 2KGJA 1FKBA 2XP4A 4QT2A 1O6WA 2AWGA 4TW7A 2MNTA 4DRMA 2PPNA 1EG3A 4O2TA 4LAYA 4DH0A 4ODMA 4TW8A 2JX8A 2ZQVA 1FKHA 2RUDA 1FKTA 4FAPA 5D75A 4BF8A 1FKRA 2JMFA 3O5MA 5BXJA 4JFKA 1NSGA 3B7XA 4MSPA 2F21A 4LAWA 4W9PA 1A7XA 4IQ2A 1J4HA 1B6CA 2DG4A 5DIVA 2FKEA 3O5OA 1QZ2A 4TNSA 2LAJA 5GPGA 1U79A 3LUOA 4QIBA 2MPHA 2XP5A 4N19A 1D7HA 5HTGA 4DRNA 1QPLA 2XP3A 3MDYB 3O5DA 1FAPA 2VCDA 2PV1A 3WH0A 2DK1A 2MLXA 1BKFA 1EG4A 3I6CA 2PV3A 3O5IA 4MGVA 2M8JA 1J4IA 3NTPA 2MLYA 5HT1A 2E45A 2KO7A 2Q5AA 2YSBA 2RE3A 4DZ3A 3IHZA 1FD9A 3JYMA 2LPVA 4FN2A 4TYOA 2N87A 1JMQA 3IKDA 2RUCA 2M1IA 1Y0OA 4U85A 2XPAA 2D9FA 4E5RA 1L1PA 4R0XA 4ODLA 1TK7A 3KAFA 2JV4A 2XP6A 4W9QA 1N1AA 3O5RA 3VAWA 2XP9A 4DROA 1EQ3A 2ZAJA 3O5JA 4IPXA 4DZ2A 1D7IA 2L2SA 2RURA 3O5GA 1WR7A 3NI6A 4U86A 2M2AA 3UI4A 3RFWA 4W9OA 2OFNA 1PBKA 3FAPA 5AHTA 1TCOC 4ITZA 4TX0A 3TDBA 4DRJA 3L4HA 4JYSA 2UZ5A 2DG9A 1NMWA 2JXWA 1JVWA 1HXVA 3NRKA 3M85A 1EYMA 2XP7A 3UI5A 1WMVA 1BL4A 3O5QA 4NNRA 5DITA 4J4NA 4JFJA 4DRKA 2DG3A 5DIUA 2M8IA 2KE0A 2YSHA 3M7NA 4ODOA 1F8AB 2YSGA 3CGNA 1FKJA 3KAHA 1FKFA 3EY6A 1J6YA 2LJ4A 3UQAA 1Q6HA 2DJYA 4DRQA 4IQCA 1Q6UA 1Q1CA 2FAPA 4DT4A 2LGOA 5J6EA 3OOBA 2KR7A 3JYJA 2MLZA 1FKIA 2VN1A 2DMVA 3KCEA 2Y78A 3GPKA 1D6OA 4LAVA 4J4OA 3KABA 1KT0A 3PRDA 3KAGA 2L4JA 3JXVA 3TC5A 1NMVA 2LKNA 1PINA 5HWCA 4QT3A 4DIPA 2ZR4A 2ZR6A 4ODKA 2F2DA 1ROUA 4ODRA 1FJDA 1ROTA 4ODPA 2ZQSA 3PA7A 4C02B 3CGMA 2PBCA 1Q6IA 3TCZA 3UQBA 2ITKA 2ZQUA 1FKGA 2RSEA 1P5QA 1FKLA 3UF8A 4ODNA 3O5FA 2EZ5W 4JFLA 1QPFA 1K9QA 3O5EA 3UQIA 1K9RA 2JZVA 4DRIA 1YATA 3UI6A 1YW5A 3KZ7A 1C9HA 1R9HA 1KT1A 4JFIA 2PPPA 4JFMA 4TW6A 5HKGA 1ZK6A
chains in the Genus database with same CATH superfamily
1X6LA 2YSIA 3ARYA 1T11A 2RUQA 4ODQA 5HWBA 1FKDA 3O5PA 3H9RB 2ZR5A 2O92A 1GUVA 4G2PA 3IKGA 2XPBA 4R5EA 2XP8A 1ZBWA 3KAIA 2BA1A 1TR8A 3PRAA 2PPOA 3ODKA 2DSZA 5HUAA 1M5YA 1J4RA 2KI3A 4KR0B 4PTMA 1W26A 3CNGA 2WADA 2F4EA 3WD4A 3O5KA 1FKSA 2B5UB 1JNTA 2RQSA 1W9VA 3RGCA 5HW7A 2DT2A 2DSVA 2M08A 4ZPWR 2IF4A 5HW6A 4DRPA 2ZQTA 2M3OW 5CQ2A 3MQHA 3LKXA 4IT6A 1TFVA 4DRHA 1F40A 2KXQA 4U84A 1D7JA 4GIVA 1JNEA 2YSFA 5I98A 2PV2A 5HW8A 2K8IA 4G50A 2A3AA 3KADA 1CTNA 5B8IC 2DWVA 2MDIA 1ZCNA 1I5HW 3O5LA 1FKKA 1H0IA 2DK7A 2MF9A 2KFWA 4REXA 4LAXA 4GGQA 1JCHB 3LE4A 3ARZA 2DT1A 1HKKA 3KACA 4Z2IA 4A0UA 3IK8A 3B9DA 3ALGA 3ARVA 3PRBA 1JNSA 2KGJA 4UDMA 1FKBA 1LL7A 1H0GA 2XP4A 4A0TA 4QT2A 1O6WA 2B31A 2AWGA 4TW7A 4Z2JA 2MNTA 4DRMA 4MPKA 2PPNA 1EG3A 4O2TA 4LAYA 4DH0A 4L3NA 4ODMA 4TW8A 4L72B 1SYTA 1HKIA 2JX8A 2OLHA 1K9TA 2ZQVA 4ML4A 1FKHA 2RUDA 1FKTA 4FAPA 1W1TA 1LG2A 3CHDA 5D75A 4BF8A 1FKRA 1UR8A 2JMFA 3O5MA 5BXJA 4JFKA 1D2KA 1NSGA 3OA5A 3B7XA 3G6LA 2WLYA 3RM4A 4MAVA 4MSPA 2F21A 2AOSA 1ZB5A 3PR9A 4HARA 1HKMA 4LAWA 3ARTA 4W9PA 3WL0A 3WD3A 1A7XA 4IQ2A 1J4HA 1LG1A 1B6CA 1RD6A 1WB0A 2DG4A 1E6RA 4MNLA 1LJYA 5DIVA 2FKEA 3O5OA 3RMEA 1QZ2A 4HBEA 1WAWA 3AS0A 1ITXA 4TNSA 3B9EA 2LAJA 5E65A 5GPGA 1U79A 1LL6A 4WK9A 3LUOA 1HJVA 4NZCA 4QIBA 4DWSA 2MPHA 2XP5A 2DSUA 2G41A 4N19A 1E9LA 1ZBCA 1D7HA 1EIBA 3WQWA 4LGXA 3FY1A 5HTGA 4DRNA 1QPLA 4AY1A 2XP3A 1GRJA 3MDYB 1IX5A 3AS2A 3O5DA 4Z2HA 4MNJA 1LQ0A 1FAPA 2VCDA 2EULA 2WM0A 2PV1A 3WH0A 3CHEA 4ZPVR 2DK1A 1RP5A 2MLXA 1BKFA 3MQGA 1EG4A 3WD2A 2DT0A 3FXYA 3I6CA 2PV3A 3O5IA 4MGVA 2M8JA 1J4IA 3NTPA 1WNOA 2MLYA 5HT1A 2E45A 2KO7A 2Q5AA 2YSBA 2RE3A 4DZ3A 3IHZA 1FD9A 1GOIA 1W1VA 5GQBA 3JYMA 5E5WA 2LPVA 5GPRA 2PI6A 4FN2A 4TYOA 3B8SA 2N87A 1JMQA 1E6PA 3IKDA 3AS1A 2RUCA 2M1IA 5HBFA 1Y0OA 3G6MA 4U85A 1OGGA 4Q7NA 4Z2GA 1UR9A 3WD0A 2XPAA 3MCBB 4E5RA 2D9FA 1L1PA 2A3CA 5E66A 4R0XA 4ODLA 4P8VA 1TK7A 3KAFA 2JV4A 2WAEA 2XP6A 2DPEA 3ARUA 2FDMA 2O9OA 4W9QA 2ESCA 1N1AA 2DT3A 3ARSA 1FLCA 3O5RA 3VAWA 2XP9A 1ZBKA 4S3JA 4DROA 1EQ3A 2YBTA 2ZAJA 1NWUA 3O5JA 4DWSD 4IPXA 3CH9A 3GU0A 4DZ2A 1D7IA 2L2SA 4WKHA 1FFQA 2RURA 4S3KA 3RM9A 3FSCA 3O5GA 2DSWA 1WR7A 4GLXA 4ZS6A 3NI6A 4WJXA 4U86A 2M2AA 3UI4A 4WIWA 3RFWA 4W9OA 2OFNA 1PBKA 3FAPA 3ALFA 5AHTA 3WKZA 1NWSA 3CHFA 1TCOC 4ITZA 4TX0A 4Z2KA 2WK2A 3TDBA 4MNKA 4P8WA 4DRJA 3ARRA 1E15A 1NWRA 4WKFA 3L4HA 4JYSA 3LKXB 4NSBA 2UZ5A 1XHGA 3WIJA 2DG9A 1NMWA 2JXWA 1JVWA 1HXVA 3NRKA 3M85A 1EYMA 2XP7A 1E6ZA 3W4RA 3UI5A 1WMVA 1BL4A 3O5QA 4NNRA 5DITA 4J4NA 4JFJA 5E64A 4DRKA 2DG3A 4KQZA 5DIUA 3ARQA 4QZVB 2IUZA 5DO2A 2M8IA 2KE0A 2YSHA 4W5UA 3QOKA 3M7NA 2QF8A 4WKAA 4ODOA 1F8AB 2YSGA 3CGNA 1FKJA 3ARXA 1OWQA 3BMBA 4P8XA 3KAHA 1FKFA 5JH8A 3EY6A 1J6YA 2LJ4A 3UQAA 1Q6HA 2DJYA 1W9PA 4DRQA 1SR0A 4IQCA 4URIA 2P4VA 3RM8A 1Q6UA 1Q1CA 2FAPA 3CHCA 3B9AA 2LGOA 4DT4A 5J6EA 1HKJA 4MTVA 3FSBA 3AS3A 3OOBA 3GTYX 2KR7A 3JYJA 2MLZA 1FKIA 2VN1A 2DMVA 3KCEA 2Y78A 3GPKA 1D6OA 4LAVA 4J4OA 2A3BA 2YBUA 1LL4A 1OGBA 3AROA 2PN0A 3KABA 1W9UA 2A3EA 1HJWA 1KT0A 2QRVA 1HJXA 5U47A 2ETNA 3PRDA 3KAGA 2L4JA 3JXVA 1W1PA 3TC5A 1NMVA 3WD1A 2LKNA 1PINA 1GPFA 3ARWA 1E6NA 3WQVA 5HWCA 4QT3A 4DIPA 1KFWA 1EHNA 2ZR4A 2ZR6A 2G8ZA 4ODKA 3WL1A 2F2DA 1NWTA 3AQUA 5DF0A 1X6NA 1ROUA 2Y8NB 4ODRA 1FJDA 1ROTA 4ODPA 2ZQSA 3PA7A 4C02B 4Z2LA 4MNMA 3CGMA 1JNDA 4IT4A 2WLZA 1E44A 1ZU8A 2PBCA 1NH6A 1ZL1A 4DWSB 4Q22A 1Q6IA 3TCZA 3UQBA 1O6IA 2ITKA 2ZQUA 1FKGA 2RSEA 3ARPA 1P5QA 1FKLA 2F23A 3UF8A 4ODNA 3O5FA 2OWOA 2EZ5W 3PQHA 1QPFA 1EDQA 4JFLA 1K9QA 3O5EA 3MCBA 5DEZA 3UQIA 1W1YA 1K9RA 5E62A 2YAJB 4ZPTR 2JZVA 4P8UA 4DRIA 4DWSC 1YATA 3BXWA 3UI6A 1YW5A 3KZ7A 4XAKA 1C9HA 1ZBVA 3EIPA 1R9HA 3FS8A 1KT1A 4JFIA 4HBOA 1FFRA 2PPPA 3CZ8A 1VF8A 4JFMA 4TW6A 5HKGA 1XRVA 1ZK6A
chains in the Genus database with same CATH topology
1X6LA 2YSIA 3ARYA 1T11A 2RUQA 4ODQA 5HWBA 1FKDA 3O5PA 3H9RB 2ZR5A 2O92A 1GUVA 4G2PA 3IKGA 2XPBA 4R5EA 2XP8A 1ZBWA 3KAIA 2BA1A 1TR8A 3PRAA 2PPOA 3ODKA 2DSZA 5HUAA 1M5YA 1J4RA 2KI3A 4KR0B 4PTMA 1W26A 3CNGA 2WADA 2F4EA 3WD4A 3O5KA 1FKSA 1JNTA 2RQSA 1W9VA 3RGCA 5HW7A 2DT2A 2DSVA 2M08A 4ZPWR 2IF4A 5HW6A 4DRPA 2ZQTA 2M3OW 5CQ2A 3MQHA 3LKXA 4IT6A 1TFVA 4DRHA 1F40A 2KXQA 4U84A 1D7JA 4GIVA 1JNEA 2YSFA 5I98A 2PV2A 5HW8A 2K8IA 4G50A 2A3AA 3KADA 1CTNA 5B8IC 2DWVA 2MDIA 1ZCNA 1I5HW 3O5LA 1FKKA 1H0IA 2DK7A 2MF9A 2KFWA 4REXA 4LAXA 4GGQA 3ARZA 3LE4A 2DT1A 1HKKA 3KACA 4Z2IA 4A0UA 3IK8A 3B9DA 3ALGA 3ARVA 3PRBA 1JNSA 2KGJA 1FKBA 1LL7A 1H0GA 2XP4A 4A0TA 4QT2A 1O6WA 2B31A 2AWGA 4TW7A 4Z2JA 2MNTA 4DRMA 4MPKA 2PPNA 1EG3A 4O2TA 4LAYA 4DH0A 4L3NA 4ODMA 4TW8A 4L72B 1SYTA 1HKIA 2JX8A 2OLHA 1K9TA 2ZQVA 4ML4A 1FKHA 2RUDA 1FKTA 4FAPA 1W1TA 1LG2A 3CHDA 5D75A 4BF8A 1FKRA 1UR8A 2JMFA 3O5MA 5BXJA 4JFKA 1D2KA 1NSGA 3OA5A 3B7XA 3G6LA 2WLYA 3RM4A 4MAVA 4MSPA 2F21A 2AOSA 1ZB5A 3PR9A 4HARA 1HKMA 4LAWA 3ARTA 4W9PA 3WL0A 3WD3A 1A7XA 4IQ2A 1J4HA 1LG1A 1B6CA 1RD6A 1WB0A 2DG4A 1E6RA 4MNLA 1LJYA 5DIVA 2FKEA 3O5OA 3RMEA 1QZ2A 4HBEA 1WAWA 3AS0A 1ITXA 4TNSA 3B9EA 2LAJA 5E65A 5GPGA 1U79A 1LL6A 4WK9A 3LUOA 1HJVA 4NZCA 4QIBA 4DWSA 2MPHA 2XP5A 2DSUA 2G41A 4N19A 1E9LA 1ZBCA 1D7HA 1EIBA 3WQWA 4LGXA 3FY1A 5HTGA 4DRNA 1QPLA 4AY1A 2XP3A 3MDYB 1IX5A 3AS2A 3O5DA 4Z2HA 4MNJA 1LQ0A 1FAPA 2VCDA 2WM0A 2PV1A 3WH0A 3CHEA 4ZPVR 2DK1A 1RP5A 2MLXA 1BKFA 3MQGA 1EG4A 3WD2A 2DT0A 3FXYA 3I6CA 2PV3A 3O5IA 4MGVA 2M8JA 1J4IA 3NTPA 1WNOA 2MLYA 5HT1A 2E45A 2KO7A 2Q5AA 2YSBA 2RE3A 4DZ3A 3IHZA 1FD9A 1GOIA 1W1VA 5GQBA 3JYMA 5E5WA 2LPVA 5GPRA 2PI6A 4FN2A 4TYOA 3B8SA 2N87A 1JMQA 1E6PA 3IKDA 3AS1A 2RUCA 2M1IA 5HBFA 1Y0OA 3G6MA 4U85A 1OGGA 4Q7NA 4Z2GA 1UR9A 3WD0A 2XPAA 3MCBB 4E5RA 2D9FA 1L1PA 2A3CA 5E66A 4R0XA 4ODLA 4P8VA 1TK7A 3KAFA 2JV4A 2WAEA 2XP6A 2DPEA 3ARUA 2FDMA 2O9OA 4W9QA 2ESCA 1N1AA 2DT3A 3ARSA 1FLCA 3O5RA 3VAWA 2XP9A 1ZBKA 4S3JA 4DROA 1EQ3A 2YBTA 2ZAJA 1NWUA 3O5JA 4DWSD 4IPXA 3CH9A 4DZ2A 1D7IA 2L2SA 4WKHA 1FFQA 2RURA 4S3KA 3RM9A 3FSCA 3O5GA 2DSWA 1WR7A 4GLXA 4ZS6A 3NI6A 4WJXA 4U86A 2M2AA 3UI4A 4WIWA 3RFWA 4W9OA 2OFNA 1PBKA 3FAPA 3ALFA 5AHTA 3WKZA 1NWSA 3CHFA 1TCOC 4ITZA 4TX0A 4Z2KA 2WK2A 3TDBA 4MNKA 4P8WA 4DRJA 3ARRA 1E15A 1NWRA 4WKFA 3L4HA 4JYSA 3LKXB 4NSBA 2UZ5A 1XHGA 3WIJA 2DG9A 1NMWA 2JXWA 1JVWA 1HXVA 3NRKA 3M85A 1EYMA 2XP7A 1E6ZA 3W4RA 3UI5A 1WMVA 1BL4A 3O5QA 4NNRA 5DITA 4J4NA 4JFJA 5E64A 4DRKA 2DG3A 4KQZA 5DIUA 3ARQA 4QZVB 2IUZA 5DO2A 2M8IA 2KE0A 2YSHA 4W5UA 3QOKA 3M7NA 2QF8A 4WKAA 4ODOA 1F8AB 2YSGA 3CGNA 1FKJA 3ARXA 1OWQA 4P8XA 3KAHA 1FKFA 5JH8A 3EY6A 1J6YA 2LJ4A 3UQAA 1Q6HA 2DJYA 1W9PA 4DRQA 1SR0A 4IQCA 4URIA 3RM8A 1Q6UA 1Q1CA 2FAPA 3CHCA 3B9AA 2LGOA 4DT4A 5J6EA 1HKJA 4MTVA 3FSBA 3AS3A 3OOBA 2KR7A 3JYJA 2MLZA 1FKIA 2VN1A 2DMVA 3KCEA 2Y78A 3GPKA 1D6OA 4LAVA 4J4OA 2A3BA 2YBUA 1LL4A 1OGBA 3AROA 3KABA 1W9UA 2A3EA 1HJWA 1KT0A 2QRVA 1HJXA 5U47A 3PRDA 3KAGA 2L4JA 3JXVA 1W1PA 3TC5A 1NMVA 3WD1A 2LKNA 1PINA 1GPFA 3ARWA 1E6NA 3WQVA 5HWCA 4QT3A 4DIPA 1KFWA 1EHNA 2ZR4A 2ZR6A 2G8ZA 4ODKA 3WL1A 2F2DA 1NWTA 3AQUA 5DF0A 1X6NA 1ROUA 2Y8NB 4ODRA 1FJDA 1ROTA 4ODPA 2ZQSA 3PA7A 4C02B 4Z2LA 4MNMA 3CGMA 1JNDA 4IT4A 2WLZA 1ZU8A 2PBCA 1NH6A 1ZL1A 4DWSB 4Q22A 1Q6IA 3TCZA 3UQBA 1O6IA 2ITKA 2ZQUA 1FKGA 2RSEA 3ARPA 1P5QA 1FKLA 3UF8A 4ODNA 3O5FA 2OWOA 2EZ5W 3PQHA 1QPFA 1EDQA 4JFLA 1K9QA 3O5EA 3MCBA 5DEZA 3UQIA 1W1YA 1K9RA 5E62A 2YAJB 4ZPTR 2JZVA 4P8UA 4DRIA 4DWSC 1YATA 3BXWA 3UI6A 1YW5A 3KZ7A 4XAKA 1C9HA 1ZBVA 1R9HA 3FS8A 1KT1A 4JFIA 4HBOA 1FFRA 2PPPA 3CZ8A 1VF8A 4JFMA 4TW6A 5HKGA 1XRVA 1ZK6A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2YSI A;  1T11 A;  2RUQ A;  4ODQ A;  5HWB A;  1FKD A;  3O5P A;  3H9R B;  2ZR5 A;  4G2P A;  3IKG A;  2XPB A;  2XP8 A;  3KAI A;  2BA1 A;  2PPO A;  3ODK A;  5HUA A;  1M5Y A;  1J4R A;  2KI3 A;  1W26 A;  3CNG A;  2F4E A;  3O5K A;  1FKS A;  1JNT A;  2RQS A;  3RGC A;  5HW7 A;  2M08 A;  2IF4 A;  5HW6 A;  4DRP A;  2ZQT A;  2M3O W;  5CQ2 A;  4DRH A;  1F40 A;  2KXQ A;  4U84 A;  1D7J A;  4GIV A;  2YSF A;  5I98 A;  2PV2 A;  5HW8 A;  2K8I A;  4G50 A;  3KAD A;  5B8I C;  2DWV A;  2MDI A;  1ZCN A;  1I5H W;  3O5L A;  1FKK A;  2DK7 A;  2MF9 A;  2KFW A;  4REX A;  4LAX A;  4GGQ A;  3LE4 A;  3KAC A;  3IK8 A;  3PRB A;  1JNS A;  2KGJ A;  1FKB A;  2XP4 A;  4QT2 A;  1O6W A;  2AWG A;  4TW7 A;  2MNT A;  4DRM A;  2PPN A;  1EG3 A;  4O2T A;  4LAY A;  4DH0 A;  4ODM A;  4TW8 A;  2JX8 A;  2ZQV A;  1FKH A;  2RUD A;  1FKT A;  4FAP A;  5D75 A;  4BF8 A;  1FKR A;  2JMF A;  3O5M A;  5BXJ A;  4JFK A;  1NSG A;  3B7X A;  4MSP A;  2F21 A;  4LAW A;  4W9P A;  1A7X A;  4IQ2 A;  1J4H A;  1B6C A;  2DG4 A;  5DIV A;  2FKE A;  3O5O A;  1QZ2 A;  4TNS A;  2LAJ A;  5GPG A;  1U79 A;  3LUO A;  4QIB A;  2MPH A;  2XP5 A;  4N19 A;  1D7H A;  5HTG A;  4DRN A;  1QPL A;  2XP3 A;  3MDY B;  3O5D A;  1FAP A;  2VCD A;  2PV1 A;  3WH0 A;  2DK1 A;  2MLX A;  1BKF A;  1EG4 A;  3I6C A;  2PV3 A;  3O5I A;  4MGV A;  2M8J A;  1J4I A;  3NTP A;  2MLY A;  5HT1 A;  2E45 A;  2KO7 A;  2Q5A A;  2YSB A;  2RE3 A;  4DZ3 A;  3IHZ A;  1FD9 A;  3JYM A;  2LPV A;  4FN2 A;  4TYO A;  2N87 A;  1JMQ A;  3IKD A;  2RUC A;  2M1I A;  1Y0O A;  4U85 A;  2XPA A;  2D9F A;  4E5R A;  1L1P A;  4R0X A;  4ODL A;  1TK7 A;  3KAF A;  2JV4 A;  2XP6 A;  4W9Q A;  1N1A A;  3O5R A;  3VAW A;  2XP9 A;  4DRO A;  1EQ3 A;  2ZAJ A;  3O5J A;  4IPX A;  4DZ2 A;  1D7I A;  2L2S A;  2RUR A;  3O5G A;  1WR7 A;  3NI6 A;  4U86 A;  2M2A A;  3UI4 A;  3RFW A;  4W9O A;  2OFN A;  1PBK A;  3FAP A;  5AHT A;  1TCO C;  4ITZ A;  4TX0 A;  3TDB A;  4DRJ A;  3L4H A;  4JYS A;  2UZ5 A;  2DG9 A;  1NMW A;  2JXW A;  1JVW A;  1HXV A;  3NRK A;  3M85 A;  1EYM A;  2XP7 A;  3UI5 A;  1WMV A;  1BL4 A;  3O5Q A;  4NNR A;  5DIT A;  4J4N A;  4JFJ A;  4DRK A;  2DG3 A;  5DIU A;  2M8I A;  2KE0 A;  2YSH A;  3M7N A;  4ODO A;  1F8A B;  2YSG A;  3CGN A;  1FKJ A;  3KAH A;  1FKF A;  3EY6 A;  1J6Y A;  2LJ4 A;  3UQA A;  1Q6H A;  2DJY A;  4DRQ A;  4IQC A;  1Q6U A;  1Q1C A;  2FAP A;  4DT4 A;  2LGO A;  5J6E A;  3OOB A;  2KR7 A;  3JYJ A;  2MLZ A;  1FKI A;  2VN1 A;  2DMV A;  3KCE A;  2Y78 A;  3GPK A;  1D6O A;  4LAV A;  4J4O A;  3KAB A;  1KT0 A;  3PRD A;  3KAG A;  2L4J A;  3JXV A;  3TC5 A;  1NMV A;  2LKN A;  1PIN A;  5HWC A;  4QT3 A;  4DIP A;  2ZR4 A;  2ZR6 A;  4ODK A;  2F2D A;  1ROU A;  4ODR A;  1FJD A;  1ROT A;  4ODP A;  2ZQS A;  3PA7 A;  4C02 B;  3CGM A;  2PBC A;  1Q6I A;  3TCZ A;  3UQB A;  2ITK A;  2ZQU A;  1FKG A;  2RSE A;  1P5Q A;  1FKL A;  3UF8 A;  4ODN A;  3O5F A;  2EZ5 W;  4JFL A;  1QPF A;  1K9Q A;  3O5E A;  3UQI A;  1K9R A;  2JZV A;  4DRI A;  1YAT A;  3UI6 A;  1YW5 A;  3KZ7 A;  1C9H A;  1R9H A;  1KT1 A;  4JFI A;  2PPP A;  4JFM A;  4TW6 A;  5HKG A;  1ZK6 A; 
#chains in the Genus database with same CATH topology
 1X6L A;  2YSI A;  3ARY A;  1T11 A;  2RUQ A;  4ODQ A;  5HWB A;  1FKD A;  3O5P A;  3H9R B;  2ZR5 A;  2O92 A;  1GUV A;  4G2P A;  3IKG A;  2XPB A;  4R5E A;  2XP8 A;  1ZBW A;  3KAI A;  2BA1 A;  1TR8 A;  3PRA A;  2PPO A;  3ODK A;  2DSZ A;  5HUA A;  1M5Y A;  1J4R A;  2KI3 A;  4KR0 B;  4PTM A;  1W26 A;  3CNG A;  2WAD A;  2F4E A;  3WD4 A;  3O5K A;  1FKS A;  2B5U B;  1JNT A;  2RQS A;  1W9V A;  3RGC A;  5HW7 A;  2DT2 A;  2DSV A;  2M08 A;  4ZPW R;  2IF4 A;  5HW6 A;  4DRP A;  2ZQT A;  2M3O W;  5CQ2 A;  3MQH A;  3LKX A;  4IT6 A;  1TFV A;  4DRH A;  1F40 A;  2KXQ A;  4U84 A;  1D7J A;  4GIV A;  1JNE A;  2YSF A;  5I98 A;  2PV2 A;  5HW8 A;  2K8I A;  4G50 A;  2A3A A;  3KAD A;  1CTN A;  5B8I C;  2DWV A;  2MDI A;  1ZCN A;  1I5H W;  3O5L A;  1FKK A;  1H0I A;  2DK7 A;  2MF9 A;  2KFW A;  4REX A;  4LAX A;  4GGQ A;  1JCH B;  3LE4 A;  3ARZ A;  2DT1 A;  1HKK A;  3KAC A;  4Z2I A;  4A0U A;  3IK8 A;  3B9D A;  3ALG A;  3ARV A;  3PRB A;  1JNS A;  2KGJ A;  4UDM A;  1FKB A;  1LL7 A;  1H0G A;  2XP4 A;  4A0T A;  4QT2 A;  1O6W A;  2B31 A;  2AWG A;  4TW7 A;  4Z2J A;  2MNT A;  4DRM A;  4MPK A;  2PPN A;  1EG3 A;  4O2T A;  4LAY A;  4DH0 A;  4L3N A;  4ODM A;  4TW8 A;  4L72 B;  1SYT A;  1HKI A;  2JX8 A;  2OLH A;  1K9T A;  2ZQV A;  4ML4 A;  1FKH A;  2RUD A;  1FKT A;  4FAP A;  1W1T A;  1LG2 A;  3CHD A;  5D75 A;  4BF8 A;  1FKR A;  1UR8 A;  2JMF A;  3O5M A;  5BXJ A;  4JFK A;  1D2K A;  1NSG A;  3OA5 A;  3B7X A;  3G6L A;  2WLY A;  3RM4 A;  4MAV A;  4MSP A;  2F21 A;  2AOS A;  1ZB5 A;  3PR9 A;  4HAR A;  1HKM A;  4LAW A;  3ART A;  4W9P A;  3WL0 A;  3WD3 A;  1A7X A;  4IQ2 A;  1J4H A;  1LG1 A;  1B6C A;  1RD6 A;  1WB0 A;  2DG4 A;  1E6R A;  4MNL A;  1LJY A;  5DIV A;  2FKE A;  3O5O A;  3RME A;  1QZ2 A;  4HBE A;  1WAW A;  3AS0 A;  1ITX A;  4TNS A;  3B9E A;  2LAJ A;  5E65 A;  5GPG A;  1U79 A;  1LL6 A;  4WK9 A;  3LUO A;  1HJV A;  4NZC A;  4QIB A;  4DWS A;  2MPH A;  2XP5 A;  2DSU A;  2G41 A;  4N19 A;  1E9L A;  1ZBC A;  1D7H A;  1EIB A;  3WQW A;  4LGX A;  3FY1 A;  5HTG A;  4DRN A;  1QPL A;  4AY1 A;  2XP3 A;  1GRJ A;  3MDY B;  1IX5 A;  3AS2 A;  3O5D A;  4Z2H A;  4MNJ A;  1LQ0 A;  1FAP A;  2VCD A;  2EUL A;  2WM0 A;  2PV1 A;  3WH0 A;  3CHE A;  4ZPV R;  2DK1 A;  1RP5 A;  2MLX A;  1BKF A;  3MQG A;  1EG4 A;  3WD2 A;  2DT0 A;  3FXY A;  3I6C A;  2PV3 A;  3O5I A;  4MGV A;  2M8J A;  1J4I A;  3NTP A;  1WNO A;  2MLY A;  5HT1 A;  2E45 A;  2KO7 A;  2Q5A A;  2YSB A;  2RE3 A;  4DZ3 A;  3IHZ A;  1FD9 A;  1GOI A;  1W1V A;  5GQB A;  3JYM A;  5E5W A;  2LPV A;  5GPR A;  2PI6 A;  4FN2 A;  4TYO A;  3B8S A;  2N87 A;  1JMQ A;  1E6P A;  3IKD A;  3AS1 A;  2RUC A;  2M1I A;  5HBF A;  1Y0O A;  3G6M A;  4U85 A;  1OGG A;  4Q7N A;  4Z2G A;  1UR9 A;  3WD0 A;  2XPA A;  3MCB B;  4E5R A;  2D9F A;  1L1P A;  2A3C A;  5E66 A;  4R0X A;  4ODL A;  4P8V A;  1TK7 A;  3KAF A;  2JV4 A;  2WAE A;  2XP6 A;  2DPE A;  3ARU A;  2FDM A;  2O9O A;  4W9Q A;  2ESC A;  1N1A A;  2DT3 A;  3ARS A;  1FLC A;  3O5R A;  3VAW A;  2XP9 A;  1ZBK A;  4S3J A;  4DRO A;  1EQ3 A;  2YBT A;  2ZAJ A;  1NWU A;  3O5J A;  4DWS D;  4IPX A;  3CH9 A;  3GU0 A;  4DZ2 A;  1D7I A;  2L2S A;  4WKH A;  1FFQ A;  2RUR A;  4S3K A;  3RM9 A;  3FSC A;  3O5G A;  2DSW A;  1WR7 A;  4GLX A;  4ZS6 A;  3NI6 A;  4WJX A;  4U86 A;  2M2A A;  3UI4 A;  4WIW A;  3RFW A;  4W9O A;  2OFN A;  1PBK A;  3FAP A;  3ALF A;  5AHT A;  3WKZ A;  1NWS A;  3CHF A;  1TCO C;  4ITZ A;  4TX0 A;  4Z2K A;  2WK2 A;  3TDB A;  4MNK A;  4P8W A;  4DRJ A;  3ARR A;  1E15 A;  1NWR A;  4WKF A;  3L4H A;  4JYS A;  3LKX B;  4NSB A;  2UZ5 A;  1XHG A;  3WIJ A;  2DG9 A;  1NMW A;  2JXW A;  1JVW A;  1HXV A;  3NRK A;  3M85 A;  1EYM A;  2XP7 A;  1E6Z A;  3W4R A;  3UI5 A;  1WMV A;  1BL4 A;  3O5Q A;  4NNR A;  5DIT A;  4J4N A;  4JFJ A;  5E64 A;  4DRK A;  2DG3 A;  4KQZ A;  5DIU A;  3ARQ A;  4QZV B;  2IUZ A;  5DO2 A;  2M8I A;  2KE0 A;  2YSH A;  4W5U A;  3QOK A;  3M7N A;  2QF8 A;  4WKA A;  4ODO A;  1F8A B;  2YSG A;  3CGN A;  1FKJ A;  3ARX A;  1OWQ A;  3BMB A;  4P8X A;  3KAH A;  1FKF A;  5JH8 A;  3EY6 A;  1J6Y A;  2LJ4 A;  3UQA A;  1Q6H A;  2DJY A;  1W9P A;  4DRQ A;  1SR0 A;  4IQC A;  4URI A;  2P4V A;  3RM8 A;  1Q6U A;  1Q1C A;  2FAP A;  3CHC A;  3B9A A;  2LGO A;  4DT4 A;  5J6E A;  1HKJ A;  4MTV A;  3FSB A;  3AS3 A;  3OOB A;  3GTY X;  2KR7 A;  3JYJ A;  2MLZ A;  1FKI A;  2VN1 A;  2DMV A;  3KCE A;  2Y78 A;  3GPK A;  1D6O A;  4LAV A;  4J4O A;  2A3B A;  2YBU A;  1LL4 A;  1OGB A;  3ARO A;  2PN0 A;  3KAB A;  1W9U A;  2A3E A;  1HJW A;  1KT0 A;  2QRV A;  1HJX A;  5U47 A;  2ETN A;  3PRD A;  3KAG A;  2L4J A;  3JXV A;  1W1P A;  3TC5 A;  1NMV A;  3WD1 A;  2LKN A;  1PIN A;  1GPF A;  3ARW A;  1E6N A;  3WQV A;  5HWC A;  4QT3 A;  4DIP A;  1KFW A;  1EHN A;  2ZR4 A;  2ZR6 A;  2G8Z A;  4ODK A;  3WL1 A;  2F2D A;  1NWT A;  3AQU A;  5DF0 A;  1X6N A;  1ROU A;  2Y8N B;  4ODR A;  1FJD A;  1ROT A;  4ODP A;  2ZQS A;  3PA7 A;  4C02 B;  4Z2L A;  4MNM A;  3CGM A;  1JND A;  4IT4 A;  2WLZ A;  1E44 A;  1ZU8 A;  2PBC A;  1NH6 A;  1ZL1 A;  4DWS B;  4Q22 A;  1Q6I A;  3TCZ A;  3UQB A;  1O6I A;  2ITK A;  2ZQU A;  1FKG A;  2RSE A;  3ARP A;  1P5Q A;  1FKL A;  2F23 A;  3UF8 A;  4ODN A;  3O5F A;  2OWO A;  2EZ5 W;  3PQH A;  1QPF A;  1EDQ A;  4JFL A;  1K9Q A;  3O5E A;  3MCB A;  5DEZ A;  3UQI A;  1W1Y A;  1K9R A;  5E62 A;  2YAJ B;  4ZPT R;  2JZV A;  4P8U A;  4DRI A;  4DWS C;  1YAT A;  3BXW A;  3UI6 A;  1YW5 A;  3KZ7 A;  4XAK A;  1C9H A;  1ZBV A;  3EIP A;  1R9H A;  3FS8 A;  1KT1 A;  4JFI A;  4HBO A;  1FFR A;  2PPP A;  3CZ8 A;  1VF8 A;  4JFM A;  4TW6 A;  5HKG A;  1XRV A;  1ZK6 A; 
#chains in the Genus database with same CATH homology
 1X6L A;  2YSI A;  3ARY A;  1T11 A;  2RUQ A;  4ODQ A;  5HWB A;  1FKD A;  3O5P A;  3H9R B;  2ZR5 A;  2O92 A;  1GUV A;  4G2P A;  3IKG A;  2XPB A;  4R5E A;  2XP8 A;  1ZBW A;  3KAI A;  2BA1 A;  1TR8 A;  3PRA A;  2PPO A;  3ODK A;  2DSZ A;  5HUA A;  1M5Y A;  1J4R A;  2KI3 A;  4KR0 B;  4PTM A;  1W26 A;  3CNG A;  2WAD A;  2F4E A;  3WD4 A;  3O5K A;  1FKS A;  1JNT A;  2RQS A;  1W9V A;  3RGC A;  5HW7 A;  2DT2 A;  2DSV A;  2M08 A;  4ZPW R;  2IF4 A;  5HW6 A;  4DRP A;  2ZQT A;  2M3O W;  5CQ2 A;  3MQH A;  3LKX A;  4IT6 A;  1TFV A;  4DRH A;  1F40 A;  2KXQ A;  4U84 A;  1D7J A;  4GIV A;  1JNE A;  2YSF A;  5I98 A;  2PV2 A;  5HW8 A;  2K8I A;  4G50 A;  2A3A A;  3KAD A;  1CTN A;  5B8I C;  2DWV A;  2MDI A;  1ZCN A;  1I5H W;  3O5L A;  1FKK A;  1H0I A;  2DK7 A;  2MF9 A;  2KFW A;  4REX A;  4LAX A;  4GGQ A;  3ARZ A;  3LE4 A;  2DT1 A;  1HKK A;  3KAC A;  4Z2I A;  4A0U A;  3IK8 A;  3B9D A;  3ALG A;  3ARV A;  3PRB A;  1JNS A;  2KGJ A;  1FKB A;  1LL7 A;  1H0G A;  2XP4 A;  4A0T A;  4QT2 A;  1O6W A;  2B31 A;  2AWG A;  4TW7 A;  4Z2J A;  2MNT A;  4DRM A;  4MPK A;  2PPN A;  1EG3 A;  4O2T A;  4LAY A;  4DH0 A;  4L3N A;  4ODM A;  4TW8 A;  4L72 B;  1SYT A;  1HKI A;  2JX8 A;  2OLH A;  1K9T A;  2ZQV A;  4ML4 A;  1FKH A;  2RUD A;  1FKT A;  4FAP A;  1W1T A;  1LG2 A;  3CHD A;  5D75 A;  4BF8 A;  1FKR A;  1UR8 A;  2JMF A;  3O5M A;  5BXJ A;  4JFK A;  1D2K A;  1NSG A;  3OA5 A;  3B7X A;  3G6L A;  2WLY A;  3RM4 A;  4MAV A;  4MSP A;  2F21 A;  2AOS A;  1ZB5 A;  3PR9 A;  4HAR A;  1HKM A;  4LAW A;  3ART A;  4W9P A;  3WL0 A;  3WD3 A;  1A7X A;  4IQ2 A;  1J4H A;  1LG1 A;  1B6C A;  1RD6 A;  1WB0 A;  2DG4 A;  1E6R A;  4MNL A;  1LJY A;  5DIV A;  2FKE A;  3O5O A;  3RME A;  1QZ2 A;  4HBE A;  1WAW A;  3AS0 A;  1ITX A;  4TNS A;  3B9E A;  2LAJ A;  5E65 A;  5GPG A;  1U79 A;  1LL6 A;  4WK9 A;  3LUO A;  1HJV A;  4NZC A;  4QIB A;  4DWS A;  2MPH A;  2XP5 A;  2DSU A;  2G41 A;  4N19 A;  1E9L A;  1ZBC A;  1D7H A;  1EIB A;  3WQW A;  4LGX A;  3FY1 A;  5HTG A;  4DRN A;  1QPL A;  4AY1 A;  2XP3 A;  3MDY B;  1IX5 A;  3AS2 A;  3O5D A;  4Z2H A;  4MNJ A;  1LQ0 A;  1FAP A;  2VCD A;  2WM0 A;  2PV1 A;  3WH0 A;  3CHE A;  4ZPV R;  2DK1 A;  1RP5 A;  2MLX A;  1BKF A;  3MQG A;  1EG4 A;  3WD2 A;  2DT0 A;  3FXY A;  3I6C A;  2PV3 A;  3O5I A;  4MGV A;  2M8J A;  1J4I A;  3NTP A;  1WNO A;  2MLY A;  5HT1 A;  2E45 A;  2KO7 A;  2Q5A A;  2YSB A;  2RE3 A;  4DZ3 A;  3IHZ A;  1FD9 A;  1GOI A;  1W1V A;  5GQB A;  3JYM A;  5E5W A;  2LPV A;  5GPR A;  2PI6 A;  4FN2 A;  4TYO A;  3B8S A;  2N87 A;  1JMQ A;  1E6P A;  3IKD A;  3AS1 A;  2RUC A;  2M1I A;  5HBF A;  1Y0O A;  3G6M A;  4U85 A;  1OGG A;  4Q7N A;  4Z2G A;  1UR9 A;  3WD0 A;  2XPA A;  3MCB B;  4E5R A;  2D9F A;  1L1P A;  2A3C A;  5E66 A;  4R0X A;  4ODL A;  4P8V A;  1TK7 A;  3KAF A;  2JV4 A;  2WAE A;  2XP6 A;  2DPE A;  3ARU A;  2FDM A;  2O9O A;  4W9Q A;  2ESC A;  1N1A A;  2DT3 A;  3ARS A;  1FLC A;  3O5R A;  3VAW A;  2XP9 A;  1ZBK A;  4S3J A;  4DRO A;  1EQ3 A;  2YBT A;  2ZAJ A;  1NWU A;  3O5J A;  4DWS D;  4IPX A;  3CH9 A;  4DZ2 A;  1D7I A;  2L2S A;  4WKH A;  1FFQ A;  2RUR A;  4S3K A;  3RM9 A;  3FSC A;  3O5G A;  2DSW A;  1WR7 A;  4GLX A;  4ZS6 A;  3NI6 A;  4WJX A;  4U86 A;  2M2A A;  3UI4 A;  4WIW A;  3RFW A;  4W9O A;  2OFN A;  1PBK A;  3FAP A;  3ALF A;  5AHT A;  3WKZ A;  1NWS A;  3CHF A;  1TCO C;  4ITZ A;  4TX0 A;  4Z2K A;  2WK2 A;  3TDB A;  4MNK A;  4P8W A;  4DRJ A;  3ARR A;  1E15 A;  1NWR A;  4WKF A;  3L4H A;  4JYS A;  3LKX B;  4NSB A;  2UZ5 A;  1XHG A;  3WIJ A;  2DG9 A;  1NMW A;  2JXW A;  1JVW A;  1HXV A;  3NRK A;  3M85 A;  1EYM A;  2XP7 A;  1E6Z A;  3W4R A;  3UI5 A;  1WMV A;  1BL4 A;  3O5Q A;  4NNR A;  5DIT A;  4J4N A;  4JFJ A;  5E64 A;  4DRK A;  2DG3 A;  4KQZ A;  5DIU A;  3ARQ A;  4QZV B;  2IUZ A;  5DO2 A;  2M8I A;  2KE0 A;  2YSH A;  4W5U A;  3QOK A;  3M7N A;  2QF8 A;  4WKA A;  4ODO A;  1F8A B;  2YSG A;  3CGN A;  1FKJ A;  3ARX A;  1OWQ A;  4P8X A;  3KAH A;  1FKF A;  5JH8 A;  3EY6 A;  1J6Y A;  2LJ4 A;  3UQA A;  1Q6H A;  2DJY A;  1W9P A;  4DRQ A;  1SR0 A;  4IQC A;  4URI A;  3RM8 A;  1Q6U A;  1Q1C A;  2FAP A;  3CHC A;  3B9A A;  2LGO A;  4DT4 A;  5J6E A;  1HKJ A;  4MTV A;  3FSB A;  3AS3 A;  3OOB A;  2KR7 A;  3JYJ A;  2MLZ A;  1FKI A;  2VN1 A;  2DMV A;  3KCE A;  2Y78 A;  3GPK A;  1D6O A;  4LAV A;  4J4O A;  2A3B A;  2YBU A;  1LL4 A;  1OGB A;  3ARO A;  3KAB A;  1W9U A;  2A3E A;  1HJW A;  1KT0 A;  2QRV A;  1HJX A;  5U47 A;  3PRD A;  3KAG A;  2L4J A;  3JXV A;  1W1P A;  3TC5 A;  1NMV A;  3WD1 A;  2LKN A;  1PIN A;  1GPF A;  3ARW A;  1E6N A;  3WQV A;  5HWC A;  4QT3 A;  4DIP A;  1KFW A;  1EHN A;  2ZR4 A;  2ZR6 A;  2G8Z A;  4ODK A;  3WL1 A;  2F2D A;  1NWT A;  3AQU A;  5DF0 A;  1X6N A;  1ROU A;  2Y8N B;  4ODR A;  1FJD A;  1ROT A;  4ODP A;  2ZQS A;  3PA7 A;  4C02 B;  4Z2L A;  4MNM A;  3CGM A;  1JND A;  4IT4 A;  2WLZ A;  1ZU8 A;  2PBC A;  1NH6 A;  1ZL1 A;  4DWS B;  4Q22 A;  1Q6I A;  3TCZ A;  3UQB A;  1O6I A;  2ITK A;  2ZQU A;  1FKG A;  2RSE A;  3ARP A;  1P5Q A;  1FKL A;  3UF8 A;  4ODN A;  3O5F A;  2OWO A;  2EZ5 W;  3PQH A;  1QPF A;  1EDQ A;  4JFL A;  1K9Q A;  3O5E A;  3MCB A;  5DEZ A;  3UQI A;  1W1Y A;  1K9R A;  5E62 A;  2YAJ B;  4ZPT R;  2JZV A;  4P8U A;  4DRI A;  4DWS C;  1YAT A;  3BXW A;  3UI6 A;  1YW5 A;  3KZ7 A;  4XAK A;  1C9H A;  1ZBV A;  1R9H A;  3FS8 A;  1KT1 A;  4JFI A;  4HBO A;  1FFR A;  2PPP A;  3CZ8 A;  1VF8 A;  4JFM A;  4TW6 A;  5HKG A;  1XRV A;  1ZK6 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...