2XP8A

Discovery of cell-active phenyl-imidazole pin1 inhibitors by structure-guided fragment evolution
Total Genus 43
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
43
sequence length
157
structure length
145
Chain Sequence
LPPGWEKAMSRSSGRVYYFNHITNASQWERPSEPARVRCSHLLVKHSQSRRPSSWRQEKITRTKEEALELINGYIQKIKSGEEDFESLASQFSDCSSAKARGDLGAFSRGQMQKPFEDASFALRTGEMSGPVFTDSGIHIILRTE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Discovery of Cell-Active Phenyl-Imidazole Pin1 Inhibitors by Structure-Guided Fragment Evolution.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Isomerase
molecule keywords PEPTIDYL-PROLYL CIS-TRANS ISOMERASE NIMA-INTERACTING 1
total genus 43
structure length 145
sequence length 157
ec nomenclature ec 5.2.1.8: Peptidylprolyl isomerase.
pdb deposition date 2010-08-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00397 WW WW domain
A PF00639 Rotamase PPIC-type PPIASE domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.20.70.10 Mainly Beta Single Sheet Ubiquitin Ligase Nedd4; Chain: W; Ubiquitin Ligase Nedd4; Chain: W; 2xp8A01
3.10.50.40 Alpha Beta Roll Chitinase A; domain 3 Chitinase A; domain 3 2xp8A02
1KT0A 4GGQA 2E45A 3JYMA 4QIBA 1FKIA 2KE0A 2XP9A 1K9RA 3O5PA 3O5FA 1D6OA 4MGVA 4W9QA 4IQ2A 1J6YA 2DG9A 5CQ2A 3TDBA 1FKHA 1D7HA 4JFLA 2ZQTA 4TNSA 1BL4A 2YSHA 1Q6IA 1QZ2A 4TYOA 5DITA 4DH0A 2JMFA 2LJ4A 3JYJA 2ITKA 2KGJA 4ODKA 5HW8A 5I98A 3FAPA 2ZR5A 5J6EA 2LPVA 1D7IA 4DRHA 2YSBA 2M8IA 2PPPA 2ZQUA 4ODOA 4E5RA 1A7XA 2DG3A 3KABA 4U84A 2AWGA 2FAPA 2JXWA 2JX8A 2M2AA 4LAVA 5GPGA 5B8IC 2XPAA 1J4HA 3CGNA 2DG4A 2DMVA 1R9HA 2LAJA 2UZ5A 4JFKA 2VN1A 2ZR4A 1WR7A 2XP7A 2K8IA 3ODKA 4JFJA 3PA7A 1QPFA 2KR7A 4DZ3A 4R0XA 2VCDA 3CNGA 2XP8A 4DRKA 2M8JA 2RUCA 3IKGA 4FN2A 1YATA 2PPNA 1FD9A 4JYSA 1WMVA 2XP4A 1NMVA 3M7NA 4BF8A 1F40A 1FJDA 4DRMA 4IPXA 2KFWA 4N19A 3CGMA 2EZ5W 2RUDA 4QT3A 2MDIA 4DRIA 1FKDA 4ODNA 4TW6A 2RE3A 2L2SA 1FKTA 2L4JA 3O5OA 2RUQA 1TCOC 1ZK6A 4DZ2A 4NNRA 2XP6A 5HUAA 2N87A 3L4HA 2YSFA 4LAWA 2PV3A 3O5IA 5HKGA 4O2TA 4ODQA 1FKGA 2RSEA 1FKSA 4FAPA 4G2PA 3UF8A 1N1AA 3M85A 3UQBA 1EQ3A 3MDYB 5AHTA 4J4OA 3KADA 1EG3A 1TK7A 1M5YA 5HWCA 1Q6HA 4LAXA 2XP5A 3IKDA 1JMQA 1EG4A 5BXJA 5HW6A 1BKFA 1YW5A 2BA1A 3KAHA 3KCEA 2M08A 2MPHA 2MLZA 1L1PA 1FKJA 4QT2A 1Y0OA 2F4EA 4TW8A 4TX0A 3O5JA 2MF9A 3EY6A 4ITZA 1FKLA 2RURA 4C02B 5HTGA 4ODMA 5DIVA 1P5QA 3GPKA 4ODPA 1Q6UA 3PRDA 1I5HW 4DT4A 4U86A 2M1IA 3NI6A 1C9HA 2MNTA 1NSGA 2ZR6A 2IF4A 2MLYA 3O5RA 3IHZA 4DRJA 3UQIA 2DWVA 2Q5AA 3RFWA 4J4NA 4G50A 1PINA 1K9QA 2M3OW 4MSPA 3VAWA 1J4IA 5HWBA 3B7XA 1ZCNA 2DK7A 3H9RB 3I6CA 4TW7A 3UI6A 4DIPA 3TCZA 2KXQA 2ZAJA 2ZQVA 2PBCA 4LAYA 1PBKA 1JNTA 3O5EA 2LGOA 2KI3A 4GIVA 2KO7A 2JZVA 1JNSA 4JFIA 3KAGA 5HT1A 1NMWA 4DRNA 1KT1A 3UI5A 2PV1A 3OOBA 3LUOA 4DRPA 3O5GA 2PV2A 1QPLA 4ODRA 5DIUA 1ROTA 4ODLA 3KACA 3UQAA 1FKFA 1FKKA 1D7JA 1ROUA 3NRKA 3O5DA 3PRBA 2JV4A 2DJYA 3NTPA 3IK8A 2F2DA 2OFNA 2DK1A 3TC5A 5D75A 1O6WA 2ZQSA 4W9PA 3RGCA 2D9FA 3KAIA 1EYMA 3WH0A 3LE4A 4REXA 3O5MA 1FAPA 2YSIA 1JVWA 2XPBA 1W26A 2MLXA 2PPOA 3KZ7A 1B6CA 2RQSA 4JFMA 4W9OA 4DROA 1FKBA 2FKEA 2YSGA 1Q1CA 1F8AB 1U79A 1J4RA 1HXVA 3O5QA 4U85A 4IQCA 4DRQA 3O5KA 2F21A 2XP3A 3KAFA 3JXVA 2Y78A 5HW7A 3O5LA 1FKRA 3UI4A 1T11A 2LKNA
chains in the Genus database with same CATH superfamily
3WL0A 4QIBA 4A0UA 1FKIA 2XP9A 1K9RA 2DSVA 5DEZA 3TDBA 1D7HA 4JFLA 4AY1A 4S3JA 4Z2LA 2YSBA 1RD6A 5GPRA 4E5RA 2A3CA 2DG3A 1JNDA 4U84A 2AWGA 2JXWA 2JX8A 1X6NA 1J4HA 2DMVA 1JNEA 1R9HA 3B9DA 1WR7A 1WAWA 4DZ3A 2FDMA 4R0XA 4DRKA 2M8JA 3ARSA 2PPNA 4Q22A 4JYSA 4MAVA 1HJWA 1W1VA 2DSWA 1FKDA 4ODNA 3ARWA 1FKTA 4HBEA 3O5OA 1NWTA 4MNKA 1GUVA 4NNRA 4LAWA 2PV3A 2WK2A 5JH8A 1E9LA 2RSEA 4Q7NA 4G2PA 5GQBA 3UF8A 1N1AA 1LL6A 3UQBA 4J4OA 3KADA 2Y8NB 5HWCA 5HW6A 4LAXA 2XP5A 1JMQA 1EG4A 4WJXA 4WKHA 1W1YA 1BKFA 2MLZA 2MPHA 1FKJA 1Y0OA 3ARVA 5HBFA 2PN0A 1KFWA 4HBOA 4DT4A 3LKXA 5E64A 2MLYA 3WD4A 3G6LA 3AS1A 4L72B 1PINA 1LJYA 5HWBA 1ZCNA 4TW7A 2ZQVA 2AOSA 4LAYA 4ZPTR 2KI3A 3ALFA 5HT1A 3OOBA 2OWOA 3LUOA 3GTYX 5DIUA 4ODLA 3PRBA 1ROUA 3NRKA 3FXYA 3WH0A 5U47A 4JFMA 2PPOA 2RQSA 3CHDA 1JCHB 2YSGA 1Q1CA 1U79A 1J4RA 5E65A 2QRVA 2XP3A 4ZPVR 3JXVA 1OGGA 4GIVA 1KT0A 3ARQA 4GGQA 3JYMA 3O5FA 1D6OA 4W9QA 4IQ2A 5CQ2A 1FKHA 2A3AA 2DT0A 1BL4A 2YSHA 3CHEA 3JYJA 4ODKA 5HW8A 2DSZA 5I98A 2ZR5A 1D7IA 1H0GA 2ZQUA 3KABA 4LAVA 2XPAA 3CGNA 2DG4A 2UZ5A 2VN1A 2XP7A 1E6NA 3ODKA 3PA7A 2VCDA 2RUCA 4FN2A 3WD3A 4KQZA 1WMVA 2XP4A 2KFWA 4N19A 2DT1A 3CGMA 2EZ5W 4DRIA 2MDIA 4P8UA 3GU0A 3ARPA 3MCBB 2RE3A 2L4JA 1LL7A 3B8SA 2RUQA 2YBTA 3AS2A 4DWSB 1TFVA 4Z2KA 5HKGA 1NWSA 4Z2JA 1NWRA 3BMBA 1E6RA 1EQ3A 3MDYB 3RMEA 4KR0B 1TK7A 4MNLA 2M08A 3KAHA 4NZCA 4TX0A 4ITZA 1FKLA 5HTGA 3PRDA 4UDMA 2M1IA 3NI6A 3AS3A 3EIPA 1K9TA 1W9VA 2MNTA 4W5UA 4MPKA 3UQIA 2Q5AA 1RP5A 2WM0A 4G50A 3FSCA 1FFRA 2A3BA 3H9RB 3UI6A 2QF8A 1VF8A 1E15A 2KXQA 2PBCA 1GPFA 4NSBA 1PBKA 3O5EA 2WLZA 2KO7A 2JZVA 1SR0A 3KAGA 4JFIA 1KT1A 1ROTA 3UQAA 1D7JA 2JV4A 2OFNA 5D75A 3TC5A 1O6WA 4W9PA 1GRJA 3KAIA 4IT4A 1FAPA 3PQHA 1JVWA 1B6CA 1FKBA 1F8AB 1ZBVA 3WD1A 4IQCA 4DRQA 3O5KA 1GOIA 2G41A 4Z2IA 1FKRA 1T11A 2E45A 3FSBA 1W9UA 3O5PA 4MGVA 2G8ZA 1J6YA 2DG9A 3AS0A 4TNSA 4Z2GA 4TYOA 4DH0A 2LJ4A 1TR8A 2ITKA 2A3EA 2KGJA 4ZPWR 2B31A 2M8IA 4ODOA 1A7XA 5B8IC 2M2AA 1W9PA 1HKKA 1EHNA 2LAJA 4JFKA 2ZR4A 1ITXA 1QPFA 3CNGA 1SYTA 1ZB5A 3IKGA 1YATA 3M7NA 1W1PA 1FJDA 4IPXA 1EIBA 1HKMA 2RUDA 3CHCA 4MTVA 4R5EA 2L2SA 4QZVB 3FY1A 3ARTA 3WIJA 1ZBKA 5HUAA 1FLCA 3L4HA 2YSFA 3O5IA 1HJVA 4GLXA 4O2TA 3WL1A 3M85A 3B9EA 1M5YA 3ARRA 1WNOA 1YW5A 2BA1A 3MQHA 1XRVA 4L3NA 4P8WA 2PI6A 4C02B 3EY6A 5DF0A 2O9OA 2ESCA 2WLYA 5DIVA 3PRAA 4ML4A 1P5QA 1Q6UA 2P4VA 1X6LA 1UR8A 2B5UB 1NSGA 2ZR6A 3O5RA 3IHZA 4DRJA 2DWVA 1LG2A 4WK9A 4J4NA 4MSPA 1NH6A 3VAWA 1J4IA 4URIA 2DK7A 3I6CA 4WKAA 4DIPA 5E5WA 3WD0A 2ZAJA 3RM9A 1LL4A 1D2KA 4IT6A 1NWUA 2OLHA 1JNSA 1NMWA 2F23A 3UI5A 2PV1A 4DRPA 1ZL1A 1IX5A 2PV2A 4ODRA 3KACA 3O5DA 1OWQA 2F2DA 3WQVA 2DK1A 2ZQSA 4WIWA 3WD2A 3RGCA 3LE4A 3B9AA 2YAJB 2YSIA 1W26A 2XPBA 3KZ7A 4W9OA 1CTNA 3O5QA 3AROA 3CZ8A 3ARXA 2DT3A 1HKIA 2Y78A 2WADA 3UI4A 3ARZA 2LKNA 2DT2A 4XAKA 2ETNA 2KE0A 4HARA 2ZQTA 4MNMA 3RM4A 4A0TA 1Q6IA 1QZ2A 5DITA 1UR9A 2JMFA 1HJXA 2EULA 3FAPA 2LPVA 4DRHA 3FS8A 2PPPA 4ODPA 4QT3A 2FAPA 5GPGA 2YBUA 1E44A 3BXWA 2K8IA 3MCBA 4JFJA 5J6EA 2KR7A 2XP8A 1ZU8A 1E6ZA 2IUZA 1FD9A 4BF8A 1NMVA 1F40A 4DRMA 4MNJA 2WAEA 2DSUA 1FFQA 1LQ0A 3WKZA 4DWSD 4TW6A 1XHGA 4DWSC 3WQWA 3ALGA 3MQGA 1TCOC 1ZK6A 2DPEA 4DZ2A 3CHFA 2XP6A 2N87A 5DO2A 3W4RA 4PTMA 3AQUA 4ODQA 1FKGA 4FAPA 1FKSA 1ZBWA 4LGXA 5AHTA 1EG3A 1OGBA 1LG1A 1Q6HA 3IKDA 4DWSA 5BXJA 3KCEA 4Z2HA 1L1PA 3ARYA 4QT2A 5E66A 2F4EA 4TW8A 3O5JA 2MF9A 1HKJA 2RURA 4ODMA 4P8VA 3GPKA 2O92A 3OA5A 4ZS6A 1I5HW 4U86A 1ZBCA 1C9HA 2IF4A 3PR9A 5E62A 4P8XA 3RFWA 1K9QA 2M3OW 3B7XA 4WKFA 3TCZA 3CH9A 1JNTA 3LKXB 2LGOA 3QOKA 4DRNA 3O5GA 4S3KA 1QPLA 3ARUA 1FKFA 1FKKA 3NTPA 2DJYA 3IK8A 1O6IA 2D9FA 1EYMA 4REXA 1EDQA 3O5MA 2MLXA 4DROA 2FKEA 3RM8A 1HXVA 4U85A 1H0IA 1WB0A 2F21A 3KAFA 3G6MA 1W1TA 5HW7A 1E6PA 3O5LA
chains in the Genus database with same CATH topology
3WL0A 4QIBA 4A0UA 1FKIA 2XP9A 1K9RA 2DSVA 5DEZA 3TDBA 1D7HA 4JFLA 4AY1A 4S3JA 4Z2LA 2YSBA 1RD6A 5GPRA 4E5RA 2A3CA 2DG3A 1JNDA 4U84A 2AWGA 2JXWA 2JX8A 1X6NA 1J4HA 2DMVA 1JNEA 1R9HA 3B9DA 1WR7A 1WAWA 4DZ3A 2FDMA 4R0XA 4DRKA 2M8JA 3ARSA 2PPNA 4Q22A 4JYSA 4MAVA 1HJWA 1W1VA 2DSWA 1FKDA 4ODNA 3ARWA 1FKTA 4HBEA 3O5OA 1NWTA 4MNKA 1GUVA 4NNRA 4LAWA 2PV3A 2WK2A 5JH8A 1E9LA 2RSEA 4Q7NA 4G2PA 5GQBA 3UF8A 1N1AA 1LL6A 3UQBA 4J4OA 3KADA 2Y8NB 5HWCA 5HW6A 4LAXA 2XP5A 1JMQA 1EG4A 4WJXA 4WKHA 1W1YA 1BKFA 2MLZA 2MPHA 1FKJA 1Y0OA 3ARVA 5HBFA 1KFWA 4HBOA 4DT4A 3LKXA 5E64A 2MLYA 3WD4A 3G6LA 3AS1A 4L72B 1PINA 1LJYA 5HWBA 1ZCNA 4TW7A 2ZQVA 2AOSA 4LAYA 4ZPTR 2KI3A 3ALFA 5HT1A 3OOBA 2OWOA 3LUOA 5DIUA 4ODLA 3PRBA 1ROUA 3NRKA 3FXYA 3WH0A 5U47A 4JFMA 2PPOA 2RQSA 3CHDA 2YSGA 1Q1CA 1U79A 1J4RA 5E65A 2QRVA 2XP3A 4ZPVR 3JXVA 1OGGA 4GIVA 1KT0A 3ARQA 4GGQA 3JYMA 3O5FA 1D6OA 4W9QA 4IQ2A 5CQ2A 1FKHA 2A3AA 2DT0A 1BL4A 2YSHA 3CHEA 3JYJA 4ODKA 5HW8A 2DSZA 5I98A 2ZR5A 1D7IA 1H0GA 2ZQUA 3KABA 4LAVA 2XPAA 3CGNA 2DG4A 2UZ5A 2VN1A 2XP7A 1E6NA 3ODKA 3PA7A 2VCDA 2RUCA 4FN2A 3WD3A 4KQZA 1WMVA 2XP4A 2KFWA 4N19A 2DT1A 3CGMA 2EZ5W 4DRIA 2MDIA 4P8UA 3ARPA 3MCBB 2RE3A 2L4JA 1LL7A 3B8SA 2RUQA 2YBTA 3AS2A 4DWSB 1TFVA 4Z2KA 5HKGA 1NWSA 4Z2JA 1NWRA 1E6RA 1EQ3A 3MDYB 3RMEA 4KR0B 1TK7A 4MNLA 2M08A 3KAHA 4NZCA 4TX0A 4ITZA 1FKLA 5HTGA 3PRDA 2M1IA 3NI6A 3AS3A 1K9TA 1W9VA 2MNTA 4W5UA 4MPKA 3UQIA 2Q5AA 1RP5A 2WM0A 4G50A 3FSCA 1FFRA 2A3BA 3H9RB 3UI6A 2QF8A 1VF8A 1E15A 2KXQA 2PBCA 1GPFA 4NSBA 1PBKA 3O5EA 2WLZA 2KO7A 2JZVA 1SR0A 3KAGA 4JFIA 1KT1A 1ROTA 3UQAA 1D7JA 2JV4A 2OFNA 5D75A 3TC5A 1O6WA 4W9PA 3KAIA 4IT4A 1FAPA 3PQHA 1JVWA 1B6CA 1FKBA 1F8AB 1ZBVA 3WD1A 4IQCA 4DRQA 3O5KA 1GOIA 2G41A 4Z2IA 1FKRA 1T11A 2E45A 3FSBA 1W9UA 3O5PA 4MGVA 2G8ZA 1J6YA 2DG9A 3AS0A 4TNSA 4Z2GA 4TYOA 4DH0A 2LJ4A 1TR8A 2ITKA 2A3EA 2KGJA 4ZPWR 2B31A 2M8IA 4ODOA 1A7XA 5B8IC 2M2AA 1W9PA 1HKKA 1EHNA 2LAJA 4JFKA 2ZR4A 1ITXA 1QPFA 3CNGA 1SYTA 1ZB5A 3IKGA 1YATA 3M7NA 1W1PA 1FJDA 4IPXA 1EIBA 1HKMA 2RUDA 3CHCA 4MTVA 4R5EA 2L2SA 4QZVB 3FY1A 3ARTA 3WIJA 1ZBKA 5HUAA 1FLCA 3L4HA 2YSFA 3O5IA 1HJVA 4GLXA 4O2TA 3WL1A 3M85A 3B9EA 1M5YA 3ARRA 1WNOA 1YW5A 2BA1A 3MQHA 1XRVA 4L3NA 4P8WA 2PI6A 4C02B 3EY6A 5DF0A 2O9OA 2ESCA 2WLYA 5DIVA 3PRAA 4ML4A 1P5QA 1Q6UA 1X6LA 1UR8A 1NSGA 2ZR6A 3O5RA 3IHZA 4DRJA 2DWVA 1LG2A 4WK9A 4J4NA 4MSPA 1NH6A 3VAWA 1J4IA 4URIA 2DK7A 3I6CA 4WKAA 4DIPA 5E5WA 3WD0A 2ZAJA 3RM9A 1LL4A 1D2KA 4IT6A 1NWUA 2OLHA 1JNSA 1NMWA 3UI5A 2PV1A 4DRPA 1ZL1A 1IX5A 2PV2A 4ODRA 3KACA 3O5DA 1OWQA 2F2DA 3WQVA 2DK1A 2ZQSA 4WIWA 3WD2A 3RGCA 3LE4A 3B9AA 2YAJB 2YSIA 1W26A 2XPBA 3KZ7A 4W9OA 1CTNA 3O5QA 3AROA 3CZ8A 3ARXA 2DT3A 1HKIA 2Y78A 2WADA 3UI4A 3ARZA 2LKNA 2DT2A 4XAKA 2KE0A 4HARA 2ZQTA 4MNMA 3RM4A 4A0TA 1Q6IA 1QZ2A 5DITA 1UR9A 2JMFA 1HJXA 3FAPA 2LPVA 4DRHA 3FS8A 2PPPA 4ODPA 4QT3A 2FAPA 5GPGA 2YBUA 3BXWA 2K8IA 3MCBA 4JFJA 5J6EA 2KR7A 2XP8A 1ZU8A 1E6ZA 2IUZA 1FD9A 4BF8A 1NMVA 1F40A 4DRMA 4MNJA 2WAEA 2DSUA 1FFQA 1LQ0A 3WKZA 4DWSD 4TW6A 1XHGA 4DWSC 3WQWA 3ALGA 3MQGA 1TCOC 1ZK6A 2DPEA 4DZ2A 3CHFA 2XP6A 2N87A 5DO2A 3W4RA 4PTMA 3AQUA 4ODQA 1FKGA 4FAPA 1FKSA 1ZBWA 4LGXA 5AHTA 1EG3A 1OGBA 1LG1A 1Q6HA 3IKDA 4DWSA 5BXJA 3KCEA 4Z2HA 1L1PA 3ARYA 4QT2A 5E66A 2F4EA 4TW8A 3O5JA 2MF9A 1HKJA 2RURA 4ODMA 4P8VA 3GPKA 2O92A 3OA5A 4ZS6A 1I5HW 4U86A 1ZBCA 1C9HA 2IF4A 3PR9A 5E62A 4P8XA 3RFWA 1K9QA 2M3OW 3B7XA 4WKFA 3TCZA 3CH9A 1JNTA 3LKXB 2LGOA 3QOKA 4DRNA 3O5GA 4S3KA 1QPLA 3ARUA 1FKFA 1FKKA 3NTPA 2DJYA 3IK8A 1O6IA 2D9FA 1EYMA 4REXA 1EDQA 3O5MA 2MLXA 4DROA 2FKEA 3RM8A 1HXVA 4U85A 1H0IA 1WB0A 2F21A 3KAFA 3G6MA 1W1TA 5HW7A 1E6PA 3O5LA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1KT0 A;  4GGQ A;  2E45 A;  3JYM A;  4QIB A;  1FKI A;  2KE0 A;  2XP9 A;  1K9R A;  3O5P A;  3O5F A;  1D6O A;  4MGV A;  4W9Q A;  4IQ2 A;  1J6Y A;  2DG9 A;  5CQ2 A;  3TDB A;  1FKH A;  1D7H A;  4JFL A;  2ZQT A;  4TNS A;  1BL4 A;  2YSH A;  1Q6I A;  1QZ2 A;  4TYO A;  5DIT A;  4DH0 A;  2JMF A;  2LJ4 A;  3JYJ A;  2ITK A;  2KGJ A;  4ODK A;  5HW8 A;  5I98 A;  3FAP A;  2ZR5 A;  5J6E A;  2LPV A;  1D7I A;  4DRH A;  2YSB A;  2M8I A;  2PPP A;  2ZQU A;  4ODO A;  4E5R A;  1A7X A;  2DG3 A;  3KAB A;  4U84 A;  2AWG A;  2FAP A;  2JXW A;  2JX8 A;  2M2A A;  4LAV A;  5GPG A;  5B8I C;  2XPA A;  1J4H A;  3CGN A;  2DG4 A;  2DMV A;  1R9H A;  2LAJ A;  2UZ5 A;  4JFK A;  2VN1 A;  2ZR4 A;  1WR7 A;  2XP7 A;  2K8I A;  3ODK A;  4JFJ A;  3PA7 A;  1QPF A;  2KR7 A;  4DZ3 A;  4R0X A;  2VCD A;  3CNG A;  2XP8 A;  4DRK A;  2M8J A;  2RUC A;  3IKG A;  4FN2 A;  1YAT A;  2PPN A;  1FD9 A;  4JYS A;  1WMV A;  2XP4 A;  1NMV A;  3M7N A;  4BF8 A;  1F40 A;  1FJD A;  4DRM A;  4IPX A;  2KFW A;  4N19 A;  3CGM A;  2EZ5 W;  2RUD A;  4QT3 A;  2MDI A;  4DRI A;  1FKD A;  4ODN A;  4TW6 A;  2RE3 A;  2L2S A;  1FKT A;  2L4J A;  3O5O A;  2RUQ A;  1TCO C;  1ZK6 A;  4DZ2 A;  4NNR A;  2XP6 A;  5HUA A;  2N87 A;  3L4H A;  2YSF A;  4LAW A;  2PV3 A;  3O5I A;  5HKG A;  4O2T A;  4ODQ A;  1FKG A;  2RSE A;  1FKS A;  4FAP A;  4G2P A;  3UF8 A;  1N1A A;  3M85 A;  3UQB A;  1EQ3 A;  3MDY B;  5AHT A;  4J4O A;  3KAD A;  1EG3 A;  1TK7 A;  1M5Y A;  5HWC A;  1Q6H A;  4LAX A;  2XP5 A;  3IKD A;  1JMQ A;  1EG4 A;  5BXJ A;  5HW6 A;  1BKF A;  1YW5 A;  2BA1 A;  3KAH A;  3KCE A;  2M08 A;  2MPH A;  2MLZ A;  1L1P A;  1FKJ A;  4QT2 A;  1Y0O A;  2F4E A;  4TW8 A;  4TX0 A;  3O5J A;  2MF9 A;  3EY6 A;  4ITZ A;  1FKL A;  2RUR A;  4C02 B;  5HTG A;  4ODM A;  5DIV A;  1P5Q A;  3GPK A;  4ODP A;  1Q6U A;  3PRD A;  1I5H W;  4DT4 A;  4U86 A;  2M1I A;  3NI6 A;  1C9H A;  2MNT A;  1NSG A;  2ZR6 A;  2IF4 A;  2MLY A;  3O5R A;  3IHZ A;  4DRJ A;  3UQI A;  2DWV A;  2Q5A A;  3RFW A;  4J4N A;  4G50 A;  1PIN A;  1K9Q A;  2M3O W;  4MSP A;  3VAW A;  1J4I A;  5HWB A;  3B7X A;  1ZCN A;  2DK7 A;  3H9R B;  3I6C A;  4TW7 A;  3UI6 A;  4DIP A;  3TCZ A;  2KXQ A;  2ZAJ A;  2ZQV A;  2PBC A;  4LAY A;  1PBK A;  1JNT A;  3O5E A;  2LGO A;  2KI3 A;  4GIV A;  2KO7 A;  2JZV A;  1JNS A;  4JFI A;  3KAG A;  5HT1 A;  1NMW A;  4DRN A;  1KT1 A;  3UI5 A;  2PV1 A;  3OOB A;  3LUO A;  4DRP A;  3O5G A;  2PV2 A;  1QPL A;  4ODR A;  5DIU A;  1ROT A;  4ODL A;  3KAC A;  3UQA A;  1FKF A;  1FKK A;  1D7J A;  1ROU A;  3NRK A;  3O5D A;  3PRB A;  2JV4 A;  2DJY A;  3NTP A;  3IK8 A;  2F2D A;  2OFN A;  2DK1 A;  3TC5 A;  5D75 A;  1O6W A;  2ZQS A;  4W9P A;  3RGC A;  2D9F A;  3KAI A;  1EYM A;  3WH0 A;  3LE4 A;  4REX A;  3O5M A;  1FAP A;  2YSI A;  1JVW A;  2XPB A;  1W26 A;  2MLX A;  2PPO A;  3KZ7 A;  1B6C A;  2RQS A;  4JFM A;  4W9O A;  4DRO A;  1FKB A;  2FKE A;  2YSG A;  1Q1C A;  1F8A B;  1U79 A;  1J4R A;  1HXV A;  3O5Q A;  4U85 A;  4IQC A;  4DRQ A;  3O5K A;  2F21 A;  2XP3 A;  3KAF A;  3JXV A;  2Y78 A;  5HW7 A;  3O5L A;  1FKR A;  3UI4 A;  1T11 A;  2LKN A; 
#chains in the Genus database with same CATH topology
 3WL0 A;  4QIB A;  4A0U A;  1FKI A;  2XP9 A;  1K9R A;  2DSV A;  5DEZ A;  3TDB A;  1D7H A;  4JFL A;  4AY1 A;  4S3J A;  4Z2L A;  2YSB A;  1RD6 A;  5GPR A;  4E5R A;  2A3C A;  2DG3 A;  1JND A;  4U84 A;  2AWG A;  2JXW A;  2JX8 A;  1X6N A;  1J4H A;  2DMV A;  1JNE A;  1R9H A;  3B9D A;  1WR7 A;  1WAW A;  4DZ3 A;  2FDM A;  4R0X A;  4DRK A;  2M8J A;  3ARS A;  2PPN A;  4Q22 A;  4JYS A;  4MAV A;  1HJW A;  1W1V A;  2DSW A;  1FKD A;  4ODN A;  3ARW A;  1FKT A;  4HBE A;  3O5O A;  1NWT A;  4MNK A;  1GUV A;  4NNR A;  4LAW A;  2PV3 A;  2WK2 A;  5JH8 A;  1E9L A;  2RSE A;  4Q7N A;  4G2P A;  5GQB A;  3UF8 A;  1N1A A;  1LL6 A;  3UQB A;  4J4O A;  3KAD A;  2Y8N B;  5HWC A;  5HW6 A;  4LAX A;  2XP5 A;  1JMQ A;  1EG4 A;  4WJX A;  4WKH A;  1W1Y A;  1BKF A;  2MLZ A;  2MPH A;  1FKJ A;  1Y0O A;  3ARV A;  5HBF A;  2PN0 A;  1KFW A;  4HBO A;  4DT4 A;  3LKX A;  5E64 A;  2MLY A;  3WD4 A;  3G6L A;  3AS1 A;  4L72 B;  1PIN A;  1LJY A;  5HWB A;  1ZCN A;  4TW7 A;  2ZQV A;  2AOS A;  4LAY A;  4ZPT R;  2KI3 A;  3ALF A;  5HT1 A;  3OOB A;  2OWO A;  3LUO A;  3GTY X;  5DIU A;  4ODL A;  3PRB A;  1ROU A;  3NRK A;  3FXY A;  3WH0 A;  5U47 A;  4JFM A;  2PPO A;  2RQS A;  3CHD A;  1JCH B;  2YSG A;  1Q1C A;  1U79 A;  1J4R A;  5E65 A;  2QRV A;  2XP3 A;  4ZPV R;  3JXV A;  1OGG A;  4GIV A;  1KT0 A;  3ARQ A;  4GGQ A;  3JYM A;  3O5F A;  1D6O A;  4W9Q A;  4IQ2 A;  5CQ2 A;  1FKH A;  2A3A A;  2DT0 A;  1BL4 A;  2YSH A;  3CHE A;  3JYJ A;  4ODK A;  5HW8 A;  2DSZ A;  5I98 A;  2ZR5 A;  1D7I A;  1H0G A;  2ZQU A;  3KAB A;  4LAV A;  2XPA A;  3CGN A;  2DG4 A;  2UZ5 A;  2VN1 A;  2XP7 A;  1E6N A;  3ODK A;  3PA7 A;  2VCD A;  2RUC A;  4FN2 A;  3WD3 A;  4KQZ A;  1WMV A;  2XP4 A;  2KFW A;  4N19 A;  2DT1 A;  3CGM A;  2EZ5 W;  4DRI A;  2MDI A;  4P8U A;  3GU0 A;  3ARP A;  3MCB B;  2RE3 A;  2L4J A;  1LL7 A;  3B8S A;  2RUQ A;  2YBT A;  3AS2 A;  4DWS B;  1TFV A;  4Z2K A;  5HKG A;  1NWS A;  4Z2J A;  1NWR A;  3BMB A;  1E6R A;  1EQ3 A;  3MDY B;  3RME A;  4KR0 B;  1TK7 A;  4MNL A;  2M08 A;  3KAH A;  4NZC A;  4TX0 A;  4ITZ A;  1FKL A;  5HTG A;  3PRD A;  4UDM A;  2M1I A;  3NI6 A;  3AS3 A;  3EIP A;  1K9T A;  1W9V A;  2MNT A;  4W5U A;  4MPK A;  3UQI A;  2Q5A A;  1RP5 A;  2WM0 A;  4G50 A;  3FSC A;  1FFR A;  2A3B A;  3H9R B;  3UI6 A;  2QF8 A;  1VF8 A;  1E15 A;  2KXQ A;  2PBC A;  1GPF A;  4NSB A;  1PBK A;  3O5E A;  2WLZ A;  2KO7 A;  2JZV A;  1SR0 A;  3KAG A;  4JFI A;  1KT1 A;  1ROT A;  3UQA A;  1D7J A;  2JV4 A;  2OFN A;  5D75 A;  3TC5 A;  1O6W A;  4W9P A;  1GRJ A;  3KAI A;  4IT4 A;  1FAP A;  3PQH A;  1JVW A;  1B6C A;  1FKB A;  1F8A B;  1ZBV A;  3WD1 A;  4IQC A;  4DRQ A;  3O5K A;  1GOI A;  2G41 A;  4Z2I A;  1FKR A;  1T11 A;  2E45 A;  3FSB A;  1W9U A;  3O5P A;  4MGV A;  2G8Z A;  1J6Y A;  2DG9 A;  3AS0 A;  4TNS A;  4Z2G A;  4TYO A;  4DH0 A;  2LJ4 A;  1TR8 A;  2ITK A;  2A3E A;  2KGJ A;  4ZPW R;  2B31 A;  2M8I A;  4ODO A;  1A7X A;  5B8I C;  2M2A A;  1W9P A;  1HKK A;  1EHN A;  2LAJ A;  4JFK A;  2ZR4 A;  1ITX A;  1QPF A;  3CNG A;  1SYT A;  1ZB5 A;  3IKG A;  1YAT A;  3M7N A;  1W1P A;  1FJD A;  4IPX A;  1EIB A;  1HKM A;  2RUD A;  3CHC A;  4MTV A;  4R5E A;  2L2S A;  4QZV B;  3FY1 A;  3ART A;  3WIJ A;  1ZBK A;  5HUA A;  1FLC A;  3L4H A;  2YSF A;  3O5I A;  1HJV A;  4GLX A;  4O2T A;  3WL1 A;  3M85 A;  3B9E A;  1M5Y A;  3ARR A;  1WNO A;  1YW5 A;  2BA1 A;  3MQH A;  1XRV A;  4L3N A;  4P8W A;  2PI6 A;  4C02 B;  3EY6 A;  5DF0 A;  2O9O A;  2ESC A;  2WLY A;  5DIV A;  3PRA A;  4ML4 A;  1P5Q A;  1Q6U A;  2P4V A;  1X6L A;  1UR8 A;  2B5U B;  1NSG A;  2ZR6 A;  3O5R A;  3IHZ A;  4DRJ A;  2DWV A;  1LG2 A;  4WK9 A;  4J4N A;  4MSP A;  1NH6 A;  3VAW A;  1J4I A;  4URI A;  2DK7 A;  3I6C A;  4WKA A;  4DIP A;  5E5W A;  3WD0 A;  2ZAJ A;  3RM9 A;  1LL4 A;  1D2K A;  4IT6 A;  1NWU A;  2OLH A;  1JNS A;  1NMW A;  2F23 A;  3UI5 A;  2PV1 A;  4DRP A;  1ZL1 A;  1IX5 A;  2PV2 A;  4ODR A;  3KAC A;  3O5D A;  1OWQ A;  2F2D A;  3WQV A;  2DK1 A;  2ZQS A;  4WIW A;  3WD2 A;  3RGC A;  3LE4 A;  3B9A A;  2YAJ B;  2YSI A;  1W26 A;  2XPB A;  3KZ7 A;  4W9O A;  1CTN A;  3O5Q A;  3ARO A;  3CZ8 A;  3ARX A;  2DT3 A;  1HKI A;  2Y78 A;  2WAD A;  3UI4 A;  3ARZ A;  2LKN A;  2DT2 A;  4XAK A;  2ETN A;  2KE0 A;  4HAR A;  2ZQT A;  4MNM A;  3RM4 A;  4A0T A;  1Q6I A;  1QZ2 A;  5DIT A;  1UR9 A;  2JMF A;  1HJX A;  2EUL A;  3FAP A;  2LPV A;  4DRH A;  3FS8 A;  2PPP A;  4ODP A;  4QT3 A;  2FAP A;  5GPG A;  2YBU A;  1E44 A;  3BXW A;  2K8I A;  3MCB A;  4JFJ A;  5J6E A;  2KR7 A;  2XP8 A;  1ZU8 A;  1E6Z A;  2IUZ A;  1FD9 A;  4BF8 A;  1NMV A;  1F40 A;  4DRM A;  4MNJ A;  2WAE A;  2DSU A;  1FFQ A;  1LQ0 A;  3WKZ A;  4DWS D;  4TW6 A;  1XHG A;  4DWS C;  3WQW A;  3ALG A;  3MQG A;  1TCO C;  1ZK6 A;  2DPE A;  4DZ2 A;  3CHF A;  2XP6 A;  2N87 A;  5DO2 A;  3W4R A;  4PTM A;  3AQU A;  4ODQ A;  1FKG A;  4FAP A;  1FKS A;  1ZBW A;  4LGX A;  5AHT A;  1EG3 A;  1OGB A;  1LG1 A;  1Q6H A;  3IKD A;  4DWS A;  5BXJ A;  3KCE A;  4Z2H A;  1L1P A;  3ARY A;  4QT2 A;  5E66 A;  2F4E A;  4TW8 A;  3O5J A;  2MF9 A;  1HKJ A;  2RUR A;  4ODM A;  4P8V A;  3GPK A;  2O92 A;  3OA5 A;  4ZS6 A;  1I5H W;  4U86 A;  1ZBC A;  1C9H A;  2IF4 A;  3PR9 A;  5E62 A;  4P8X A;  3RFW A;  1K9Q A;  2M3O W;  3B7X A;  4WKF A;  3TCZ A;  3CH9 A;  1JNT A;  3LKX B;  2LGO A;  3QOK A;  4DRN A;  3O5G A;  4S3K A;  1QPL A;  3ARU A;  1FKF A;  1FKK A;  3NTP A;  2DJY A;  3IK8 A;  1O6I A;  2D9F A;  1EYM A;  4REX A;  1EDQ A;  3O5M A;  2MLX A;  4DRO A;  2FKE A;  3RM8 A;  1HXV A;  4U85 A;  1H0I A;  1WB0 A;  2F21 A;  3KAF A;  3G6M A;  1W1T A;  5HW7 A;  1E6P A;  3O5L A; 
#chains in the Genus database with same CATH homology
 3WL0 A;  4QIB A;  4A0U A;  1FKI A;  2XP9 A;  1K9R A;  2DSV A;  5DEZ A;  3TDB A;  1D7H A;  4JFL A;  4AY1 A;  4S3J A;  4Z2L A;  2YSB A;  1RD6 A;  5GPR A;  4E5R A;  2A3C A;  2DG3 A;  1JND A;  4U84 A;  2AWG A;  2JXW A;  2JX8 A;  1X6N A;  1J4H A;  2DMV A;  1JNE A;  1R9H A;  3B9D A;  1WR7 A;  1WAW A;  4DZ3 A;  2FDM A;  4R0X A;  4DRK A;  2M8J A;  3ARS A;  2PPN A;  4Q22 A;  4JYS A;  4MAV A;  1HJW A;  1W1V A;  2DSW A;  1FKD A;  4ODN A;  3ARW A;  1FKT A;  4HBE A;  3O5O A;  1NWT A;  4MNK A;  1GUV A;  4NNR A;  4LAW A;  2PV3 A;  2WK2 A;  5JH8 A;  1E9L A;  2RSE A;  4Q7N A;  4G2P A;  5GQB A;  3UF8 A;  1N1A A;  1LL6 A;  3UQB A;  4J4O A;  3KAD A;  2Y8N B;  5HWC A;  5HW6 A;  4LAX A;  2XP5 A;  1JMQ A;  1EG4 A;  4WJX A;  4WKH A;  1W1Y A;  1BKF A;  2MLZ A;  2MPH A;  1FKJ A;  1Y0O A;  3ARV A;  5HBF A;  1KFW A;  4HBO A;  4DT4 A;  3LKX A;  5E64 A;  2MLY A;  3WD4 A;  3G6L A;  3AS1 A;  4L72 B;  1PIN A;  1LJY A;  5HWB A;  1ZCN A;  4TW7 A;  2ZQV A;  2AOS A;  4LAY A;  4ZPT R;  2KI3 A;  3ALF A;  5HT1 A;  3OOB A;  2OWO A;  3LUO A;  5DIU A;  4ODL A;  3PRB A;  1ROU A;  3NRK A;  3FXY A;  3WH0 A;  5U47 A;  4JFM A;  2PPO A;  2RQS A;  3CHD A;  2YSG A;  1Q1C A;  1U79 A;  1J4R A;  5E65 A;  2QRV A;  2XP3 A;  4ZPV R;  3JXV A;  1OGG A;  4GIV A;  1KT0 A;  3ARQ A;  4GGQ A;  3JYM A;  3O5F A;  1D6O A;  4W9Q A;  4IQ2 A;  5CQ2 A;  1FKH A;  2A3A A;  2DT0 A;  1BL4 A;  2YSH A;  3CHE A;  3JYJ A;  4ODK A;  5HW8 A;  2DSZ A;  5I98 A;  2ZR5 A;  1D7I A;  1H0G A;  2ZQU A;  3KAB A;  4LAV A;  2XPA A;  3CGN A;  2DG4 A;  2UZ5 A;  2VN1 A;  2XP7 A;  1E6N A;  3ODK A;  3PA7 A;  2VCD A;  2RUC A;  4FN2 A;  3WD3 A;  4KQZ A;  1WMV A;  2XP4 A;  2KFW A;  4N19 A;  2DT1 A;  3CGM A;  2EZ5 W;  4DRI A;  2MDI A;  4P8U A;  3ARP A;  3MCB B;  2RE3 A;  2L4J A;  1LL7 A;  3B8S A;  2RUQ A;  2YBT A;  3AS2 A;  4DWS B;  1TFV A;  4Z2K A;  5HKG A;  1NWS A;  4Z2J A;  1NWR A;  1E6R A;  1EQ3 A;  3MDY B;  3RME A;  4KR0 B;  1TK7 A;  4MNL A;  2M08 A;  3KAH A;  4NZC A;  4TX0 A;  4ITZ A;  1FKL A;  5HTG A;  3PRD A;  2M1I A;  3NI6 A;  3AS3 A;  1K9T A;  1W9V A;  2MNT A;  4W5U A;  4MPK A;  3UQI A;  2Q5A A;  1RP5 A;  2WM0 A;  4G50 A;  3FSC A;  1FFR A;  2A3B A;  3H9R B;  3UI6 A;  2QF8 A;  1VF8 A;  1E15 A;  2KXQ A;  2PBC A;  1GPF A;  4NSB A;  1PBK A;  3O5E A;  2WLZ A;  2KO7 A;  2JZV A;  1SR0 A;  3KAG A;  4JFI A;  1KT1 A;  1ROT A;  3UQA A;  1D7J A;  2JV4 A;  2OFN A;  5D75 A;  3TC5 A;  1O6W A;  4W9P A;  3KAI A;  4IT4 A;  1FAP A;  3PQH A;  1JVW A;  1B6C A;  1FKB A;  1F8A B;  1ZBV A;  3WD1 A;  4IQC A;  4DRQ A;  3O5K A;  1GOI A;  2G41 A;  4Z2I A;  1FKR A;  1T11 A;  2E45 A;  3FSB A;  1W9U A;  3O5P A;  4MGV A;  2G8Z A;  1J6Y A;  2DG9 A;  3AS0 A;  4TNS A;  4Z2G A;  4TYO A;  4DH0 A;  2LJ4 A;  1TR8 A;  2ITK A;  2A3E A;  2KGJ A;  4ZPW R;  2B31 A;  2M8I A;  4ODO A;  1A7X A;  5B8I C;  2M2A A;  1W9P A;  1HKK A;  1EHN A;  2LAJ A;  4JFK A;  2ZR4 A;  1ITX A;  1QPF A;  3CNG A;  1SYT A;  1ZB5 A;  3IKG A;  1YAT A;  3M7N A;  1W1P A;  1FJD A;  4IPX A;  1EIB A;  1HKM A;  2RUD A;  3CHC A;  4MTV A;  4R5E A;  2L2S A;  4QZV B;  3FY1 A;  3ART A;  3WIJ A;  1ZBK A;  5HUA A;  1FLC A;  3L4H A;  2YSF A;  3O5I A;  1HJV A;  4GLX A;  4O2T A;  3WL1 A;  3M85 A;  3B9E A;  1M5Y A;  3ARR A;  1WNO A;  1YW5 A;  2BA1 A;  3MQH A;  1XRV A;  4L3N A;  4P8W A;  2PI6 A;  4C02 B;  3EY6 A;  5DF0 A;  2O9O A;  2ESC A;  2WLY A;  5DIV A;  3PRA A;  4ML4 A;  1P5Q A;  1Q6U A;  1X6L A;  1UR8 A;  1NSG A;  2ZR6 A;  3O5R A;  3IHZ A;  4DRJ A;  2DWV A;  1LG2 A;  4WK9 A;  4J4N A;  4MSP A;  1NH6 A;  3VAW A;  1J4I A;  4URI A;  2DK7 A;  3I6C A;  4WKA A;  4DIP A;  5E5W A;  3WD0 A;  2ZAJ A;  3RM9 A;  1LL4 A;  1D2K A;  4IT6 A;  1NWU A;  2OLH A;  1JNS A;  1NMW A;  3UI5 A;  2PV1 A;  4DRP A;  1ZL1 A;  1IX5 A;  2PV2 A;  4ODR A;  3KAC A;  3O5D A;  1OWQ A;  2F2D A;  3WQV A;  2DK1 A;  2ZQS A;  4WIW A;  3WD2 A;  3RGC A;  3LE4 A;  3B9A A;  2YAJ B;  2YSI A;  1W26 A;  2XPB A;  3KZ7 A;  4W9O A;  1CTN A;  3O5Q A;  3ARO A;  3CZ8 A;  3ARX A;  2DT3 A;  1HKI A;  2Y78 A;  2WAD A;  3UI4 A;  3ARZ A;  2LKN A;  2DT2 A;  4XAK A;  2KE0 A;  4HAR A;  2ZQT A;  4MNM A;  3RM4 A;  4A0T A;  1Q6I A;  1QZ2 A;  5DIT A;  1UR9 A;  2JMF A;  1HJX A;  3FAP A;  2LPV A;  4DRH A;  3FS8 A;  2PPP A;  4ODP A;  4QT3 A;  2FAP A;  5GPG A;  2YBU A;  3BXW A;  2K8I A;  3MCB A;  4JFJ A;  5J6E A;  2KR7 A;  2XP8 A;  1ZU8 A;  1E6Z A;  2IUZ A;  1FD9 A;  4BF8 A;  1NMV A;  1F40 A;  4DRM A;  4MNJ A;  2WAE A;  2DSU A;  1FFQ A;  1LQ0 A;  3WKZ A;  4DWS D;  4TW6 A;  1XHG A;  4DWS C;  3WQW A;  3ALG A;  3MQG A;  1TCO C;  1ZK6 A;  2DPE A;  4DZ2 A;  3CHF A;  2XP6 A;  2N87 A;  5DO2 A;  3W4R A;  4PTM A;  3AQU A;  4ODQ A;  1FKG A;  4FAP A;  1FKS A;  1ZBW A;  4LGX A;  5AHT A;  1EG3 A;  1OGB A;  1LG1 A;  1Q6H A;  3IKD A;  4DWS A;  5BXJ A;  3KCE A;  4Z2H A;  1L1P A;  3ARY A;  4QT2 A;  5E66 A;  2F4E A;  4TW8 A;  3O5J A;  2MF9 A;  1HKJ A;  2RUR A;  4ODM A;  4P8V A;  3GPK A;  2O92 A;  3OA5 A;  4ZS6 A;  1I5H W;  4U86 A;  1ZBC A;  1C9H A;  2IF4 A;  3PR9 A;  5E62 A;  4P8X A;  3RFW A;  1K9Q A;  2M3O W;  3B7X A;  4WKF A;  3TCZ A;  3CH9 A;  1JNT A;  3LKX B;  2LGO A;  3QOK A;  4DRN A;  3O5G A;  4S3K A;  1QPL A;  3ARU A;  1FKF A;  1FKK A;  3NTP A;  2DJY A;  3IK8 A;  1O6I A;  2D9F A;  1EYM A;  4REX A;  1EDQ A;  3O5M A;  2MLX A;  4DRO A;  2FKE A;  3RM8 A;  1HXV A;  4U85 A;  1H0I A;  1WB0 A;  2F21 A;  3KAF A;  3G6M A;  1W1T A;  5HW7 A;  1E6P A;  3O5L A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...